F430449

General Info

Members Datasets Scaffolds Average Seq Length
386 205 772 97

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100660904|Ga0068853_1006609042
Length 111
Sequence MSPFGAGASRGSGEAMTYGVVHHFEGGTEEQYRASIAAVHPADGSLPAGQLYHAAGASEDGWDIIAVHDSKESWETFRDSILMPRMQAGIDGGFTAPPQERVFEIVNEARG

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
119 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
203 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
204 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
205 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.34
Metatranscriptomes 3.63
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.92
Rhizosphere 85.23
Stem 0
Stem Tuber 0
Unclassified 21.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100660904 3300005539 Bacteria 995
2 Ga0070658_10126637 3300005327 Bacteria 2126
3 Ga0070683_101001609 3300005329 Bacteria 802
4 Ga0070682_100908094 3300005337 Bacteria 724
5 Ga0070674_101108216 3300005356 Bacteria 699
6 Ga0070659_100642796 3300005366 Unclassified 914
7 Ga0070714_100468218 3300005435 Bacteria 1199
8 Ga0070714_101014171 3300005435 Unclassified 808
9 Ga0070714_101245172 3300005435 Bacteria 726
10 Ga0070713_101719409 3300005436 Unclassified 609
11 Ga0070708_100009333 3300005445 Bacteria 7905
12 Ga0070708_100373024 3300005445 Unclassified 1345
13 Ga0070663_101848381 3300005455 Bacteria 542
14 Ga0070681_10728660 3300005458 Bacteria 908
15 Ga0068867_100518922 3300005459 Bacteria 1027
16 Ga0070706_100295515 3300005467 Bacteria 1512
17 Ga0070706_100706421 3300005467 Bacteria 935
18 Ga0070706_101050214 3300005467 Unclassified 750
19 Ga0070707_100365489 3300005468 Unclassified 1402
20 Ga0070698_100097473 3300005471 Bacteria 2916
21 Ga0070698_101001377 3300005471 Bacteria 783
22 Ga0070684_100091957 3300005535 Bacteria 2699
23 Ga0070684_100281086 3300005535 Bacteria 1525
24 Ga0070693_101598719 3300005547 Bacteria 512
25 Ga0068855_100018173 3300005563 Bacteria 8447
26 Ga0068855_100064597 3300005563 Bacteria 4268
27 Ga0070664_100297335 3300005564 Bacteria 1458
28 Ga0068856_100113470 3300005614 Bacteria 2708
29 Ga0068856_100212817 3300005614 Unclassified 1948
30 Ga0068856_100252551 3300005614 Bacteria 1778
31 Ga0068852_100131523 3300005616 Bacteria 2305
32 Ga0068852_100331873 3300005616 Unclassified 1480
33 Ga0070717_10134965 3300006028 Bacteria 2124
34 Ga0070717_10422521 3300006028 Unclassified 1199
35 Ga0070717_10490103 3300006028 Bacteria 1110
36 Ga0105240_10088694 3300009093 Bacteria 3784
37 Ga0105245_10957718 3300009098 Unclassified 899
38 Ga0105245_13107969 3300009098 Bacteria 514
39 Ga0105243_11053969 3300009148 Bacteria 819
40 Ga0105243_12045997 3300009148 Bacteria 608
41 Ga0105241_11088997 3300009174 Unclassified 752
42 Ga0105248_11683910 3300009177 Unclassified 719
43 Ga0105248_11838623 3300009177 Unclassified 687
44 Ga0105248_12764989 3300009177 Bacteria 560
45 Ga0105237_10048992 3300009545 Bacteria 4247
46 Ga0105237_10243329 3300009545 Bacteria 1800
47 Ga0105238_10450595 3300009551 Bacteria 1284
48 Ga0105239_10062930 3300010375 Bacteria 4073
49 Ga0105239_10283997 3300010375 Bacteria 1864
50 Ga0157370_11400111 3300013104 Bacteria 629
51 Ga0157369_10117997 3300013105 Bacteria 2816
52 Ga0157369_10123220 3300013105 Bacteria 2750
53 Ga0157374_11061085 3300013296 Bacteria 830
54 Ga0157378_13204965 3300013297 Bacteria 508
55 Ga0163162_11380570 3300013306 Bacteria 801
56 Ga0157372_10374038 3300013307 Bacteria 1660
57 Ga0157375_13643325 3300013308 Unclassified 512
58 Ga0163163_10329162 3300014325 Bacteria 1582
59 Ga0163163_10928252 3300014325 Unclassified 934
60 Ga0157380_11510923 3300014326 Bacteria 725
