F430504

General Info

Members Datasets Scaffolds Average Seq Length
386 134 386 637

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10008454|Ga0157369_1000845410
Length 635
Sequence MSERDKQASRSRGGDRNLFTRSGARLLSAAAAGDIGVDWPTIGNQQSPQPIPGQPQPLSVETTTDRSYTISLEGLDRIGNSSEVIAQFQQQSALYLDRKKRANAAQMERRAQADADLLGQILRSQGYYDADVEPTIQAQGQALTVALTADPGQQYQFQSVELPGLSGPEADKLRQAFSVKAGDPVVAQDVIAAGIALKIALGRLGFALAKVGEQQITVDHQTHLATLILPVDPGPVARFGAIRVTGKPPFDARHVQEIARFKPGDGFRQDKVDDLRRALIATGLLAAADIKVVPEPNGQAVDLVVDMQPAPPRTIAGELGYGTGEGISLQGSWEHRNLFPPEGALTLRGIAGTREQLAGVQFRRNNFKKRDQVLNLQLVASHTKYDAYTAKTIDIAADFERQSNIIWLKKWTWSLGTELLATDERGIFHDPTQKQTKTFLIAALPLSLAYDGSNDLLNPTKGYRLSAHVSPEYSLHGGSFGYSRAQLDASVYQPVSSNTVLAGRIRLGTIFGASALDIAPSRRFYSGGGGSVRGYGYQRIGPLDAQGDPIGGRSLAEFGLEARFRFGDLGVVPFLDGGSLTEKAAPDLRHWQLGTGVGFRYYSNFGPIRVDIGTPLNRRPGDGRIAVAVSLGQAF

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 4.66
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001895 3300001904 Bacteria 3725
2 JGI24740J21852_10001777 3300001979 Bacteria 9889
3 JGI24739J22299_10005420 3300001989 Bacteria 4848
4 JGI24737J22298_10004572 3300001990 Bacteria 4815
5 JGI24738J21930_10001535 3300002075 Bacteria 6372
6 JGI24744J21845_10001581 3300002077 Bacteria 4545
7 Ga0070658_10000247 3300005327 Bacteria 47860
8 Ga0070658_10001597 3300005327 Bacteria 19154
9 Ga0070658_10002061 3300005327 Bacteria 16856
10 Ga0070658_10023110 3300005327 Bacteria 4991
11 Ga0070658_10031570 3300005327 Bacteria 4254
12 Ga0070658_10060873 3300005327 Bacteria 3075
13 Ga0070658_10126301 3300005327 Bacteria 2129
14 Ga0070676_10005914 3300005328 Bacteria 6529
15 Ga0070683_100005621 3300005329 Bacteria 10478
16 Ga0070670_100075827 3300005331 Bacteria 2889
17 Ga0070666_10016360 3300005335 Bacteria 4745
18 Ga0070666_10023272 3300005335 Bacteria 4032
19 Ga0070680_100000707 3300005336 Bacteria 23165
20 Ga0070680_100003423 3300005336 Bacteria 11842
21 Ga0070680_100009222 3300005336 Bacteria 7567
22 Ga0070680_100009408 3300005336 Bacteria 7507
23 Ga0070680_100013665 3300005336 Bacteria 6330
24 Ga0070680_100058345 3300005336 Bacteria 3156
25 Ga0070682_100020258 3300005337 Bacteria 3912
26 Ga0070660_100000012 3300005339 Bacteria 123961
27 Ga0070660_100000760 3300005339 Bacteria 21407
28 Ga0070660_100001714 3300005339 Bacteria 15027
29 Ga0070660_100009409 3300005339 Bacteria 6870
30 Ga0070660_100013072 3300005339 Bacteria 5944
31 Ga0070660_100020028 3300005339 Bacteria 4910
32 Ga0070661_100000945 3300005344 Bacteria 20690
33 Ga0070661_100004237 3300005344 Bacteria 9890
34 Ga0070661_100009869 3300005344 Bacteria 6623
35 Ga0070661_100015085 3300005344 Bacteria 5452
36 Ga0070692_10001707 3300005345 Bacteria 8164
37 Ga0070692_10005390 3300005345 Bacteria 5449
38 Ga0070692_10033006 3300005345 Bacteria 2607
39 Ga0070668_100044353 3300005347 Bacteria 3412
40 Ga0070671_100000786 3300005355 Bacteria 22862
41 Ga0070671_100001188 3300005355 Bacteria 19501
42 Ga0070671_100014725 3300005355 Bacteria 6322
43 Ga0070671_100018934 3300005355 Bacteria 5597
44 Ga0070671_100029006 3300005355 Bacteria 4561
45 Ga0070671_100037937 3300005355 Bacteria 3998
46 Ga0070673_100010010 3300005364 Bacteria 6396
47 Ga0070659_100001272 3300005366 Bacteria 18288
48 Ga0070659_100017546 3300005366 Bacteria 5391
49 Ga0070659_100018758 3300005366 Bacteria 5222
50 Ga0070659_100033802 3300005366 Bacteria 3974
51 Ga0070659_100037853 3300005366 Bacteria 3761
52 Ga0070659_100111225 3300005366 Bacteria 2211
53 Ga0070667_100003546 3300005367 Bacteria 13300
54 Ga0070667_100019515 3300005367 Bacteria 5625
55 Ga0070663_100001011 3300005455 Bacteria 15326
56 Ga0070663_100011091 3300005455 Bacteria 5642
57 Ga0070663_100023645 3300005455 Bacteria 4121
58 Ga0070663_100066526 3300005455 Bacteria 2611
59 Ga0070678_100001707 3300005456 Bacteria 11796
60 Ga0070678_100018230 3300005456 Bacteria 4547
61 Ga0070678_100040309 3300005456 Bacteria 3304
62 Ga0070662_100001296 3300005457 Bacteria 15362
63 Ga0070681_10002173 3300005458 Bacteria 17844
64 Ga0070681_10096302 3300005458 Bacteria 2908
65 Ga0070679_100034191 3300005530 Bacteria 5037
66 Ga0070679_100056892 3300005530 Bacteria 3897
67 Ga0070679_100058539 3300005530 Bacteria 3839
68 Ga0068853_100080411 3300005539 Bacteria 2851
69 Ga0070672_100038415 3300005543 Bacteria 3658
70 Ga0070665_100002314 3300005548 Bacteria 21146
71 Ga0070665_100017450 3300005548 Bacteria 7206
72 Ga0068855_100000135 3300005563 Bacteria 94502
73 Ga0068855_100001750 3300005563 Bacteria 27115
74 Ga0068855_100047538 3300005563 Bacteria 5069
75 Ga0068855_100063453 3300005563 Bacteria 4311
76 Ga0070664_100001382 3300005564 Bacteria 19334
77 Ga0070664_100010967 3300005564 Bacteria 7347
78 Ga0070664_100016287 3300005564 Bacteria 6094
79 Ga0070664_100019403 3300005564 Bacteria 5595
80 Ga0068857_100013947 3300005577 Bacteria 6993
81 Ga0068854_100002927 3300005578 Bacteria 10595
82 Ga0068854_100007829 3300005578 Bacteria 6839
83 Ga0068854_100022288 3300005578 Bacteria 4311
84 Ga0068854_100026794 3300005578 Bacteria 3965
85 Ga0068854_100072856 3300005578 Bacteria 2516
86 Ga0068856_100007289 3300005614 Bacteria 10790
87 Ga0068856_100014596 3300005614 Bacteria 7590
88 Ga0068856_100039421 3300005614 Bacteria 4638
89 Ga0068856_100058497 3300005614 Bacteria 3806
90 Ga0068852_100001670 3300005616 Bacteria 15121
91 Ga0068852_100001848 3300005616 Bacteria 14394
92 Ga0068852_100004359 3300005616 Bacteria 9993
93 Ga0068852_100006893 3300005616 Bacteria 8258
94 Ga0068852_100037619 3300005616 Unclassified 4059
95 Ga0068859_100011043 3300005617 Bacteria 9087
96 Ga0068859_100011674 3300005617 Bacteria 8828
