F430351

General Info

Members Datasets Scaffolds Average Seq Length
385 282 297 514

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2824653114|2824659716
Length 567
Sequence RIGRLEAWPIATPIKPEDVMATQTMSIGAVHGEERASWVPMIAIALGQMIMSFNVASLPVAMGGMVTSFGVAPTTVATGIVAYSMLVAGFVMLGAKLAQRFGALQVFRGAVVLFFVSQVMMTFSPSAAVMISAQALCGVSGSVIVPSLVALIAENYAGRQQATALGALGSARAAAGVLAFIIGGVFGTYIGWRPAFGILIAASAIVFLMSFRLKPDRGRPDVQIDLVGVALAASAIILISFGFNNLNGWGLAVATANAPFDLFGLSPAPVMIVLGIVLGQSFLLWTHRRQAAGKTPLLALEVIDSPQERCAVFALFAVVALEAALNFTVPLYIQIVQGRSPLATAIAMMPFNLTVFFSAMLIVNVYERLTPRQIGRYGFACCTIALVWLAFVVRNDWSEIPVLFGLVLFGIGQGSLVTLLFNVLVTASPKPLAGDVGSLRGTTQNLAAAVGTAVAGALLVGLLSTIALGKITASPLLTTELQAQVDLDNITFVSNDRLRSVLEGTRGSPQQIAEAVRVNTEARLRALKIGLLIMAGLALIAIIPAGRLPNYLPGEIPSDEAAAKNPS

Samples

Sample ID Description Type Environment
1 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2516143018 Ensifer sp. BR816 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
9 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
10 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
11 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
12 2751185800 Brucella pituitosa AA2 Isolate Unclassified
13 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
14 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
15 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
16 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
17 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
18 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
19 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
20 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
21 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
22 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
23 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
24 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
25 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
26 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
27 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
28 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
29 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
30 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
31 2922368715
32 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
33 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
34 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
35 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
36 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
37 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
38 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
39 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
40 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
41 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
42 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
43 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
44 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
45 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
46 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
47 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
48 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
49 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
50 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
51 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
52 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
53 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
54 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
55 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
56 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