61 Ga0197907_11114946 3300020069 Bacteria 556
62 Ga0206352_10695464 3300020078 Bacteria 506
63 Ga0213876_10256760 3300021384 Bacteria 929
64 Ga0224712_10539060 3300022467 Unclassified 566
65 Ga0207692_10172841 3300025898 Bacteria 1253
66 Ga0207692_10790236 3300025898 Bacteria 620
67 Ga0207688_10297510 3300025901 Bacteria 986
68 Ga0207647_10060661 3300025904 Bacteria 2311
69 Ga0207705_10010403 3300025909 Bacteria 6765
70 Ga0207684_10016495 3300025910 Bacteria 6342
71 Ga0207684_10246588 3300025910 Bacteria 1541
72 Ga0207671_10060536 3300025914 Bacteria 2809
73 Ga0207671_10068542 3300025914 Unclassified 2644
74 Ga0207693_10011068 3300025915 Bacteria 7310
75 Ga0207646_10093669 3300025922 Bacteria 2690
76 Ga0207646_10251899 3300025922 Unclassified 1595
77 Ga0207687_10582739 3300025927 Bacteria 941
78 Ga0207700_10674315 3300025928 Bacteria 922
79 Ga0207664_10385253 3300025929 Bacteria 1245
80 Ga0207664_10438031 3300025929 Unclassified 1165
81 Ga0207664_11406680 3300025929 Bacteria 618
82 Ga0207664_11735248 3300025929 Unclassified 547
83 Ga0207709_11335380 3300025935 Bacteria 593
84 Ga0207669_10692234 3300025937 Bacteria 837
85 Ga0207665_10625665 3300025939 Unclassified 842
86 Ga0207711_11238493 3300025941 Unclassified 688
87 Ga0207661_10036061 3300025944 Bacteria 3858
88 Ga0207661_12013561 3300025944 Bacteria 523
89 Ga0207679_10250527 3300025945 Bacteria 1505
90 Ga0207667_10015768 3300025949 Bacteria 8568
91 Ga0207667_10070557 3300025949 Bacteria 3636
92 Ga0207667_10157684 3300025949 Bacteria 2335
93 Ga0207677_11881640 3300026023 Unclassified 556
94 Ga0207702_10139297 3300026078 Unclassified 2193
95 Ga0207702_10253218 3300026078 Bacteria 1654
96 Ga0207702_10360415 3300026078 Bacteria 1393
97 Ga0207702_10411710 3300026078 Unclassified 1306
98 Ga0207702_10475903 3300026078 Unclassified 1215
99 Ga0207702_11279535 3300026078 Bacteria 727
100 Ga0207648_10519610 3300026089 Bacteria 1091
101 Ga0207674_10091500 3300026116 Bacteria 3032
102 Ga0207698_10110259 3300026142 Bacteria 2305
103 Ga0207698_10165780 3300026142 Bacteria 1938
104 Ga0265319_1000799 3300028563 Bacteria 20306
105 Ga0265319_1051133 3300028563 Unclassified 1363
106 Ga0265318_10001913 3300028577 Bacteria 11662
107 Ga0265338_10015665 3300028800 Bacteria 8307
108 Ga0265338_10345534 3300028800 Unclassified 1071
109 Ga0265777_103033 3300030877 Unclassified 1011
110 Ga0265770_1151121 3300030878 Unclassified 510
111 Ga0265760_10021916 3300031090 Unclassified 1850
112 Ga0265330_10431665 3300031235 Unclassified 558
113 Ga0265328_10214158 3300031239 Unclassified 733
114 Ga0265320_10006124 3300031240 Bacteria 7618
115 Ga0265325_10140377 3300031241 Unclassified 1150
116 Ga0265325_10434183 3300031241 Unclassified 573
117 Ga0265327_10035135 3300031251 Bacteria 2774
118 Ga0265316_10639130 3300031344 Unclassified 753
119 Ga0310117_114065 3300031592 Bacteria 831
120 Ga0265314_10138485 3300031711 Unclassified 1508
121 Ga0265314_10367439 3300031711 Bacteria 787
122 Ga0265342_10685349 3300031712 Unclassified 513
123 Ga0307412_11517159 3300031911 Unclassified 610
124 Ga0307409_101133438 3300031995 Bacteria 804
125 Ga0307409_102461622 3300031995 Unclassified 549
126 Ga0307510_10342443 3300033180 Unclassified 947
127 Ga0373926_0002809 3300035083 Bacteria 5561
128 Ga0373926_0142593 3300035083 Unclassified 910
129 Ga0373934_0001612 3300035086 Bacteria 8281
130 Ga0373944_0030460 3300035089 Bacteria 1618
131 Ga0373944_0098310 3300035089 Bacteria 986
132 Ga0373923_0001042 3300035111 Bacteria 7569
133 Ga0373923_0028994 3300035111 Bacteria 2217
134 Ga0373936_0002811 3300035113 Bacteria 6487
135 Ga0373945_0004085 3300035116 Bacteria 4625