97 Ga0068859_100066534 3300005617 Bacteria 3638
98 Ga0068864_100001999 3300005618 Bacteria 16790
99 Ga0068864_100004239 3300005618 Bacteria 11799
100 Ga0068864_100026489 3300005618 Bacteria 4889
101 Ga0068864_100033350 3300005618 Bacteria 4377
102 Ga0068864_100036125 3300005618 Bacteria 4210
103 Ga0068863_100020913 3300005841 Bacteria 6250
104 Ga0068858_100001819 3300005842 Bacteria 21706
105 Ga0068858_100005781 3300005842 Bacteria 12080
106 Ga0068858_100009022 3300005842 Bacteria 9537
107 Ga0068860_100002225 3300005843 Bacteria 20416
108 Ga0068862_100021091 3300005844 Bacteria 5446
109 Ga0068862_100021282 3300005844 Bacteria 5420
110 Ga0097621_100015673 3300006237 Bacteria 5711
111 Ga0097620_100011044 3300006931 Bacteria 9087
112 Ga0097620_100011674 3300006931 Bacteria 8828
113 Ga0097620_100066533 3300006931 Bacteria 3638
114 Ga0105240_10004421 3300009093 Bacteria 21431
115 Ga0105240_10015481 3300009093 Bacteria 10368
116 Ga0105240_10019267 3300009093 Bacteria 9119
117 Ga0105240_10189732 3300009093 Bacteria 2417
118 Ga0105245_10010121 3300009098 Bacteria 8213
119 Ga0105248_10000168 3300009177 Bacteria 76376
120 Ga0105248_10001480 3300009177 Bacteria 26140
121 Ga0105248_10005033 3300009177 Bacteria 14597
122 Ga0105248_10010319 3300009177 Bacteria 10279
123 Ga0105237_10049903 3300009545 Bacteria 4205
124 Ga0105238_10020349 3300009551 Bacteria 6755
125 Ga0157373_10003364 3300013100 Bacteria 12090
126 Ga0157373_10031684 3300013100 Bacteria 3806
127 Ga0157371_10003202 3300013102 Bacteria 15029
128 Ga0157370_10020072 3300013104 Bacteria 6684
129 Ga0157370_10022521 3300013104 Bacteria 6269
130 Ga0157370_10034923 3300013104 Bacteria 4892
131 Ga0157369_10000185 3300013105 Bacteria 86285
132 Ga0157369_10008454 3300013105 Bacteria 11806
133 Ga0157369_10023517 3300013105 Bacteria 6863
134 Ga0157369_10023804 3300013105 Bacteria 6819
135 Ga0157369_10024824 3300013105 Bacteria 6660
136 Ga0157369_10117487 3300013105 Bacteria 2823
137 Ga0157374_10070068 3300013296 Bacteria 3303
138 Ga0157374_10100062 3300013296 Bacteria 2778
139 Ga0157372_10004460 3300013307 Bacteria 14932
140 Ga0157372_10023500 3300013307 Bacteria 6683
141 Ga0157372_10101241 3300013307 Bacteria 3289
142 Ga0157372_10180589 3300013307 Bacteria 2443
143 Ga0157375_10002694 3300013308 Bacteria 15380
144 Ga0163163_10002906 3300014325 Bacteria 14496
145 Ga0157379_10023869 3300014968 Bacteria 5429
146 Ga0213875_10003888 3300021388 Bacteria 8357
147 Ga0207682_10003716 3300025893 Bacteria 6573
148 Ga0207688_10009556 3300025901 Bacteria 5278
149 Ga0207680_10021429 3300025903 Bacteria 3496
150 Ga0207647_10004451 3300025904 Bacteria 10383
151 Ga0207647_10008216 3300025904 Bacteria 7500
152 Ga0207647_10009956 3300025904 Bacteria 6733
153 Ga0207647_10010666 3300025904 Bacteria 6477
154 Ga0207645_10009456 3300025907 Bacteria 6740
155 Ga0207705_10000003 3300025909 Bacteria 709270
156 Ga0207705_10000050 3300025909 Bacteria 170078
157 Ga0207705_10000578 3300025909 Bacteria 30673
158 Ga0207705_10000617 3300025909 Bacteria 29732
159 Ga0207705_10001308 3300025909 Bacteria 19980
160 Ga0207705_10014635 3300025909 Bacteria 5643
161 Ga0207705_10024682 3300025909 Bacteria 4289
162 Ga0207705_10026523 3300025909 Bacteria 4132
163 Ga0207695_10017848 3300025913 Bacteria 8226
164 Ga0207660_10000491 3300025917 Bacteria 26376
165 Ga0207660_10011725 3300025917 Bacteria 5715
166 Ga0207660_10012884 3300025917 Bacteria 5476
167 Ga0207660_10024043 3300025917 Bacteria 4121
168 Ga0207657_10000038 3300025919 Bacteria 123940
169 Ga0207657_10000121 3300025919 Bacteria 78211
170 Ga0207657_10000471 3300025919 Bacteria 42534
171 Ga0207657_10000576 3300025919 Bacteria 38985
172 Ga0207657_10002094 3300025919 Bacteria 21586
173 Ga0207657_10002128 3300025919 Bacteria 21447
174 Ga0207657_10002159 3300025919 Bacteria 21321
175 Ga0207657_10003113 3300025919 Bacteria 17743
176 Ga0207657_10008276 3300025919 Bacteria 10586
177 Ga0207657_10014079 3300025919 Bacteria 7827
178 Ga0207657_10020246 3300025919 Bacteria 6294
179 Ga0207657_10026859 3300025919 Bacteria 5280
180 Ga0207657_10038989 3300025919 Bacteria 4224
181 Ga0207657_10050172 3300025919 Bacteria 3632
182 Ga0207649_10000187 3300025920 Bacteria 50808
183 Ga0207649_10002482 3300025920 Bacteria 10310
184 Ga0207649_10003927 3300025920 Bacteria 8107
185 Ga0207649_10015133 3300025920 Bacteria 4331
186 Ga0207649_10016772 3300025920 Bacteria 4141
187 Ga0207649_10023258 3300025920 Bacteria 3587
188 Ga0207652_10004731 3300025921 Bacteria 11037
189 Ga0207652_10028955 3300025921 Bacteria 4625
190 Ga0207652_10078607 3300025921 Bacteria 2881
191 Ga0207652_10079762 3300025921 Bacteria 2860
192 Ga0207681_10021369 3300025923 Bacteria 4113
193 Ga0207694_10009416 3300025924 Bacteria 7366
194 Ga0207694_10016364 3300025924 Bacteria 5599
195 Ga0207694_10042700 3300025924 Bacteria 3498
196 Ga0207650_10009136 3300025925 Bacteria 6773
197 Ga0207650_10009783 3300025925 Bacteria 6555
198 Ga0207650_10016557 3300025925 Bacteria 5156
199 Ga0207644_10000741 3300025931 Bacteria 20675
200 Ga0207644_10003708 3300025931 Bacteria 9900
201 Ga0207644_10026049 3300025931 Bacteria 4026
202 Ga0207690_10002005 3300025932 Bacteria 12470
203 Ga0207690_10010623 3300025932 Bacteria 5483
204 Ga0207706_10000061 3300025933 Bacteria 109447
205 Ga0207706_10000480 3300025933 Bacteria 42754
206 Ga0207706_10005527 3300025933 Bacteria 11784
207 Ga0207706_10008262 3300025933 Bacteria 9605
208 Ga0207706_10008935 3300025933 Bacteria 9224
209 Ga0207706_10010336 3300025933 Bacteria 8530
210 Ga0207706_10086573 3300025933 Bacteria 2754
211 Ga0207691_10025291 3300025940 Bacteria 5575