57 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
58 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
59 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
60 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
61 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
62 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
63 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
64 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
65 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
66 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
67 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
68 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
69 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
70 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
71 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
72 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
73 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
74 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
75 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
76 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
77 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
78 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
79 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
83 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
84 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
88 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
98 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
99 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
100 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
108 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
136 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
177 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
178 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
254 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
255 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
258 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
259 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
264 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
265 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
266 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
267 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
270 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
271 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
272 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
273 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
274 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
275 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
276 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
277 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
278 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
279 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
280 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
281 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
282 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.34
Metatranscriptomes 0
Isolates 22.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.66
Nodule 18.44
Rhizoplane 4.42
Rhizosphere 46.75
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000354 3300002987 Bacteria 21222
2 JGI25153J46596_10003254 3300003215 Bacteria 9135
3 rootL2_10028665 3300003322 Bacteria 2391
4 JGI25160J50197_1000026 3300003354 Bacteria 184693
5 JGI25161J50226_1000014 3300003374 Bacteria 191109
6 JGI25404J52841_10002781 3300003659 Bacteria 3369
7 JGI25404J52841_10005355 3300003659 Bacteria 2650
8 Ga0055543_1000052 3300004625 Bacteria 104887
9 Ga0065165_1000073 3300005262 Bacteria 164910
10 Ga0065165_1001131 3300005262 Bacteria 31347
11 Ga0068868_100024362 3300005338 Bacteria 4592
12 Ga0070668_100051939 3300005347 Bacteria 3159
13 Ga0070669_100049654 3300005353 Bacteria 3063
14 Ga0070671_100073640 3300005355 Unclassified 2853
15 Ga0070714_100007795 3300005435 Bacteria 8341
16 Ga0070711_100105092 3300005439 Bacteria 2061
17 Ga0070700_100045675 3300005441 Bacteria 2703
18 Ga0070663_100068601 3300005455 Bacteria 2574
19 Ga0070662_100010878 3300005457 Bacteria 5994
20 Ga0070662_100039179 3300005457 Bacteria 3370
21 Ga0070681_10012702 3300005458 Bacteria 8358
22 Ga0070679_100028818 3300005530 Bacteria 5477
23 Ga0070665_100006275 3300005548 Bacteria 12150
24 Ga0070704_100057871 3300005549 Bacteria 2759
25 Ga0068855_100004905 3300005563 Bacteria 16327
26 Ga0068855_100097253 3300005563 Bacteria 3391
27 Ga0070664_100020054 3300005564 Bacteria 5503
28 Ga0068857_100131448 3300005577 Bacteria 2258
29 Ga0068854_100009603 3300005578 Bacteria 6244
30 Ga0068856_100007605 3300005614 Bacteria 10574
31 Ga0068856_100192052 3300005614 Bacteria 2056
32 Ga0070702_100044169 3300005615 Bacteria 2514
33 Ga0068852_100095519 3300005616 Bacteria 2669
34 Ga0068864_100004657 3300005618 Bacteria 11252
35 Ga0068864_100069316 3300005618 Bacteria 3066
36 Ga0068861_100022888 3300005719 Bacteria 4504
37 Ga0068861_100032882 3300005719 Bacteria 3822
38 Ga0068861_100123534 3300005719 Bacteria 2091
39 Ga0068858_100016981 3300005842 Bacteria 6833
40 Ga0068860_100020322 3300005843 Bacteria 6432
41 Ga0068860_100024663 3300005843 Bacteria 5807
42 Ga0081455_10015910 3300005937 Bacteria 7282
43 Ga0081455_10041302 3300005937 Bacteria 4058
44 Ga0081538_10011784 3300005981 Bacteria 7057
45 Ga0081540_1003623 3300005983 Bacteria 12125
46 Ga0081540_1004383 3300005983 Bacteria 10792
47 Ga0081540_1005334 3300005983 Bacteria 9621
48 Ga0081540_1014753 3300005983 Bacteria 4984
49 Ga0075365_10015811 3300006038 Bacteria 4571
50 Ga0075365_10022900 3300006038 Bacteria 3921
51 Ga0075365_10040575 3300006038 Bacteria 3036
52 Ga0075365_10101566 3300006038 Bacteria 1969
53 Ga0075368_10023247 3300006042 Bacteria 2365
54 Ga0075363_100062552 3300006048 Bacteria 2007
55 Ga0075364_10001020 3300006051 Bacteria 14868
56 Ga0075364_10005510 3300006051 Bacteria 7365
57 Ga0075364_10030506 3300006051 Bacteria 3460
58 Ga0075364_10064521 3300006051 Bacteria 2404
59 Ga0075364_10114816 3300006051 Bacteria 1799
60 Ga0070712_100128175 3300006175 Bacteria 1920
61 Ga0075367_10014652 3300006178 Bacteria 4245
62 Ga0075367_10067675 3300006178 Bacteria 2141
63 Ga0075369_10003155 3300006186 Bacteria 5974
64 Ga0075369_10004802 3300006186 Bacteria 5026
65 Ga0097621_100000034 3300006237 Bacteria 69159
66 Ga0097621_100019612 3300006237 Bacteria 5194
67 Ga0075370_10021926 3300006353 Bacteria 3502
68 Ga0075370_10050280 3300006353 Bacteria 2364
69 Ga0068871_100000819 3300006358 Bacteria 20831
70 Ga0068871_100053959 3300006358 Bacteria 3259
71 Ga0075430_100000105 3300006846 Bacteria 50527
72 Ga0075431_100019913 3300006847 Bacteria 6851
73 Ga0075433_10061478 3300006852 Bacteria 3290
74 Ga0075434_100036693 3300006871 Bacteria 4849
75 Ga0099824_1016566 3300006942 Bacteria 6644
76 Ga0105251_10003566 3300009011 Bacteria 11223
77 Ga0105240_10004625 3300009093 Bacteria 20865
78 Ga0105245_10011559 3300009098 Bacteria 7688
79 Ga0105247_10004435 3300009101 Bacteria 8957
80 Ga0105247_10018477 3300009101 Bacteria 4182
81 Ga0105247_10034168 3300009101 Bacteria 3097
82 Ga0114129_10084372 3300009147 Bacteria 4411
83 Ga0114129_10216023 3300009147 Bacteria 2589