136 Ga0373945_0009656 3300035116 Bacteria 3164
137 Ga0373953_0012181 3300035117 Bacteria 3039
138 Ga0373953_0040807 3300035117 Bacteria 1845
139 Ga0373954_0289419 3300035118 Unclassified 808
140 Ga0373956_0019251 3300035119 Bacteria 2894
141 Ga0373957_0012060 3300035120 Bacteria 2900
142 Ga0373943_0004870 3300035170 Bacteria 6069
143 Ga0373943_0016081 3300035170 Bacteria 3407
144 Ga0373943_0030015 3300035170 Bacteria 2571
145 Ga0373943_0720441 3300035170 Bacteria 592
146 Ga0373946_0000622 3300035171 Bacteria 11799
147 Ga0373955_0027255 3300035172 Bacteria 2951
148 Ga0373955_0341921 3300035172 Bacteria 905
149 Ga0373955_1016428 3300035172 Bacteria 511
150 Ga0316574_0043428 3300035398 Bacteria 2777
151 Ga0373924_0000951 3300035410 Bacteria 9157
152 Ga0373924_0014556 3300035410 Bacteria 2976
153 Ga0373935_0003396 3300035692 Bacteria 9250
154 Ga0373935_0066548 3300035692 Unclassified 2315
155 Ga0373927_0003263 3300035695 Bacteria 11669
156 Ga0373927_0065756 3300035695 Bacteria 2345
157 Ga0373927_0174542 3300035695 Bacteria 1409
158 Ga0373927_0197129 3300035695 Bacteria 1321
159 Ga0373933_0033544 3300035724 Bacteria 2986
160 Ga0373947_0003603 3300035725 Bacteria 9137
161 Ga0373947_0005553 3300035725 Bacteria 7348
162 Ga0373947_0005609 3300035725 Bacteria 7320
163 Ga0373947_1205372 3300035725 Unclassified 516
164 Ga0373937_0092797 3300036401 Bacteria 2798
165 Ga0373937_0110348 3300036401 Bacteria 2558
166 Ga0316584_0690796 3300036712 Bacteria 700
167 Ga0373925_0027801 3300037068 Unclassified 4140
168 Ga0373925_0736782 3300037068 Bacteria 812
169 Ga0395899_0104513 3300037312 Bacteria 2041
170 Ga0395900_0068643 3300037418 Unclassified 3643
171 Ga0395898_0076318 3300037466 Bacteria 3236
172 Ga0395898_0303364 3300037466 Unclassified 1523
173 Ga0395905_0070729 3300037471 Bacteria 3270
174 Ga0395905_0394823 3300037471 Unclassified 1278
175 Ga0395905_0737184 3300037471 Unclassified 888
176 Ga0436364_1404658 3300037853 Bacteria 2567
177 Ga0395901_0142211 3300038443 Plasmid 2521
178 Ga0395901_0498350 3300038443 Unclassified 1240
179 Ga0395901_1278915 3300038443 Unclassified 696
180 Ga0436365_1758047 3300039437 Unclassified 1531
181 Ga0436365_1882390 3300039437 Unclassified 1310
182 Ga0436360_0594379 3300039438 Unclassified 503
183 Ga0436361_0092808 3300039447 Bacteria 607
184 Ga0436361_0403168 3300039447 Bacteria 569
185 Ga0451789_0670320 3300041443 Bacteria 508
186 Ga0451793_0749871 3300041452 Unclassified 714
187 Ga0451793_1873201 3300041452 Bacteria 682
188 Ga0451835_0530294 3300041492 Bacteria 524
189 Ga0451847_0803337 3300041503 Bacteria 604
190 Ga0451853_1365569 3300041512 Unclassified 704
191 Ga0451853_3432588 3300041512 Bacteria 1367
192 Ga0466961_0357196 3300044693 Unclassified 889
193 Ga0466970_0819360 3300044765 Unclassified 546
194 Ga0495592_0085309 3300046454 Bacteria 2276
195 Ga0495603_0001337 3300046455 Bacteria 14322
196 Ga0495603_0041110 3300046455 Bacteria 2765
197 Ga0495603_0351442 3300046455 Bacteria 846
198 Ga0495603_0626501 3300046455 Unclassified 616
199 Ga0495629_0024673 3300046459 Bacteria 4280
200 Ga0495629_0054500 3300046459 Bacteria 2796
201 Ga0495629_0136085 3300046459 Bacteria 1710
202 Ga0495629_0259016 3300046459 Bacteria 1196
203 Ga0495641_0006495 3300046461 Bacteria 7565
204 Ga0495641_0090066 3300046461 Bacteria 1370
205 Ga0495641_0142153 3300046461 Bacteria 1072
206 Ga0495641_0189730 3300046461 Unclassified 921
207 Ga0495641_0238319 3300046461 Bacteria 817
208 Ga0495651_0120994 3300046462 Bacteria 1923
209 Ga0495651_0307821 3300046462 Unclassified 1060
210 Ga0495651_0574173 3300046462 Bacteria 714
211 Ga0495653_0064908 3300046463 Bacteria 2749