212 Ga0207691_10098911 3300025940 Unclassified 2605
213 Ga0207711_10000044 3300025941 Bacteria 157113
214 Ga0207711_10001567 3300025941 Bacteria 21131
215 Ga0207711_10004458 3300025941 Bacteria 11935
216 Ga0207711_10081586 3300025941 Bacteria 2826
217 Ga0207661_10000125 3300025944 Bacteria 48789
218 Ga0207661_10004204 3300025944 Bacteria 10069
219 Ga0207679_10000631 3300025945 Bacteria 23451
220 Ga0207679_10011943 3300025945 Bacteria 5644
221 Ga0207679_10108750 3300025945 Unclassified 2184
222 Ga0207667_10001013 3300025949 Bacteria 35783
223 Ga0207667_10005967 3300025949 Bacteria 14826
224 Ga0207667_10019863 3300025949 Bacteria 7486
225 Ga0207667_10021254 3300025949 Bacteria 7193
226 Ga0207667_10024405 3300025949 Bacteria 6638
227 Ga0207667_10046504 3300025949 Bacteria 4595
228 Ga0207667_10093227 3300025949 Bacteria 3110
229 Ga0207712_10021139 3300025961 Bacteria 4269
230 Ga0207640_10003065 3300025981 Bacteria 9004
231 Ga0207640_10005496 3300025981 Bacteria 6909
232 Ga0207640_10031424 3300025981 Bacteria 3281
233 Ga0207658_10003825 3300025986 Bacteria 10601
234 Ga0207658_10006286 3300025986 Bacteria 8113
235 Ga0207658_10040424 3300025986 Bacteria 3371
236 Ga0207677_10001069 3300026023 Bacteria 14951
237 Ga0207677_10010808 3300026023 Bacteria 5177
238 Ga0207639_10000373 3300026041 Bacteria 30956
239 Ga0207639_10002088 3300026041 Bacteria 13446
240 Ga0207639_10043581 3300026041 Bacteria 3370
241 Ga0207678_10002446 3300026067 Bacteria 16879
242 Ga0207678_10002961 3300026067 Bacteria 15380
243 Ga0207678_10005673 3300026067 Bacteria 11154
244 Ga0207678_10050555 3300026067 Bacteria 3591
245 Ga0207678_10067099 3300026067 Bacteria 3079
246 Ga0207702_10004861 3300026078 Bacteria 11833
247 Ga0207702_10005552 3300026078 Bacteria 11015
248 Ga0207702_10028271 3300026078 Bacteria 4659
249 Ga0207702_10029229 3300026078 Bacteria 4585
250 Ga0207702_10034964 3300026078 Bacteria 4202
251 Ga0207641_10002884 3300026088 Bacteria 15571
252 Ga0207641_10055244 3300026088 Bacteria 3371
253 Ga0207648_10002037 3300026089 Bacteria 22055
254 Ga0207676_10002924 3300026095 Bacteria 12175
255 Ga0207676_10002969 3300026095 Bacteria 12105
256 Ga0207676_10010086 3300026095 Bacteria 6722
257 Ga0207676_10013791 3300026095 Bacteria 5802
258 Ga0207676_10026011 3300026095 Bacteria 4347
259 Ga0207674_10000758 3300026116 Bacteria 42236
260 Ga0207674_10002617 3300026116 Bacteria 22550
261 Ga0207674_10006253 3300026116 Bacteria 14033
262 Ga0207674_10012585 3300026116 Bacteria 9455
263 Ga0207674_10035080 3300026116 Bacteria 5237
264 Ga0207683_10020676 3300026121 Bacteria 5631
265 Ga0207698_10000798 3300026142 Bacteria 18308
266 Ga0207698_10001287 3300026142 Bacteria 14621
267 Ga0207698_10002047 3300026142 Bacteria 11893
268 Ga0207698_10003074 3300026142 Bacteria 10004
269 Ga0207698_10006334 3300026142 Bacteria 7373
270 Ga0207698_10010876 3300026142 Bacteria 5875
271 Ga0268266_10028779 3300028379 Bacteria 4722
272 Ga0268265_10020360 3300028380 Bacteria 4629
273 Ga0268264_10007076 3300028381 Bacteria 9401
274 Ga0307410_10019575 3300031852 Bacteria 4121
275 Ga0307406_10020641 3300031901 Bacteria 3883
276 Ga0307416_100037248 3300032002 Bacteria 3740
277 Ga0373931_0006657 3300035691 Bacteria 5412
278 Ga0395899_0000419 3300037312 Bacteria 49177
279 Ga0395899_0038745 3300037312 Bacteria 3568
280 Ga0395899_0078945 3300037312 Bacteria 2398
281 Ga0395900_0000817 3300037418 Bacteria 41225
282 Ga0395900_0002988 3300037418 Bacteria 18402
283 Ga0395900_0003442 3300037418 Bacteria 17112
284 Ga0395900_0020258 3300037418 Bacteria 6788
285 Ga0395900_0023278 3300037418 Bacteria 6339
286 Ga0395900_0048308 3300037418 Bacteria 4383
287 Ga0395900_0050569 3300037418 Bacteria 4280
288 Ga0395900_0059692 3300037418 Bacteria 3926
289 Ga0395900_0065150 3300037418 Bacteria 3743
290 Ga0395900_0066957 3300037418 Bacteria 3691
291 Ga0395900_0079581 3300037418 Bacteria 3368
292 Ga0395900_0080275 3300037418 Bacteria 3352
293 Ga0395900_0087159 3300037418 Bacteria 3209
294 Ga0395900_0113636 3300037418 Bacteria 2779
295 Ga0395900_0117365 3300037418 Bacteria 2730
296 Ga0395898_0012294 3300037466 Bacteria 8853
297 Ga0395898_0015567 3300037466 Bacteria 7798
298 Ga0395898_0017963 3300037466 Bacteria 7216
299 Ga0395898_0019218 3300037466 Bacteria 6955
300 Ga0395898_0026832 3300037466 Bacteria 5789
301 Ga0395898_0041197 3300037466 Bacteria 4562
302 Ga0395898_0084245 3300037466 Bacteria 3064
303 Ga0395898_0095275 3300037466 Bacteria 2860
304 Ga0395898_0106781 3300037466 Bacteria 2685
305 Ga0395905_0000092 3300037471 Bacteria 149300
306 Ga0395905_0004217 3300037471 Bacteria 15031
307 Ga0395905_0006512 3300037471 Bacteria 11745
308 Ga0395905_0008306 3300037471 Bacteria 10243
309 Ga0395905_0010835 3300037471 Bacteria 8831
310 Ga0395905_0011462 3300037471 Bacteria 8567
311 Ga0395905_0016929 3300037471 Bacteria 6924
312 Ga0395905_0017087 3300037471 Bacteria 6889
313 Ga0395905_0018494 3300037471 Bacteria 6613
314 Ga0395905_0019509 3300037471 Bacteria 6426
315 Ga0395905_0021545 3300037471 Bacteria 6093
316 Ga0395905_0024776 3300037471 Bacteria 5662
317 Ga0395905_0030352 3300037471 Bacteria 5094
318 Ga0395905_0042841 3300037471 Bacteria 4246
319 Ga0395905_0074640 3300037471 Bacteria 3178
320 Ga0395905_0076289 3300037471 Unclassified 3141
321 Ga0395905_0131306 3300037471 Bacteria 2355
322 Ga0436364_0130435 3300037853 Bacteria 29193
323 Ga0395901_0000030 3300038443 Bacteria 241916
324 Ga0395901_0000188 3300038443 Bacteria 78908
325 Ga0395901_0010244 3300038443 Bacteria 9496
326 Ga0395901_0010666 3300038443 Bacteria 9313
327 Ga0395901_0018151 3300038443 Bacteria 7180