84 Ga0105243_10028117 3300009148 Bacteria 4314
85 Ga0105242_10055287 3300009176 Bacteria 3247
86 Ga0105248_10020758 3300009177 Bacteria 7277
87 Ga0105248_10184360 3300009177 Bacteria 2352
88 Ga0105237_10171193 3300009545 Bacteria 2171
89 Ga0105238_10000313 3300009551 Bacteria 53005
90 Ga0105238_10020648 3300009551 Bacteria 6709
91 Ga0105249_10098705 3300009553 Bacteria 2744
92 Ga0105239_10095909 3300010375 Bacteria 3276
93 Ga0105246_10023808 3300011119 Bacteria 3968
94 Ga0105246_10084631 3300011119 Bacteria 2269
95 Ga0157369_10000204 3300013105 Bacteria 82045
96 Ga0157374_10000182 3300013296 Bacteria 58386
97 Ga0157374_10000249 3300013296 Bacteria 49808
98 Ga0157374_10031553 3300013296 Bacteria 4817
99 Ga0157378_10000008 3300013297 Bacteria 162605
100 Ga0157378_10004775 3300013297 Bacteria 11873
101 Ga0163162_10004730 3300013306 Bacteria 13131
102 Ga0163162_10252720 3300013306 Bacteria 1894
103 Ga0157372_10000930 3300013307 Bacteria 31906
104 Ga0157375_10104430 3300013308 Bacteria 2922
105 Ga0163163_10014144 3300014325 Bacteria 7329
106 Ga0163163_10219163 3300014325 Bacteria 1951
107 Ga0157379_10158670 3300014968 Bacteria 2042
108 Ga0163161_10022824 3300017792 Bacteria 4408
109 Ga0209233_1003744 3300025261 Bacteria 5315
110 Ga0209233_1007198 3300025261 Bacteria 3541
111 Ga0209130_1000121 3300025284 Bacteria 127462
112 Ga0209130_1001796 3300025284 Bacteria 12596
113 Ga0209758_1005997 3300025297 Bacteria 8989
114 Ga0207426_1000075 3300025302 Bacteria 321337
115 Ga0207426_1000102 3300025302 Bacteria 255303
116 Ga0207426_1001889 3300025302 Bacteria 15264
117 Ga0207426_1009701 3300025302 Bacteria 3786
118 Ga0207642_10013749 3300025899 Bacteria 2963
119 Ga0207688_10022304 3300025901 Bacteria 3464
120 Ga0207707_10002245 3300025912 Bacteria 17469
121 Ga0207693_10005583 3300025915 Bacteria 10455
122 Ga0207652_10009421 3300025921 Bacteria 7853
123 Ga0207694_10001550 3300025924 Bacteria 19495
124 Ga0207694_10090207 3300025924 Bacteria 2418
125 Ga0207687_10004981 3300025927 Bacteria 8803
126 Ga0207644_10053539 3300025931 Unclassified 2904
127 Ga0207706_10019237 3300025933 Bacteria 6141
128 Ga0207704_10028728 3300025938 Bacteria 3090
129 Ga0207711_10017667 3300025941 Bacteria 5925
130 Ga0207711_10045570 3300025941 Bacteria 3748
131 Ga0207689_10009490 3300025942 Bacteria 8400
132 Ga0207689_10012477 3300025942 Bacteria 7259
133 Ga0207689_10021801 3300025942 Bacteria 5386
134 Ga0207661_10009608 3300025944 Bacteria 6944
135 Ga0207667_10001192 3300025949 Bacteria 32605
136 Ga0207667_10002895 3300025949 Bacteria 21309
137 Ga0207667_10163405 3300025949 Bacteria 2289
138 Ga0207668_10022549 3300025972 Bacteria 4033
139 Ga0207668_10046433 3300025972 Bacteria 2967
140 Ga0207658_10160721 3300025986 Bacteria 1841
141 Ga0207703_10040537 3300026035 Bacteria 3726
142 Ga0207703_10095353 3300026035 Unclassified 2510
143 Ga0207639_10185166 3300026041 Unclassified 1775
144 Ga0207678_10001795 3300026067 Bacteria 19666
145 Ga0207678_10004089 3300026067 Bacteria 13122
146 Ga0207678_10030891 3300026067 Bacteria 4676
147 Ga0207708_10008852 3300026075 Bacteria 7452
148 Ga0207702_10001614 3300026078 Bacteria 22290
149 Ga0207702_10002159 3300026078 Bacteria 18888
150 Ga0207702_10075310 3300026078 Bacteria 2915
151 Ga0207648_10022541 3300026089 Bacteria 5653
152 Ga0207676_10005952 3300026095 Bacteria 8601
153 Ga0207676_10032192 3300026095 Bacteria 3949
154 Ga0207674_10016932 3300026116 Bacteria 7961
155 Ga0207675_100008340 3300026118 Bacteria 9761
156 Ga0207675_100042347 3300026118 Bacteria 4251
157 Ga0207675_100046536 3300026118 Bacteria 4053
158 Ga0207683_10045349 3300026121 Bacteria 3845