212 Ga0495653_0160577 3300046463 Bacteria 1560
213 Ga0495653_0298204 3300046463 Bacteria 1052
214 Ga0495580_0011111 3300046472 Bacteria 6977
215 Ga0495580_0166908 3300046472 Bacteria 1522
216 Ga0495582_0001101 3300046473 Bacteria 15160
217 Ga0495582_0010009 3300046473 Bacteria 5218
218 Ga0495582_0110268 3300046473 Bacteria 1546
219 Ga0495582_0507275 3300046473 Bacteria 697
220 Ga0495639_0002557 3300046475 Bacteria 7934
221 Ga0495639_0009535 3300046475 Bacteria 4166
222 Ga0495639_0369309 3300046475 Bacteria 722
223 Ga0495662_0001115 3300046476 Bacteria 13218
224 Ga0495662_0005115 3300046476 Bacteria 6569
225 Ga0495664_0025642 3300046477 Bacteria 3432
226 Ga0495664_0203800 3300046477 Bacteria 1198
227 Ga0495594_0008806 3300046499 Bacteria 5203
228 Ga0495594_0029182 3300046499 Bacteria 2981
229 Ga0495583_0198346 3300046506 Bacteria 816
230 Ga0495608_0010750 3300046511 Bacteria 6380
231 Ga0495608_0043236 3300046511 Bacteria 3010
232 Ga0495618_0005400 3300046514 Bacteria 7796
233 Ga0495618_0032385 3300046514 Bacteria 3273
234 Ga0495628_0030820 3300046516 Bacteria 4340
235 Ga0495630_0014933 3300046517 Bacteria 5663
236 Ga0495630_0022276 3300046517 Bacteria 4680
237 Ga0495630_0119188 3300046517 Bacteria 2002
238 Ga0495666_0001453 3300046526 Bacteria 11540
239 Ga0495666_0054317 3300046526 Bacteria 1921
240 Ga0495652_0025731 3300046529 Bacteria 5202
241 Ga0495652_0301422 3300046529 Bacteria 1165
242 Ga0495665_0006391 3300046531 Bacteria 6359
243 Ga0495665_0010305 3300046531 Bacteria 5059
244 Ga0495640_0022018 3300046533 Bacteria 4666
245 Ga0495640_0031644 3300046533 Bacteria 3773
246 Ga0495586_0004264 3300046535 Bacteria 7648
247 Ga0495586_0042673 3300046535 Bacteria 2442
248 Ga0495587_0054751 3300046536 Bacteria 2350
249 Ga0495645_0055129 3300046543 Bacteria 2886
250 Ga0495622_0074461 3300046557 Bacteria 1566
251 Ga0495667_0042654 3300046559 Bacteria 3008
252 Ga0495667_0460846 3300046559 Bacteria 798
253 Ga0495656_0019390 3300046615 Bacteria 2625
254 Ga0495634_0003607 3300046642 Bacteria 12363
255 Ga0495634_0256560 3300046642 Bacteria 1068
256 Ga0495634_0376512 3300046642 Unclassified 846
257 Ga0495635_0019077 3300046663 Bacteria 4787
258 Ga0495635_0041747 3300046663 Bacteria 3168
259 Ga0495635_0830887 3300046663 Unclassified 594
260 Ga0495588_0038441 3300046674 Bacteria 2434
261 Ga0495588_0049105 3300046674 Bacteria 2169
262 Ga0495657_0013787 3300046675 Bacteria 5950
263 Ga0495657_0163145 3300046675 Bacteria 1377
264 Ga0495599_0026886 3300046678 Bacteria 3606
265 Ga0495623_0036425 3300046679 Bacteria 3151
266 Ga0495623_0061416 3300046679 Bacteria 2357
267 Ga0495623_0340248 3300046679 Bacteria 820
268 Ga0495646_0027202 3300046680 Bacteria 3588
269 Ga0495647_0000605 3300046681 Bacteria 10604
270 Ga0495647_0569509 3300046681 Unclassified 530
271 Ga0495658_0018214 3300046683 Bacteria 3646
272 Ga0495658_0061654 3300046683 Bacteria 2153
273 Ga0495658_0534653 3300046683 Bacteria 750
274 Ga0495613_0005163 3300046689 Bacteria 9803
275 Ga0495613_0064459 3300046689 Bacteria 2679
276 Ga0495613_0115280 3300046689 Unclassified 1934
277 Ga0495613_0124342 3300046689 Unclassified 1851
278 Ga0495613_0292801 3300046689 Bacteria 1128
279 Ga0495624_0003126 3300046690 Bacteria 12366
280 Ga0495624_0090787 3300046690 Bacteria 1885
281 Ga0495624_0482991 3300046690 Bacteria 742
282 Ga0495600_0012533 3300046809 Bacteria 5305
283 Ga0495600_0017084 3300046809 Bacteria 4612
284 Ga0495600_0206782 3300046809 Bacteria 1259
285 Ga0495600_0315100 3300046809 Bacteria 985
286 Ga0495581_0000033 3300047315 Bacteria 52520
287 Ga0495581_0007706 3300047315 Bacteria 6230
288 Ga0495581_0276503 3300047315 Bacteria 982