328 Ga0395901_0018706 3300038443 Bacteria 7076
329 Ga0395901_0021992 3300038443 Bacteria 6537
330 Ga0395901_0025225 3300038443 Bacteria 6103
331 Ga0395901_0026876 3300038443 Bacteria 5908
332 Ga0395901_0029594 3300038443 Bacteria 5640
333 Ga0395901_0034407 3300038443 Bacteria 5232
334 Ga0395901_0049734 3300038443 Bacteria 4356
335 Ga0395901_0050129 3300038443 Unclassified 4338
336 Ga0395901_0059429 3300038443 Bacteria 3977
337 Ga0395901_0060885 3300038443 Bacteria 3928
338 Ga0395901_0074938 3300038443 Bacteria 3530
339 Ga0395901_0121690 3300038443 Bacteria 2742
340 Ga0395901_0122021 3300038443 Bacteria 2739
341 Ga0395901_0171789 3300038443 Bacteria 2274
342 Ga0395901_0228478 3300038443 Bacteria 1943
343 Ga0450889_000116 3300042144 Bacteria 7855
344 Ga0466966_0000004 3300044684 Bacteria 223594
345 Ga0466966_0059449 3300044684 Bacteria 2414
346 Ga0466961_0001994 3300044693 Bacteria 12706
347 Ga0466963_0007364 3300044694 Bacteria 6556
348 Ga0466963_0010090 3300044694 Bacteria 5711
349 Ga0466963_0053646 3300044694 Bacteria 2677
350 Ga0466970_0003633 3300044765 Bacteria 7522
351 Ga0466970_0013043 3300044765 Bacteria 4259
352 Ga0466970_0021678 3300044765 Bacteria 3348
353 Ga0466957_0001592 3300044842 Bacteria 11931
354 Ga0466957_0007833 3300044842 Bacteria 6054
355 Ga0466957_0026157 3300044842 Bacteria 3461
356 Ga0466959_0009854 3300045049 Bacteria 6808
357 Ga0466959_0058842 3300045049 Bacteria 2799
358 Ga0466958_0001099 3300045836 Bacteria 12466
359 Ga0466967_0006968 3300045976 Bacteria 8088
360 Ga0466967_0020833 3300045976 Bacteria 5310
361 Ga0466967_0052434 3300045976 Bacteria 3580
362 Ga0495598_0000516 3300046537 Bacteria 7164
363 Ga0495621_0000519 3300046539 Bacteria 9514
364 Ga0495668_0002564 3300046616 Bacteria 14767
365 Ga0495670_0007845 3300046691 Bacteria 5250
366 Ga0496100_0011823 3300048903 Bacteria 4981
367 Ga0496102_0033435 3300048905 Bacteria 4622
368 Ga0496103_0019777 3300048906 Bacteria 4042
369 Ga0496106_0004488 3300048909 Bacteria 10354
370 Ga0496106_0035412 3300048909 Bacteria 3733
371 Ga0496107_0023180 3300048910 Bacteria 4388
372 Ga0496107_0065755 3300048910 Bacteria 2629
373 Ga0496108_0005509 3300048911 Bacteria 10241
374 Ga0496108_0007467 3300048911 Bacteria 8861
375 Ga0496108_0091813 3300048911 Bacteria 2581
376 Ga0496109_0019485 3300048912 Bacteria 5986
377 Ga0496110_0058303 3300048913 Bacteria 3401
378 Ga0496111_0000588 3300048914 Bacteria 19077
379 Ga0496112_0001074 3300048915 Bacteria 20212
380 Ga0496113_0000358 3300048916 Bacteria 21890
381 Ga0496113_0014659 3300048916 Bacteria 5357
382 Ga0496113_0019945 3300048916 Bacteria 4702
383 Ga0496114_0000019 3300048917 Bacteria 244365
384 Ga0501080_0009041 3300049742 Bacteria 9068
385 Ga0500658_0000041 3300053134 Bacteria 77435
386 Ga0466962_0004650 3300061719 Bacteria 6593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0059449 Ga0466966_0059449_77_1807 572
2 3300048917 Ga0496114_0000019 Ga0496114_0000019_64483_66213 572
3 3300025909 Ga0207705_10024682 Ga0207705_100246822 577
4 3300038443 Ga0395901_0025225 Ga0395901_0025225_4141_5919 582
5 3300038443 Ga0395901_0049734 Ga0395901_0049734_2520_4298 582
6 3300037418 Ga0395900_0079581 Ga0395900_0079581_1107_2954 586
7 3300005841 Ga0068863_100020913 Ga0068863_1000209137 588
8 3300037466 Ga0395898_0095275 Ga0395898_0095275_379_2352 588
9 3300048910 Ga0496107_0065755 Ga0496107_0065755_774_2609 591
10 3300005844 Ga0068862_100021091 Ga0068862_1000210917 596
11 3300028380 Ga0268265_10020360 Ga0268265_100203602 596
12 3300061719 Ga0466962_0004650 Ga0466962_0004650_208_2145 596
13 3300021388 Ga0213875_10003888 Ga0213875_100038882 597
14 3300037853 Ga0436364_0130435 Ga0436364_0130435_10295_12268 597
15 3300005456 Ga0070678_100001707 Ga0070678_1000017072 598
16 3300025931 Ga0207644_10003708 Ga0207644_100037084 598
17 3300037418 Ga0395900_0065150 Ga0395900_0065150_237_2111 598
18 3300037466 Ga0395898_0106781 Ga0395898_0106781_73_2085 598
19 3300005336 Ga0070680_100009222 Ga0070680_10000922210 599
20 3300005339 Ga0070660_100020028 Ga0070660_1000200282 599
21 3300005530 Ga0070679_100034191 Ga0070679_1000341912 599
22 3300005327 Ga0070658_10031570 Ga0070658_100315706 601
23 3300005366 Ga0070659_100018758 Ga0070659_1000187586 601
24 3300005564 Ga0070664_100019403 Ga0070664_1000194032 601
25 3300025919 Ga0207657_10002094 Ga0207657_100020942 601
26 3300025945 Ga0207679_10011943 Ga0207679_100119432 601
27 3300026116 Ga0207674_10012585 Ga0207674_100125852 601
28 3300037418 Ga0395900_0023278 Ga0395900_0023278_3837_5684 602
29 3300037466 Ga0395898_0017963 Ga0395898_0017963_1588_3435 602
30 3300037471 Ga0395905_0018494 Ga0395905_0018494_2609_4456 602
31 3300037471 Ga0395905_0030352 Ga0395905_0030352_204_2054 602
32 3300038443 Ga0395901_0050129 Ga0395901_0050129_1515_3362 602
33 3300038443 Ga0395901_0059429 Ga0395901_0059429_1393_3243 602
34 3300048911 Ga0496108_0005509 Ga0496108_0005509_6774_8795 602
35 3300048916 Ga0496113_0019945 Ga0496113_0019945_659_2680 602
36 3300037418 Ga0395900_0080275 Ga0395900_0080275_468_2312 603
37 3300045049 Ga0466959_0058842 Ga0466959_0058842_80_1918 603
38 3300005327 Ga0070658_10001597 Ga0070658_100015974 604
39 3300005339 Ga0070660_100001714 Ga0070660_10000171410 604
40 3300005539 Ga0068853_100080411 Ga0068853_1000804113 604
41 3300005563 Ga0068855_100000135 Ga0068855_10000013593 604
42 3300005616 Ga0068852_100037619 Ga0068852_1000376192 604
43 3300025909 Ga0207705_10000050 Ga0207705_1000005080 604
44 3300025919 Ga0207657_10000121 Ga0207657_100001214 604
45 3300025949 Ga0207667_10001013 Ga0207667_100010134 604