159 Ga0209589_1000030 3300027357 Bacteria 147457
160 Ga0209489_100056 3300027361 Bacteria 147457
161 Ga0209700_100059 3300027363 Bacteria 147457
162 Ga0209813_10014587 3300027866 Bacteria 2118
163 Ga0268266_10004259 3300028379 Bacteria 13765
164 Ga0268266_10062821 3300028379 Bacteria 3206
165 Ga0268265_10021703 3300028380 Bacteria 4502
166 Ga0268265_10083576 3300028380 Bacteria 2528
167 Ga0307408_100014910 3300031548 Bacteria 5170
168 Ga0307408_100112069 3300031548 Bacteria 2097
169 Ga0307409_100045911 3300031995 Bacteria 3302
170 Ga0307510_10001352 3300033180 Bacteria 26762
171 Ga0307510_10077521 3300033180 Bacteria 3259
172 Ga0315911_1000009 3300033442 Bacteria 379354
173 Ga0373932_0010433 3300035112 Bacteria 2248
174 Ga0373931_0019492 3300035691 Bacteria 3386
175 Ga0373931_0063269 3300035691 Unclassified 1999
176 Ga0373927_0009095 3300035695 Bacteria 6667
177 Ga0373925_0041743 3300037068 Bacteria 3402
178 Ga0436364_1368874 3300037853 Bacteria 1756
179 Ga0436364_1420692 3300037853 Bacteria 8891
180 Ga0436365_0346933 3300039437 Bacteria 3673
181 Ga0453684_0100043 3300044712 Bacteria 3550
182 Ga0453684_0257268 3300044712 Bacteria 2002
183 Ga0451576_0001024 3300045051 Bacteria 51781
184 Ga0451576_0046365 3300045051 Bacteria 4577
185 Ga0495590_0030595 3300046457 Bacteria 1886
186 Ga0495664_0041203 3300046477 Bacteria 2732
187 Ga0495584_0005399 3300046491 Bacteria 6769
188 Ga0495607_0092233 3300046501 Bacteria 1639
189 Ga0495606_0004621 3300046507 Bacteria 13636
190 Ga0495648_0059900 3300046524 Bacteria 2268
191 Ga0495613_0100613 3300046689 Bacteria 2088
192 Ga0495671_0059594 3300046692 Bacteria 1886
193 Ga0495686_0031036 3300047472 Bacteria 3468
194 Ga0495686_0105836 3300047472 Bacteria 1692
195 Ga0496100_0083482 3300048903 Bacteria 2163
196 Ga0496100_0085235 3300048903 Unclassified 2144
197 Ga0496101_0049417 3300048904 Bacteria 3025
198 Ga0496103_0031162 3300048906 Bacteria 3248
199 Ga0496104_0030742 3300048907 Bacteria 4992
200 Ga0496104_0158268 3300048907 Bacteria 2173
201 Ga0496105_0038063 3300048908 Bacteria 3962
202 Ga0496106_0008572 3300048909 Bacteria 7565
203 Ga0496106_0020036 3300048909 Bacteria 4961
204 Ga0496106_0065772 3300048909 Bacteria 2760
205 Ga0496107_0023617 3300048910 Bacteria 4348
206 Ga0496108_0058093 3300048911 Bacteria 3250
207 Ga0496112_0000814 3300048915 Bacteria 22067
208 Ga0496113_0078094 3300048916 Bacteria 2533
209 Ga0496114_0194437 3300048917 Bacteria 1775
210 Ga0496115_0056245 3300048918 Bacteria 3162
211 Ga0496115_0074994 3300048918 Bacteria 2747
212 Ga0496116_0057548 3300048919 Bacteria 2541
213 Ga0496117_0022619 3300048920 Bacteria 5038
214 Ga0496118_0024090 3300048921 Bacteria 5265
215 Ga0496121_0000694 3300048924 Bacteria 62818
216 Ga0496121_0001662 3300048924 Bacteria 36711
217 Ga0496121_0003864 3300048924 Bacteria 20824
218 Ga0496121_0022855 3300048924 Bacteria 6044
219 Ga0496121_0024776 3300048924 Bacteria 5723
220 Ga0496121_0031761 3300048924 Bacteria 4817
221 Ga0496121_0035274 3300048924 Bacteria 4486
222 Ga0496122_0012818 3300048925 Bacteria 8290
223 Ga0496122_0037431 3300048925 Bacteria 3905
224 Ga0496122_0039852 3300048925 Bacteria 3741
225 Ga0496123_0043054 3300048926 Bacteria 3107
226 Ga0496125_0000428 3300048928 Bacteria 77638
227 Ga0496125_0001155 3300048928 Bacteria 40039
228 Ga0496125_0031626 3300048928 Bacteria 4714
229 Ga0496125_0066307 3300048928 Bacteria 2854
230 Ga0496126_0008969 3300048929 Bacteria 10705
231 Ga0496126_0019180 3300048929 Bacteria 6742
232 Ga0496126_0078020 3300048929 Bacteria 2935
233 Ga0496126_0129346 3300048929 Bacteria 2183
234 Ga0496126_0241061 3300048929 Bacteria 1510
235 Ga0501031_0016011 3300049568 Bacteria 4869