289 Ga0495581_0500309 3300047315 Unclassified 707
290 Ga0495581_0563774 3300047315 Bacteria 661
291 Ga0495604_0024141 3300047317 Bacteria 4853
292 Ga0495604_0139379 3300047317 Bacteria 1734
293 Ga0495636_0002462 3300047318 Bacteria 7094
294 Ga0495674_0008492 3300047319 Bacteria 9783
295 Ga0495674_0076322 3300047319 Bacteria 2882
296 Ga0495674_0223998 3300047319 Bacteria 1554
297 Ga0495676_0022657 3300047321 Bacteria 5461
298 Ga0495676_0054434 3300047321 Bacteria 3181
299 Ga0495676_0355391 3300047321 Bacteria 979
300 Ga0495676_0460987 3300047321 Bacteria 837
301 Ga0495680_0032981 3300047322 Bacteria 4197
302 Ga0495680_0046359 3300047322 Bacteria 3427
303 Ga0495680_0132653 3300047322 Bacteria 1829
304 Ga0495680_0229666 3300047322 Bacteria 1322
305 Ga0495675_0003899 3300047444 Bacteria 9035
306 Ga0495675_0050299 3300047444 Bacteria 2649
307 Ga0495684_0004235 3300047471 Bacteria 11197
308 Ga0495684_0773735 3300047471 Bacteria 630
309 Ga0495684_0922022 3300047471 Unclassified 561
310 Ga0495593_0002887 3300047673 Bacteria 10358
311 Ga0495593_0004177 3300047673 Bacteria 8587
312 Ga0495602_0074681 3300048088 Bacteria 2880
313 Ga0495602_0685851 3300048088 Unclassified 696
314 Ga0495615_0156765 3300048090 Bacteria 681
315 Ga0496100_0725019 3300048903 Bacteria 777
316 Ga0496101_0108272 3300048904 Bacteria 2089
317 Ga0496102_0001991 3300048905 Bacteria 17645
318 Ga0496103_0005055 3300048906 Bacteria 7955
319 Ga0496103_0720621 3300048906 Bacteria 632
320 Ga0496104_0141117 3300048907 Bacteria 2314
321 Ga0496105_0212185 3300048908 Unclassified 1578
322 Ga0496105_0221519 3300048908 Bacteria 1540
323 Ga0496105_0344461 3300048908 Bacteria 1191
324 Ga0496105_0717755 3300048908 Bacteria 766
325 Ga0496105_1137502 3300048908 Bacteria 578
326 Ga0496106_0245058 3300048909 Bacteria 1432
327 Ga0496107_0493375 3300048910 Bacteria 908
328 Ga0496107_1085489 3300048910 Bacteria 579
329 Ga0496108_0177594 3300048911 Bacteria 1844
330 Ga0496108_0406231 3300048911 Bacteria 1189
331 Ga0496108_0690187 3300048911 Unclassified 886
332 Ga0496108_0794208 3300048911 Bacteria 817
333 Ga0496108_0841961 3300048911 Unclassified 790
334 Ga0496108_0907475 3300048911 Unclassified 756
335 Ga0496108_1246873 3300048911 Bacteria 627
336 Ga0496108_1598807 3300048911 Unclassified 539
337 Ga0496109_0104123 3300048912 Bacteria 2635
338 Ga0496109_0116854 3300048912 Bacteria 2482
339 Ga0496109_0271450 3300048912 Bacteria 1598
340 Ga0496109_0593902 3300048912 Bacteria 1043
341 Ga0496110_0798594 3300048913 Bacteria 848
342 Ga0496111_0025448 3300048914 Bacteria 4176
343 Ga0496111_0266072 3300048914 Bacteria 1272
344 Ga0496111_0723564 3300048914 Bacteria 723
345 Ga0496112_0002905 3300048915 Bacteria 13952
346 Ga0496112_0329375 3300048915 Bacteria 1471
347 Ga0496112_0364967 3300048915 Bacteria 1386
348 Ga0496112_0405743 3300048915 Bacteria 1302
349 Ga0496112_0526348 3300048915 Bacteria 1117
350 Ga0496112_0717846 3300048915 Bacteria 927
351 Ga0496112_1817341 3300048915 Unclassified 521
352 Ga0496113_0022637 3300048916 Bacteria 4449
353 Ga0496113_0125386 3300048916 Bacteria 2010
354 Ga0496113_0471102 3300048916 Bacteria 1009
355 Ga0496114_0181967 3300048917 Bacteria 1836
356 Ga0496114_0471579 3300048917 Bacteria 1111
357 Ga0496115_0048204 3300048918 Bacteria 3407
358 Ga0501067_0046155 3300049583 Bacteria 2418
359 Ga0501075_1522080 3300049591 Unclassified 506
360 nmdc:mga0n895_539209_c1 3300050512 Bacteria 1173
361 Ga0495601_0041712 3300053077 Bacteria 2877
362 Ga0495601_0265443 3300053077 Unclassified 1120
363 Ga0495601_0348845 3300053077 Unclassified 962
364 Ga0495601_0627360 3300053077 Unclassified 688