46 3300026142 Ga0207698_10010876 Ga0207698_100108762 604
47 3300031852 Ga0307410_10019575 Ga0307410_100195752 604
48 3300037471 Ga0395905_0131306 Ga0395905_0131306_488_2329 604
49 3300049742 Ga0501080_0009041 Ga0501080_0009041_5467_7320 604
50 3300005344 Ga0070661_100015085 Ga0070661_1000150854 605
51 3300005355 Ga0070671_100014725 Ga0070671_1000147255 605
52 3300005564 Ga0070664_100016287 Ga0070664_1000162872 605
53 3300005614 Ga0068856_100014596 Ga0068856_1000145962 605
54 3300005617 Ga0068859_100011043 Ga0068859_1000110432 605
55 3300005618 Ga0068864_100001999 Ga0068864_1000019995 605
56 3300006931 Ga0097620_100011044 Ga0097620_1000110442 605
57 3300009545 Ga0105237_10049903 Ga0105237_100499036 605
58 3300014968 Ga0157379_10023869 Ga0157379_100238692 605
59 3300025920 Ga0207649_10023258 Ga0207649_100232585 605
60 3300026078 Ga0207702_10005552 Ga0207702_100055522 605
61 3300026095 Ga0207676_10002924 Ga0207676_100029247 605
62 3300026116 Ga0207674_10002617 Ga0207674_1000261716 605
63 3300037418 Ga0395900_0066957 Ga0395900_0066957_378_2207 605
64 3300037471 Ga0395905_0016929 Ga0395905_0016929_4322_6166 605
65 3300044765 Ga0466970_0013043 Ga0466970_0013043_2147_3985 605
66 3300048905 Ga0496102_0033435 Ga0496102_0033435_1861_3705 605
67 3300048906 Ga0496103_0019777 Ga0496103_0019777_1861_3705 605
68 3300048909 Ga0496106_0035412 Ga0496106_0035412_759_2603 605
69 3300048916 Ga0496113_0000358 Ga0496113_0000358_18593_20437 605
70 3300005345 Ga0070692_10005390 Ga0070692_100053904 606
71 3300005548 Ga0070665_100017450 Ga0070665_10001745010 606
72 3300005564 Ga0070664_100010967 Ga0070664_1000109679 606
73 3300005578 Ga0068854_100007829 Ga0068854_1000078292 606
74 3300005842 Ga0068858_100001819 Ga0068858_1000018192 606
75 3300005842 Ga0068858_100009022 Ga0068858_1000090224 606
76 3300006237 Ga0097621_100015673 Ga0097621_1000156739 606
77 3300025904 Ga0207647_10008216 Ga0207647_100082165 606
78 3300025909 Ga0207705_10000003 Ga0207705_10000003284 606
79 3300025909 Ga0207705_10001308 Ga0207705_1000130811 606
80 3300025919 Ga0207657_10014079 Ga0207657_100140795 606
81 3300025920 Ga0207649_10002482 Ga0207649_100024825 606
82 3300025925 Ga0207650_10009783 Ga0207650_100097833 606
83 3300025933 Ga0207706_10000480 Ga0207706_1000048037 606
84 3300025949 Ga0207667_10021254 Ga0207667_100212542 606
85 3300025981 Ga0207640_10003065 Ga0207640_100030652 606
86 3300025986 Ga0207658_10040424 Ga0207658_100404242 606
87 3300026088 Ga0207641_10055244 Ga0207641_100552442 606
88 3300026142 Ga0207698_10006334 Ga0207698_100063342 606
89 3300038443 Ga0395901_0228478 Ga0395901_0228478_47_1885 606
90 3300044694 Ga0466963_0007364 Ga0466963_0007364_3049_4869 606
91 3300044694 Ga0466963_0053646 Ga0466963_0053646_61_1917 606
92 3300048911 Ga0496108_0007467 Ga0496108_0007467_2138_4000 606
93 3300037466 Ga0395898_0019218 Ga0395898_0019218_3235_5214 607
94 3300044684 Ga0466966_0000004 Ga0466966_0000004_131752_133695 607
95 3300005355 Ga0070671_100029006 Ga0070671_1000290067 608
96 3300009177 Ga0105248_10001480 Ga0105248_100014808 608
97 3300048903 Ga0496100_0011823 Ga0496100_0011823_2976_4841 608
98 3300048909 Ga0496106_0004488 Ga0496106_0004488_7542_9407 608
99 3300048910 Ga0496107_0023180 Ga0496107_0023180_1496_3361 608
100 3300048911 Ga0496108_0091813 Ga0496108_0091813_62_1927 608
101 3300048912 Ga0496109_0019485 Ga0496109_0019485_3302_5167 608
102 3300048914 Ga0496111_0000588 Ga0496111_0000588_4309_6174 608
103 3300048915 Ga0496112_0001074 Ga0496112_0001074_2363_4228 608
104 3300048916 Ga0496113_0014659 Ga0496113_0014659_2888_4753 608
105 3300009093 Ga0105240_10015481 Ga0105240_1001548110 609
106 3300013104 Ga0157370_10022521 Ga0157370_100225215 609
107 3300013105 Ga0157369_10117487 Ga0157369_101174872 609
108 3300038443 Ga0395901_0074938 Ga0395901_0074938_580_2553 610
109 3300045976 Ga0466967_0006968 Ga0466967_0006968_1884_3881 610
110 3300046537 Ga0495598_0000516 Ga0495598_0000516_4380_6326 610
111 3300046539 Ga0495621_0000519 Ga0495621_0000519_1794_3740 610
112 3300046691 Ga0495670_0007845 Ga0495670_0007845_1170_3116 610
113 3300009098 Ga0105245_10010121 Ga0105245_100101213 611
114 3300025919 Ga0207657_10000576 Ga0207657_1000057628 612
115 3300037312 Ga0395899_0078945 Ga0395899_0078945_351_2342 612
116 3300038443 Ga0395901_0018151 Ga0395901_0018151_2523_4514 612
117 3300013102 Ga0157371_10003202 Ga0157371_100032024 613
118 3300037418 Ga0395900_0059692 Ga0395900_0059692_773_2713 613
119 3300037471 Ga0395905_0076289 Ga0395905_0076289_706_2679 613
120 3300013105 Ga0157369_10000185 Ga0157369_100001858 614
121 3300005336 Ga0070680_100009408 Ga0070680_1000094084 615
122 3300005458 Ga0070681_10096302 Ga0070681_100963022 615
123 3300005530 Ga0070679_100058539 Ga0070679_1000585392 615
124 3300005616 Ga0068852_100006893 Ga0068852_1000068932 615
125 3300005844 Ga0068862_100021282 Ga0068862_1000212824 615
126 3300025917 Ga0207660_10011725 Ga0207660_100117255 615
127 3300025921 Ga0207652_10078607 Ga0207652_100786072 615
128 3300025924 Ga0207694_10016364 Ga0207694_100163642 615
129 3300025949 Ga0207667_10019863 Ga0207667_100198635 615
130 3300026078 Ga0207702_10029229 Ga0207702_100292292 615
131 3300026142 Ga0207698_10002047 Ga0207698_100020472 615
132 3300046616 Ga0495668_0002564 Ga0495668_0002564_4814_6727 615
133 3300053134 Ga0500658_0000041 Ga0500658_0000041_66406_68319 615
134 3300005563 Ga0068855_100047538 Ga0068855_1000475384 616
135 3300005563 Ga0068855_100063453 Ga0068855_1000634533 616
136 3300005578 Ga0068854_100072856 Ga0068854_1000728562 616
137 3300005614 Ga0068856_100058497 Ga0068856_1000584972 616