236 Ga0501032_0000051 3300049569 Bacteria 101366
237 Ga0501033_0000114 3300049570 Bacteria 77168
238 Ga0501033_0033848 3300049570 Bacteria 3836
239 Ga0501034_0000094 3300049571 Bacteria 163124
240 Ga0501034_0197212 3300049571 Bacteria 1973
241 Ga0501036_0000129 3300049572 Bacteria 48319
242 Ga0501037_0000057 3300049573 Bacteria 107920
243 Ga0501038_0000031 3300049574 Bacteria 132231
244 Ga0501039_0000099 3300049575 Bacteria 60203
245 Ga0501039_0086801 3300049575 Bacteria 2437
246 Ga0501041_0088865 3300049577 Bacteria 1907
247 Ga0501043_0000040 3300049579 Bacteria 117024
248 Ga0501047_0014603 3300049581 Bacteria 7472
249 Ga0501067_0025868 3300049583 Bacteria 3252
250 Ga0501075_0010771 3300049591 Bacteria 6442
251 Ga0501076_0041968 3300049592 Bacteria 3602
252 Ga0501035_0000154 3300049822 Bacteria 84548
253 Ga0501035_0039057 3300049822 Bacteria 4297
254 Ga0501044_0033866 3300049823 Bacteria 5364
255 Ga0501044_0040101 3300049823 Bacteria 4883
256 nmdc:mga03683_27187_c1 3300050489 Bacteria 2263
257 nmdc:mga03n38_459_c1 3300050490 Bacteria 10198
258 nmdc:mga03n38_55558_c1 3300050490 Bacteria 1784
259 nmdc:mga00v17_13885_c1 3300050491 Bacteria 4481
260 nmdc:mga00v17_19622_c1 3300050491 Bacteria 3863
261 nmdc:mga00v17_29458_c1 3300050491 Bacteria 3222
262 nmdc:mga0yw44_24346_c1 3300050492 Bacteria 3425
263 nmdc:mga0yw44_7279_c1 3300050492 Bacteria 5429
264 nmdc:mga06z11_377_c1 3300050494 Bacteria 16781
265 nmdc:mga06z11_4798_c1 3300050494 Bacteria 5348
266 nmdc:mga06z11_53551_c1 3300050494 Bacteria 2076
267 nmdc:mga04h51_29697_c1 3300050495 Bacteria 1715
268 nmdc:mga07m45_17864_c1 3300050496 Bacteria 3817
269 nmdc:mga0qj67_19_c1 3300050509 Bacteria 112208
270 nmdc:mga06r32_155262_c1 3300050510 Bacteria 2270
271 nmdc:mga06r32_3780_c2 3300050510 Bacteria 6530
272 nmdc:mga08y16_64020_c1 3300050511 Bacteria 3840
273 nmdc:mga0n895_261372_c1 3300050512 Bacteria 1757
274 nmdc:mga0rr50_31465_c1 3300050513 Bacteria 3769
275 nmdc:mga0a205_91250_c1 3300050515 Bacteria 2943
276 Ga0500643_000107 3300053087 Bacteria 87031
277 Ga0500566_0000060 3300053094 Bacteria 52549
278 Ga0500640_024171 3300053095 Bacteria 2637
279 Ga0500572_001921 3300053111 Bacteria 5216
280 Ga0500595_004932 3300053119 Bacteria 5899
281 Ga0500595_022547 3300053119 Bacteria 2227
282 Ga0500607_014736 3300053121 Bacteria 4524
283 Ga0500607_031324 3300053121 Bacteria 2925
284 Ga0500559_0003507 3300053136 Bacteria 7685
285 Ga0500564_017105 3300053138 Bacteria 3292
286 Ga0500568_0004484 3300053139 Bacteria 7449
287 Ga0500586_000498 3300053145 Bacteria 7886
288 Ga0500616_0030895 3300053153 Bacteria 2938
289 Ga0500619_008608 3300053154 Bacteria 2488
290 Ga0500622_0001319 3300053156 Bacteria 20183
291 Ga0500622_0006133 3300053156 Bacteria 7057
292 Ga0500622_0016176 3300053156 Bacteria 3987
293 Ga0500634_0034555 3300053161 Bacteria 2754
294 Ga0500636_0000014 3300053177 Bacteria 124740
295 Ga0500645_000434 3300053730 Bacteria 28643
296 Ga0500645_003853 3300053730 Bacteria 5940
297 Ga0501084_0131079 3300054114 Bacteria 2110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0241061 Ga0496126_0241061_28_1485 434
2 iso_pu_bacteria 8016511872 8016516145 443
3 3300048903 Ga0496100_0085235 Ga0496100_0085235_555_2132 444
4 3300044712 Ga0453684_0100043 Ga0453684_0100043_1727_3328 445
5 3300053121 Ga0500607_031324 Ga0500607_031324_357_2006 448
6 3300053145 Ga0500586_000498 Ga0500586_000498_1575_3224 448
7 iso_pu_bacteria 8019576017 8019579849 450
8 3300014968 Ga0157379_10158670 Ga0157379_101586702 454
9 3300053153 Ga0500616_0030895 Ga0500616_0030895_432_2081 454
10 3300053156 Ga0500622_0016176 Ga0500622_0016176_1759_3366 457