365 Ga0495601_0687584 3300053077 Bacteria 653
366 Ga0495612_0003717 3300053078 Bacteria 6337
367 Ga0495612_0046044 3300053078 Bacteria 1786
368 Ga0495612_0062051 3300053078 Bacteria 1549
369 Ga0495595_0002740 3300053084 Bacteria 6915
370 Ga0495595_0010705 3300053084 Bacteria 3819
371 Ga0495619_0006852 3300053085 Bacteria 7204
372 Ga0495619_0155197 3300053085 Bacteria 1579
373 Ga0495619_0473190 3300053085 Bacteria 863
374 Ga0495619_0513860 3300053085 Unclassified 823
375 Ga0495619_0958741 3300053085 Bacteria 573
376 Ga0587066_226548 3300059490 Bacteria 504
377 Ga0587082_189546 3300059504 Bacteria 508
378 Ga0587062_084990 3300059639 Bacteria 594
379 Ga0587072_106637 3300059643 Unclassified 635
380 Ga0587114_083330 3300059655 Unclassified 598
381 Ga0587111_0118919 3300060346 Bacteria 678
382 Ga0587111_0159213 3300060346 Unclassified 612
383 2812375884 2811994882 Bacteria 4688362
384 2819689998 2818991462 Bacteria 4320267
385 2819726438 2818991469 Bacteria 4644110
386 8015556817 8015556637 Bacteria 3582323
387 Ga0068853_100660904
388 Ga0070658_10126637
389 Ga0070683_101001609
390 Ga0070682_100908094
391 Ga0070674_101108216
392 Ga0070659_100642796
393 Ga0070714_100468218
394 Ga0070714_101014171
395 Ga0070714_101245172
396 Ga0070713_101719409
397 Ga0070708_100009333
398 Ga0070708_100373024
399 Ga0070663_101848381
400 Ga0070681_10728660
401 Ga0068867_100518922
402 Ga0070706_100295515
403 Ga0070706_100706421
404 Ga0070706_101050214
405 Ga0070707_100365489
406 Ga0070698_100097473
407 Ga0070698_101001377
408 Ga0070684_100091957
409 Ga0070684_100281086
410 Ga0070693_101598719
411 Ga0068855_100018173
412 Ga0068855_100064597
413 Ga0070664_100297335
414 Ga0068856_100113470
415 Ga0068856_100212817
416 Ga0068856_100252551
417 Ga0068852_100131523
418 Ga0068852_100331873
419 Ga0070717_10134965
420 Ga0070717_10422521
421 Ga0070717_10490103
422 Ga0105240_10088694
423 Ga0105245_10957718
424 Ga0105245_13107969
425 Ga0105243_11053969
426 Ga0105243_12045997
427 Ga0105241_11088997
428 Ga0105248_11683910
429 Ga0105248_11838623
430 Ga0105248_12764989
431 Ga0105237_10048992
432 Ga0105237_10243329
433 Ga0105238_10450595
434 Ga0105239_10062930
435 Ga0105239_10283997
436 Ga0157370_11400111
437 Ga0157369_10117997
438 Ga0157369_10123220
439 Ga0157374_11061085
440 Ga0157378_13204965
441 Ga0163162_11380570
442 Ga0157372_10374038
443 Ga0157375_13643325
444 Ga0163163_10329162
445 Ga0163163_10928252
446 Ga0157380_11510923
447 Ga0197907_11114946
448 Ga0206352_10695464
449 Ga0213876_10256760
450 Ga0224712_10539060
451 Ga0207692_10172841
452 Ga0207692_10790236
453 Ga0207688_10297510
454 Ga0207647_10060661
455 Ga0207705_10010403
456 Ga0207684_10016495
457 Ga0207684_10246588
458 Ga0207671_10060536
459 Ga0207671_10068542
460 Ga0207693_10011068
461 Ga0207646_10093669
462 Ga0207646_10251899
463 Ga0207687_10582739
464 Ga0207700_10674315
465 Ga0207664_10385253
466 Ga0207664_10438031
467 Ga0207664_11406680
468 Ga0207664_11735248
469 Ga0207709_11335380
470 Ga0207669_10692234
471 Ga0207665_10625665
472 Ga0207711_11238493
473 Ga0207661_10036061
474 Ga0207661_12013561
475 Ga0207679_10250527
476 Ga0207667_10015768
477 Ga0207667_10070557
478 Ga0207667_10157684
479 Ga0207677_11881640
480 Ga0207702_10139297
481 Ga0207702_10253218
482 Ga0207702_10360415
483 Ga0207702_10411710
484 Ga0207702_10475903
485 Ga0207702_11279535
486 Ga0207648_10519610
487 Ga0207674_10091500
488 Ga0207698_10110259
489 Ga0207698_10165780
490 Ga0265319_1000799
491 Ga0265319_1051133
492 Ga0265318_10001913
493 Ga0265338_10015665
494 Ga0265338_10345534
495 Ga0265777_103033
496 Ga0265770_1151121
497 Ga0265760_10021916
498 Ga0265330_10431665