138 3300005618 Ga0068864_100004239 Ga0068864_1000042393 616
139 3300013104 Ga0157370_10034923 Ga0157370_100349232 616
140 3300025919 Ga0207657_10026859 Ga0207657_100268592 616
141 3300025921 Ga0207652_10004731 Ga0207652_100047317 616
142 3300025941 Ga0207711_10001567 Ga0207711_1000156718 616
143 3300025949 Ga0207667_10046504 Ga0207667_100465044 616
144 3300026067 Ga0207678_10050555 Ga0207678_100505554 616
145 3300026095 Ga0207676_10002969 Ga0207676_100029695 616
146 3300037418 Ga0395900_0002988 Ga0395900_0002988_4346_6370 616
147 3300037466 Ga0395898_0026832 Ga0395898_0026832_1349_3373 616
148 3300037471 Ga0395905_0042841 Ga0395905_0042841_1312_3336 616
149 3300038443 Ga0395901_0026876 Ga0395901_0026876_2417_4441 616
150 3300038443 Ga0395901_0121690 Ga0395901_0121690_75_2099 616
151 3300005366 Ga0070659_100037853 Ga0070659_1000378531 617
152 3300005458 Ga0070681_10002173 Ga0070681_100021735 617
153 3300005614 Ga0068856_100007289 Ga0068856_1000072892 617
154 3300013100 Ga0157373_10003364 Ga0157373_100033642 617
155 3300025920 Ga0207649_10003927 Ga0207649_100039273 617
156 3300025949 Ga0207667_10024405 Ga0207667_100244057 617
157 3300026078 Ga0207702_10034964 Ga0207702_100349643 617
158 3300044693 Ga0466961_0001994 Ga0466961_0001994_7973_9910 617
159 3300044694 Ga0466963_0010090 Ga0466963_0010090_2556_4493 617
160 3300044765 Ga0466970_0003633 Ga0466970_0003633_1733_3670 617
161 3300044842 Ga0466957_0001592 Ga0466957_0001592_3845_5782 617
162 3300044842 Ga0466957_0007833 Ga0466957_0007833_247_2211 617
163 3300045049 Ga0466959_0009854 Ga0466959_0009854_4748_6685 617
164 3300045836 Ga0466958_0001099 Ga0466958_0001099_4932_6869 617
165 3300002075 JGI24738J21930_10001535 JGI24738J21930_100015352 618
166 3300005327 Ga0070658_10000247 Ga0070658_1000024738 618
167 3300005329 Ga0070683_100005621 Ga0070683_1000056211 618
168 3300005337 Ga0070682_100020258 Ga0070682_1000202583 618
169 3300005339 Ga0070660_100000012 Ga0070660_100000012123 618
170 3300005344 Ga0070661_100000945 Ga0070661_1000009457 618
171 3300005355 Ga0070671_100037937 Ga0070671_1000379373 618
172 3300005366 Ga0070659_100001272 Ga0070659_10000127214 618
173 3300005367 Ga0070667_100019515 Ga0070667_1000195152 618
174 3300005455 Ga0070663_100011091 Ga0070663_1000110912 618
175 3300005455 Ga0070663_100066526 Ga0070663_1000665262 618
176 3300005457 Ga0070662_100001296 Ga0070662_1000012969 618
177 3300005548 Ga0070665_100002314 Ga0070665_1000023148 618
178 3300005563 Ga0068855_100001750 Ga0068855_1000017508 618
179 3300005564 Ga0070664_100001382 Ga0070664_1000013827 618
180 3300005616 Ga0068852_100001670 Ga0068852_1000016708 618
181 3300005617 Ga0068859_100066534 Ga0068859_1000665346 618
182 3300005618 Ga0068864_100036125 Ga0068864_1000361252 618
183 3300006931 Ga0097620_100066533 Ga0097620_1000665331 618
184 3300009177 Ga0105248_10000168 Ga0105248_100001687 618
185 3300013100 Ga0157373_10031684 Ga0157373_100316841 618
186 3300025904 Ga0207647_10010666 Ga0207647_100106663 618
187 3300025909 Ga0207705_10000578 Ga0207705_1000057822 618
188 3300025909 Ga0207705_10000617 Ga0207705_1000061726 618
189 3300025919 Ga0207657_10000038 Ga0207657_1000003813 618
190 3300025919 Ga0207657_10020246 Ga0207657_100202462 618
191 3300025920 Ga0207649_10000187 Ga0207649_100001878 618
192 3300025931 Ga0207644_10026049 Ga0207644_100260492 618
193 3300025932 Ga0207690_10002005 Ga0207690_100020055 618
194 3300025933 Ga0207706_10000061 Ga0207706_10000061109 618
195 3300025941 Ga0207711_10004458 Ga0207711_100044588 618
196 3300025944 Ga0207661_10000125 Ga0207661_100001259 618
197 3300025945 Ga0207679_10000631 Ga0207679_1000063113 618
198 3300025949 Ga0207667_10005967 Ga0207667_100059678 618
199 3300025986 Ga0207658_10003825 Ga0207658_100038258 618
200 3300026041 Ga0207639_10002088 Ga0207639_1000208814 618
201 3300026067 Ga0207678_10002446 Ga0207678_100024462 618
202 3300026078 Ga0207702_10004861 Ga0207702_100048613 618
203 3300026095 Ga0207676_10010086 Ga0207676_100100862 618
204 3300026116 Ga0207674_10035080 Ga0207674_100350803 618
205 3300026142 Ga0207698_10001287 Ga0207698_100012872 618
206 3300035691 Ga0373931_0006657 Ga0373931_0006657_1872_3896 618
207 3300005336 Ga0070680_100003423 Ga0070680_1000034232 619
208 3300005366 Ga0070659_100017546 Ga0070659_1000175462 619
209 3300005530 Ga0070679_100056892 Ga0070679_1000568922 619
210 3300005578 Ga0068854_100026794 Ga0068854_1000267942 619
211 3300005614 Ga0068856_100039421 Ga0068856_1000394214 619
212 3300013296 Ga0157374_10070068 Ga0157374_100700684 619
213 3300025919 Ga0207657_10002159 Ga0207657_100021598 619
214 3300025925 Ga0207650_10016557 Ga0207650_100165572 619
215 3300025933 Ga0207706_10008935 Ga0207706_100089355 619
216 3300025945 Ga0207679_10108750 Ga0207679_101087501 619
217 3300037418 Ga0395900_0113636 Ga0395900_0113636_552_2576 619
218 3300037418 Ga0395900_0117365 Ga0395900_0117365_180_2201 619
219 3300037471 Ga0395905_0024776 Ga0395905_0024776_3574_5598 619
220 3300038443 Ga0395901_0021992 Ga0395901_0021992_2532_4556 619
221 3300005331 Ga0070670_100075827 Ga0070670_1000758272 620
222 3300013105 Ga0157369_10008454 Ga0157369_1000845410 620
223 3300025901 Ga0207688_10009556 Ga0207688_100095562 620
224 3300025904 Ga0207647_10004451 Ga0207647_1000445110 620
225 3300025909 Ga0207705_10014635 Ga0207705_100146353 620
226 3300025921 Ga0207652_10079762 Ga0207652_100797622 620
227 3300025925 Ga0207650_10009136 Ga0207650_100091365 620
228 3300025933 Ga0207706_10086573 Ga0207706_100865732 620
229 3300026095 Ga0207676_10026011 Ga0207676_100260115 620
230 3300005366 Ga0070659_100111225 Ga0070659_1001112251 621
231 3300005616 Ga0068852_100004359 Ga0068852_10000435910 621
232 3300013105 Ga0157369_10024824 Ga0157369_100248242 621
233 3300025924 Ga0207694_10042700 Ga0207694_100427002 621
234 3300026041 Ga0207639_10043581 Ga0207639_100435811 621
235 3300026142 Ga0207698_10003074 Ga0207698_100030744 621
236 3300037471 Ga0395905_0004217 Ga0395905_0004217_5594_7636 621
237 3300037471 Ga0395905_0010835 Ga0395905_0010835_5978_7966 621
238 3300038443 Ga0395901_0018706 Ga0395901_0018706_4485_6473 621
239 3300032002 Ga0307416_100037248 Ga0307416_1000372482 622
240 3300048913 Ga0496110_0058303 Ga0496110_0058303_1134_3149 622
241 3300005355 Ga0070671_100001188 Ga0070671_1000011881 623
242 3300013307 Ga0157372_10101241 Ga0157372_101012413 623
243 3300025931 Ga0207644_10000741 Ga0207644_100007414 623
244 3300038443 Ga0395901_0010666 Ga0395901_0010666_3309_5333 623
245 3300044842 Ga0466957_0026157 Ga0466957_0026157_497_2527 623
246 3300005578 Ga0068854_100002927 Ga0068854_1000029274 624
247 3300009093 Ga0105240_10004421 Ga0105240_1000442112 624
248 3300013105 Ga0157369_10023517 Ga0157369_100235172 624
249 3300013296 Ga0157374_10100062 Ga0157374_101000622 624
250 3300025913 Ga0207695_10017848 Ga0207695_100178485 624
251 3300025981 Ga0207640_10005496 Ga0207640_100054962 624
252 3300026023 Ga0207677_10001069 Ga0207677_1000106916 624
253 3300037418 Ga0395900_0020258 Ga0395900_0020258_2143_4152 624
254 3300037471 Ga0395905_0006512 Ga0395905_0006512_4098_6107 624
255 3300005335 Ga0070666_10023272 Ga0070666_100232725 625
256 3300005345 Ga0070692_10033006 Ga0070692_100330062 625
257 3300005355 Ga0070671_100018934 Ga0070671_1000189342 625
258 3300005364 Ga0070673_100010010 Ga0070673_1000100107 625
259 3300005366 Ga0070659_100033802 Ga0070659_1000338023 625
260 3300005456 Ga0070678_100040309 Ga0070678_1000403094 625
261 3300025903 Ga0207680_10021429 Ga0207680_100214291 625
262 3300026067 Ga0207678_10067099 Ga0207678_100670992 625
263 3300028379 Ga0268266_10028779 Ga0268266_100287792 625
264 3300037471 Ga0395905_0000092 Ga0395905_0000092_44890_46899 625
265 3300037471 Ga0395905_0008306 Ga0395905_0008306_642_2666 625
266 3300037471 Ga0395905_0021545 Ga0395905_0021545_3624_5642 625
267 3300038443 Ga0395901_0010244 Ga0395901_0010244_3830_5854 625
268 3300038443 Ga0395901_0122021 Ga0395901_0122021_612_2621 625
269 3300002077 JGI24744J21845_10001581 JGI24744J21845_100015812 626
270 3300005328 Ga0070676_10005914 Ga0070676_100059142 626
271 3300005347 Ga0070668_100044353 Ga0070668_1000443534 626
272 3300005543 Ga0070672_100038415 Ga0070672_1000384152 626
273 3300005618 Ga0068864_100026489 Ga0068864_1000264892 626
274 3300025893 Ga0207682_10003716 Ga0207682_100037162 626
275 3300025907 Ga0207645_10009456 Ga0207645_100094562 626
276 3300025919 Ga0207657_10008276 Ga0207657_100082769 626
277 3300025919 Ga0207657_10050172 Ga0207657_100501724 626
278 3300025933 Ga0207706_10008262 Ga0207706_100082622 626
279 3300025940 Ga0207691_10025291 Ga0207691_100252912 626
280 3300025940 Ga0207691_10098911 Ga0207691_100989112 626
281 3300025944 Ga0207661_10004204 Ga0207661_100042042 626
282 3300026023 Ga0207677_10010808 Ga0207677_100108085 626
283 3300026089 Ga0207648_10002037 Ga0207648_1000203715 626
284 3300026121 Ga0207683_10020676 Ga0207683_100206761 626
285 3300037312 Ga0395899_0038745 Ga0395899_0038745_1319_3328 626
286 3300037418 Ga0395900_0048308 Ga0395900_0048308_134_2143 626
287 3300005616 Ga0068852_100001848 Ga0068852_10000184811 627
288 3300009093 Ga0105240_10189732 Ga0105240_101897321 627
289 3300025917 Ga0207660_10024043 Ga0207660_100240432 627
290 3300025941 Ga0207711_10081586 Ga0207711_100815862 627
291 3300026142 Ga0207698_10000798 Ga0207698_100007987 627
292 3300031901 Ga0307406_10020641 Ga0307406_100206412 627
293 3300001979 JGI24740J21852_10001777 JGI24740J21852_100017777 628
294 3300001989 JGI24739J22299_10005420 JGI24739J22299_100054202 628
295 3300005327 Ga0070658_10060873 Ga0070658_100608731 628
296 3300005336 Ga0070680_100013665 Ga0070680_1000136652 628
297 3300005336 Ga0070680_100058345 Ga0070680_1000583452 628
298 3300005344 Ga0070661_100009869 Ga0070661_1000098692 628
299 3300005455 Ga0070663_100023645 Ga0070663_1000236453 628
300 3300005578 Ga0068854_100022288 Ga0068854_1000222883 628
301 3300013307 Ga0157372_10023500 Ga0157372_100235004 628
302 3300025917 Ga0207660_10000491 Ga0207660_1000049113 628
303 3300025917 Ga0207660_10012884 Ga0207660_100128843 628
304 3300025919 Ga0207657_10002128 Ga0207657_100021288 628
305 3300025919 Ga0207657_10038989 Ga0207657_100389892 628
306 3300025920 Ga0207649_10015133 Ga0207649_100151333 628
307 3300025921 Ga0207652_10028955 Ga0207652_100289552 628
308 3300025932 Ga0207690_10010623 Ga0207690_100106233 628
309 3300025933 Ga0207706_10005527 Ga0207706_100055272 628
310 3300025981 Ga0207640_10031424 Ga0207640_100314243 628
311 3300026067 Ga0207678_10005673 Ga0207678_100056738 628
312 3300026078 Ga0207702_10028271 Ga0207702_100282712 628
313 3300026116 Ga0207674_10006253 Ga0207674_100062532 628
314 3300001990 JGI24737J22298_10004572 JGI24737J22298_100045724 629
315 3300005327 Ga0070658_10023110 Ga0070658_100231102 629
316 3300005339 Ga0070660_100013072 Ga0070660_1000130724 629
317 3300005367 Ga0070667_100003546 Ga0070667_10000354615 629
318 3300005456 Ga0070678_100018230 Ga0070678_1000182302 629
319 3300005577 Ga0068857_100013947 Ga0068857_1000139472 629
320 3300005617 Ga0068859_100011674 Ga0068859_1000116749 629
321 3300005618 Ga0068864_100033350 Ga0068864_1000333504 629
322 3300005842 Ga0068858_100005781 Ga0068858_1000057812 629
323 3300005843 Ga0068860_100002225 Ga0068860_1000022255 629