499 Ga0265328_10214158
500 Ga0265320_10006124
501 Ga0265325_10140377
502 Ga0265325_10434183
503 Ga0265327_10035135
504 Ga0265316_10639130
505 Ga0310117_114065
506 Ga0265314_10138485
507 Ga0265314_10367439
508 Ga0265342_10685349
509 Ga0307412_11517159
510 Ga0307409_101133438
511 Ga0307409_102461622
512 Ga0307510_10342443
513 Ga0373926_0002809
514 Ga0373926_0142593
515 Ga0373934_0001612
516 Ga0373944_0030460
517 Ga0373944_0098310
518 Ga0373923_0001042
519 Ga0373923_0028994
520 Ga0373936_0002811
521 Ga0373945_0004085
522 Ga0373945_0009656
523 Ga0373953_0012181
524 Ga0373953_0040807
525 Ga0373954_0289419
526 Ga0373956_0019251
527 Ga0373957_0012060
528 Ga0373943_0004870
529 Ga0373943_0016081
530 Ga0373943_0030015
531 Ga0373943_0720441
532 Ga0373946_0000622
533 Ga0373955_0027255
534 Ga0373955_0341921
535 Ga0373955_1016428
536 Ga0316574_0043428
537 Ga0373924_0000951
538 Ga0373924_0014556
539 Ga0373935_0003396
540 Ga0373935_0066548
541 Ga0373927_0003263
542 Ga0373927_0065756
543 Ga0373927_0174542
544 Ga0373927_0197129
545 Ga0373933_0033544
546 Ga0373947_0003603
547 Ga0373947_0005553
548 Ga0373947_0005609
549 Ga0373947_1205372
550 Ga0373937_0092797
551 Ga0373937_0110348
552 Ga0316584_0690796
553 Ga0373925_0027801
554 Ga0373925_0736782
555 Ga0395899_0104513
556 Ga0395900_0068643
557 Ga0395898_0076318
558 Ga0395898_0303364
559 Ga0395905_0070729
560 Ga0395905_0394823
561 Ga0395905_0737184
562 Ga0436364_1404658
563 Ga0395901_0142211
564 Ga0395901_0498350
565 Ga0395901_1278915
566 Ga0436365_1758047
567 Ga0436365_1882390
568 Ga0436360_0594379
569 Ga0436361_0092808
570 Ga0436361_0403168
571 Ga0451789_0670320
572 Ga0451793_0749871
573 Ga0451793_1873201
574 Ga0451835_0530294
575 Ga0451847_0803337
576 Ga0451853_1365569
577 Ga0451853_3432588
578 Ga0466961_0357196
579 Ga0466970_0819360
580 Ga0495592_0085309
581 Ga0495603_0001337
582 Ga0495603_0041110
583 Ga0495603_0351442
584 Ga0495603_0626501
585 Ga0495629_0024673
586 Ga0495629_0054500
587 Ga0495629_0136085
588 Ga0495629_0259016
589 Ga0495641_0006495
590 Ga0495641_0090066
591 Ga0495641_0142153
592 Ga0495641_0189730
593 Ga0495641_0238319
594 Ga0495651_0120994
595 Ga0495651_0307821
596 Ga0495651_0574173
597 Ga0495653_0064908
598 Ga0495653_0160577
599 Ga0495653_0298204
600 Ga0495580_0011111
601 Ga0495580_0166908
602 Ga0495582_0001101
603 Ga0495582_0010009
604 Ga0495582_0110268
605 Ga0495582_0507275
606 Ga0495639_0002557
607 Ga0495639_0009535
608 Ga0495639_0369309
609 Ga0495662_0001115
610 Ga0495662_0005115
611 Ga0495664_0025642
612 Ga0495664_0203800
613 Ga0495594_0008806
614 Ga0495594_0029182
615 Ga0495583_0198346
616 Ga0495608_0010750
617 Ga0495608_0043236
618 Ga0495618_0005400
619 Ga0495618_0032385
620 Ga0495628_0030820
621 Ga0495630_0014933
622 Ga0495630_0022276
623 Ga0495630_0119188
624 Ga0495666_0001453
625 Ga0495666_0054317
626 Ga0495652_0025731
627 Ga0495652_0301422
628 Ga0495665_0006391
629 Ga0495665_0010305
630 Ga0495640_0022018
631 Ga0495640_0031644
632 Ga0495586_0004264
633 Ga0495586_0042673
634 Ga0495587_0054751
635 Ga0495645_0055129
636 Ga0495622_0074461
637 Ga0495667_0042654
638 Ga0495667_0460846
639 Ga0495656_0019390
640 Ga0495634_0003607
641 Ga0495634_0256560
642 Ga0495634_0376512
643 Ga0495635_0019077
644 Ga0495635_0041747
645 Ga0495635_0830887
646 Ga0495588_0038441
647 Ga0495588_0049105
648 Ga0495657_0013787
649 Ga0495657_0163145
650 Ga0495599_0026886
651 Ga0495623_0036425
652 Ga0495623_0061416
653 Ga0495623_0340248
654 Ga0495646_0027202
655 Ga0495647_0000605
656 Ga0495647_0569509
657 Ga0495658_0018214
658 Ga0495658_0061654
659 Ga0495658_0534653
660 Ga0495613_0005163
661 Ga0495613_0064459
662 Ga0495613_0115280