324 3300006931 Ga0097620_100011674 Ga0097620_1000116742 629
325 3300009177 Ga0105248_10005033 Ga0105248_100050332 629
326 3300013307 Ga0157372_10180589 Ga0157372_101805892 629
327 3300014325 Ga0163163_10002906 Ga0163163_1000290611 629
328 3300025919 Ga0207657_10003113 Ga0207657_100031134 629
329 3300025923 Ga0207681_10021369 Ga0207681_100213692 629
330 3300025933 Ga0207706_10010336 Ga0207706_100103365 629
331 3300025941 Ga0207711_10000044 Ga0207711_1000004450 629
332 3300025961 Ga0207712_10021139 Ga0207712_100211392 629
333 3300025986 Ga0207658_10006286 Ga0207658_1000628610 629
334 3300026088 Ga0207641_10002884 Ga0207641_100028846 629
335 3300026095 Ga0207676_10013791 Ga0207676_100137914 629
336 3300026116 Ga0207674_10000758 Ga0207674_1000075826 629
337 3300028381 Ga0268264_10007076 Ga0268264_100070763 629
338 3300037418 Ga0395900_0050569 Ga0395900_0050569_1356_3380 629
339 3300037471 Ga0395905_0011462 Ga0395905_0011462_4789_6813 629
340 3300038443 Ga0395901_0034407 Ga0395901_0034407_3146_5170 629
341 3300038443 Ga0395901_0060885 Ga0395901_0060885_63_2087 629
342 3300042144 Ga0450889_000116 Ga0450889_000116_4218_6224 629
343 3300044765 Ga0466970_0021678 Ga0466970_0021678_564_2570 629
344 3300045976 Ga0466967_0020833 Ga0466967_0020833_1650_3671 629
345 3300005335 Ga0070666_10016360 Ga0070666_100163602 630
346 3300005336 Ga0070680_100000707 Ga0070680_1000007078 630
347 3300005355 Ga0070671_100000786 Ga0070671_10000078620 630
348 3300009093 Ga0105240_10019267 Ga0105240_1001926710 630
349 3300009177 Ga0105248_10010319 Ga0105248_100103196 630
350 3300009551 Ga0105238_10020349 Ga0105238_100203496 630
351 3300013104 Ga0157370_10020072 Ga0157370_100200722 630
352 3300013105 Ga0157369_10023804 Ga0157369_100238042 630
353 3300013307 Ga0157372_10004460 Ga0157372_1000446015 630
354 3300013308 Ga0157375_10002694 Ga0157375_100026948 630
355 3300025904 Ga0207647_10009956 Ga0207647_100099562 630
356 3300025920 Ga0207649_10016772 Ga0207649_100167722 630
357 3300025924 Ga0207694_10009416 Ga0207694_100094162 630
358 3300026041 Ga0207639_10000373 Ga0207639_1000037314 630
359 3300037466 Ga0395898_0012294 Ga0395898_0012294_1626_3650 630
360 3300037471 Ga0395905_0017087 Ga0395905_0017087_3807_5831 630
361 3300037471 Ga0395905_0019509 Ga0395905_0019509_1649_3667 630
362 3300038443 Ga0395901_0029594 Ga0395901_0029594_2249_4267 630
363 3300001904 JGI24736J21556_1001895 JGI24736J21556_10018952 631
364 3300005327 Ga0070658_10002061 Ga0070658_100020618 631
365 3300005327 Ga0070658_10126301 Ga0070658_101263011 631
366 3300005339 Ga0070660_100000760 Ga0070660_10000076017 631
367 3300005339 Ga0070660_100009409 Ga0070660_1000094095 631
368 3300005344 Ga0070661_100004237 Ga0070661_1000042374 631
369 3300005345 Ga0070692_10001707 Ga0070692_100017072 631
370 3300005455 Ga0070663_100001011 Ga0070663_1000010114 631
371 3300025909 Ga0207705_10026523 Ga0207705_100265232 631
372 3300025919 Ga0207657_10000471 Ga0207657_1000047129 631
373 3300025949 Ga0207667_10093227 Ga0207667_100932271 631
374 3300026067 Ga0207678_10002961 Ga0207678_100029619 631
375 3300037312 Ga0395899_0000419 Ga0395899_0000419_29299_31338 631
376 3300037418 Ga0395900_0000817 Ga0395900_0000817_17848_19887 631
377 3300037418 Ga0395900_0003442 Ga0395900_0003442_7905_9923 631
378 3300037418 Ga0395900_0087159 Ga0395900_0087159_1184_3166 631
379 3300037466 Ga0395898_0015567 Ga0395898_0015567_750_2789 631
380 3300037466 Ga0395898_0041197 Ga0395898_0041197_235_2274 631
381 3300037466 Ga0395898_0084245 Ga0395898_0084245_509_2545 631
382 3300037471 Ga0395905_0074640 Ga0395905_0074640_298_2337 631
383 3300038443 Ga0395901_0000030 Ga0395901_0000030_101028_103067 631
384 3300038443 Ga0395901_0000188 Ga0395901_0000188_74731_76749 631
385 3300038443 Ga0395901_0171789 Ga0395901_0171789_71_2107 631
386 3300045976 Ga0466967_0052434 Ga0466967_0052434_1389_3407 631

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01103

Omp85

Omp85 superfamily domain

321

635

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q6b-assembly1.cif.gz_A the high-resolution and new form crystal structure of bama potra4-5 from e.coli 0.8039 149 303
3q6b-assembly1.cif.gz_A the high-resolution and new form crystal structure of bama potra4-5 from e.coli 0.7951 149 303
4n74-assembly1.cif.gz_A crystal structure of outer membrane protein tama beta-barrel domain in e.coli 0.7826 306 627
6izs-assembly1.cif.gz_A crystal structure of haemophilus influenzae bama potra4 0.781 148 229
4n74-assembly1.cif.gz_A crystal structure of outer membrane protein tama beta-barrel domain in e.coli 0.774 306 627
ID Description Score Start End Superfamily
5aywA05 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8426 232 306 3.10.20.310
4k3bA05 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8385 232 306 3.10.20.310
4pk1A01 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8288 150 227 3.10.20.310
5aywA05 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8142 232 306 3.10.20.310
3mc8A03 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.803 234 306 3.10.20.310
ID Description Score Start End GO Terms
AF-A0A077AS02-F1-model_v4 Bacterial surface antigen (D15) domain-containing protein 0.8049 328 630 GO:0019867
AF-A0A077AS02-F1-model_v4 Bacterial surface antigen (D15) domain-containing protein 0.8002 328 630 GO:0019867
AF-A0A4Q3JCY9-F1-model_v4 deleted 0.7789 438 630
AF-A0A2W6Y2I4-F1-model_v4 Metallophosphoesterase 0.7769 308 625
AF-A0A2X4YLK8-F1-model_v4 deleted 0.772 338 627

Feature Viewer

pLDDT pTM Quality
77.48 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map