663 Ga0495613_0124342
664 Ga0495613_0292801
665 Ga0495624_0003126
666 Ga0495624_0090787
667 Ga0495624_0482991
668 Ga0495600_0012533
669 Ga0495600_0017084
670 Ga0495600_0206782
671 Ga0495600_0315100
672 Ga0495581_0000033
673 Ga0495581_0007706
674 Ga0495581_0276503
675 Ga0495581_0500309
676 Ga0495581_0563774
677 Ga0495604_0024141
678 Ga0495604_0139379
679 Ga0495636_0002462
680 Ga0495674_0008492
681 Ga0495674_0076322
682 Ga0495674_0223998
683 Ga0495676_0022657
684 Ga0495676_0054434
685 Ga0495676_0355391
686 Ga0495676_0460987
687 Ga0495680_0032981
688 Ga0495680_0046359
689 Ga0495680_0132653
690 Ga0495680_0229666
691 Ga0495675_0003899
692 Ga0495675_0050299
693 Ga0495684_0004235
694 Ga0495684_0773735
695 Ga0495684_0922022
696 Ga0495593_0002887
697 Ga0495593_0004177
698 Ga0495602_0074681
699 Ga0495602_0685851
700 Ga0495615_0156765
701 Ga0496100_0725019
702 Ga0496101_0108272
703 Ga0496102_0001991
704 Ga0496103_0005055
705 Ga0496103_0720621
706 Ga0496104_0141117
707 Ga0496105_0212185
708 Ga0496105_0221519
709 Ga0496105_0344461
710 Ga0496105_0717755
711 Ga0496105_1137502
712 Ga0496106_0245058
713 Ga0496107_0493375
714 Ga0496107_1085489
715 Ga0496108_0177594
716 Ga0496108_0406231
717 Ga0496108_0690187
718 Ga0496108_0794208
719 Ga0496108_0841961
720 Ga0496108_0907475
721 Ga0496108_1246873
722 Ga0496108_1598807
723 Ga0496109_0104123
724 Ga0496109_0116854
725 Ga0496109_0271450
726 Ga0496109_0593902
727 Ga0496110_0798594
728 Ga0496111_0025448
729 Ga0496111_0266072
730 Ga0496111_0723564
731 Ga0496112_0002905
732 Ga0496112_0329375
733 Ga0496112_0364967
734 Ga0496112_0405743
735 Ga0496112_0526348
736 Ga0496112_0717846
737 Ga0496112_1817341
738 Ga0496113_0022637
739 Ga0496113_0125386
740 Ga0496113_0471102
741 Ga0496114_0181967
742 Ga0496114_0471579
743 Ga0496115_0048204
744 Ga0501067_0046155
745 Ga0501075_1522080
746 nmdc:mga0n895_539209_c1
747 Ga0495601_0041712
748 Ga0495601_0265443
749 Ga0495601_0348845
750 Ga0495601_0627360
751 Ga0495601_0687584
752 Ga0495612_0003717
753 Ga0495612_0046044
754 Ga0495612_0062051
755 Ga0495595_0002740
756 Ga0495595_0010705
757 Ga0495619_0006852
758 Ga0495619_0155197
759 Ga0495619_0473190
760 Ga0495619_0513860
761 Ga0495619_0958741
762 Ga0587066_226548
763 Ga0587082_189546
764 Ga0587062_084990
765 Ga0587072_106637
766 Ga0587114_083330
767 Ga0587111_0118919
768 Ga0587111_0159213
769 2812375884
770 2819689998
771 2819726438
772 8015556817

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y0h-assembly1.cif.gz_B structure of rv0793 from mycobacterium tuberculosis 0.7169 1 93
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.7114 2 92
4zos-assembly1.cif.gz_C 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.7011 2 93
1y0h-assembly1.cif.gz_B structure of rv0793 from mycobacterium tuberculosis 0.6977 1 93
7w6f-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.694 1 87
ID Description Score Start End Superfamily
1y0hB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7169 1 93 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7114 2 92 3.30.70.100
af_Q54CJ9_3_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7051 2 88 3.30.70.100
af_A0A0P0WFG4_28_106_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6999 34 60 3.30.70.330
1y0hB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6977 1 93 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7W3P8K9-F1-model_v4 Antibiotic biosynthesis monooxygenase 1.007 1 95
AF-A0A6P1NTU8-F1-model_v4 Uncharacterized protein 1.006 2 95
AF-Q6MJK6-F1-model_v4 ABM domain-containing protein 0.9987 1 95
AF-X6CNR8-F1-model_v4 ABM domain-containing protein 0.9927 1 95
AF-F2A3R9-F1-model_v4 deleted 0.9922 1 95

Map