11 3300005435 Ga0070714_100007795 Ga0070714_1000077953 458
12 3300025915 Ga0207693_10005583 Ga0207693_1000558310 458
13 3300046457 Ga0495590_0030595 Ga0495590_0030595_75_1724 460
14 3300047472 Ga0495686_0105836 Ga0495686_0105836_193_1644 460
15 3300048929 Ga0496126_0078020 Ga0496126_0078020_1186_2835 460
16 3300053161 Ga0500634_0034555 Ga0500634_0034555_632_2281 460
17 3300005458 Ga0070681_10012702 Ga0070681_100127024 461
18 3300005530 Ga0070679_100028818 Ga0070679_1000288184 461
19 3300005563 Ga0068855_100004905 Ga0068855_10000490515 461
20 3300005578 Ga0068854_100009603 Ga0068854_1000096034 461
21 3300005614 Ga0068856_100007605 Ga0068856_1000076052 461
22 3300009093 Ga0105240_10004625 Ga0105240_1000462518 461
23 3300009098 Ga0105245_10011559 Ga0105245_100115596 461
24 3300009101 Ga0105247_10018477 Ga0105247_100184774 461
25 3300009177 Ga0105248_10020758 Ga0105248_100207584 461
26 3300009551 Ga0105238_10000313 Ga0105238_1000031347 461
27 3300009551 Ga0105238_10020648 Ga0105238_100206484 461
28 3300011119 Ga0105246_10023808 Ga0105246_100238084 461
29 3300013105 Ga0157369_10000204 Ga0157369_100002041 461
30 3300013296 Ga0157374_10000182 Ga0157374_1000018249 461
31 3300013296 Ga0157374_10031553 Ga0157374_100315534 461
32 3300013297 Ga0157378_10004775 Ga0157378_100047751 461
33 3300013307 Ga0157372_10000930 Ga0157372_1000093031 461
34 3300014325 Ga0163163_10014144 Ga0163163_100141444 461
35 3300025912 Ga0207707_10002245 Ga0207707_1000224515 461
36 3300025921 Ga0207652_10009421 Ga0207652_100094216 461
37 3300025924 Ga0207694_10001550 Ga0207694_100015504 461
38 3300025944 Ga0207661_10009608 Ga0207661_100096083 461
39 3300025949 Ga0207667_10002895 Ga0207667_100028954 461
40 3300026035 Ga0207703_10095353 Ga0207703_100953533 461
41 3300026078 Ga0207702_10001614 Ga0207702_1000161416 461
42 3300026116 Ga0207674_10016932 Ga0207674_100169323 461
43 3300048909 Ga0496106_0020036 Ga0496106_0020036_79_1668 461
44 3300048915 Ga0496112_0000814 Ga0496112_0000814_889_2529 461
45 3300048916 Ga0496113_0078094 Ga0496113_0078094_916_2505 461
46 3300048924 Ga0496121_0024776 Ga0496121_0024776_1268_2857 461
47 3300050491 nmdc:mga00v17_19622_c1 nmdc:mga00v17_19622_c1_557_2146 461
48 3300050495 nmdc:mga04h51_29697_c1 nmdc:mga04h51_29697_c1_113_1702 461
49 3300050496 nmdc:mga07m45_17864_c1 nmdc:mga07m45_17864_c1_1700_3289 461
50 3300005338 Ga0068868_100024362 Ga0068868_1000243623 462
51 3300005549 Ga0070704_100057871 Ga0070704_1000578712 462
52 3300005719 Ga0068861_100032882 Ga0068861_1000328822 462
53 3300006237 Ga0097621_100000034 Ga0097621_1000000342 462
54 3300025986 Ga0207658_10160721 Ga0207658_101607211 463
55 3300026118 Ga0207675_100042347 Ga0207675_1000423473 463
56 3300028380 Ga0268265_10021703 Ga0268265_100217032 463
57 3300050494 nmdc:mga06z11_53551_c1 nmdc:mga06z11_53551_c1_594_2063 463
58 3300005353 Ga0070669_100049654 Ga0070669_1000496542 464
59 3300005457 Ga0070662_100039179 Ga0070662_1000391792 464
60 3300006038 Ga0075365_10040575 Ga0075365_100405752 464
61 3300006051 Ga0075364_10030506 Ga0075364_100305062 464
62 3300006186 Ga0075369_10004802 Ga0075369_100048022 464
63 3300009147 Ga0114129_10216023 Ga0114129_102160232 464
64 3300025942 Ga0207689_10012477 Ga0207689_100124775 464
65 3300025972 Ga0207668_10046433 Ga0207668_100464334 464
66 3300026041 Ga0207639_10185166 Ga0207639_101851661 464
67 3300048924 Ga0496121_0031761 Ga0496121_0031761_1443_3080 464
68 3300048925 Ga0496122_0037431 Ga0496122_0037431_1965_3524 464
69 3300048928 Ga0496125_0000428 Ga0496125_0000428_12274_13833 464
70 3300048929 Ga0496126_0019180 Ga0496126_0019180_2902_4551 464
71 3300050491 nmdc:mga00v17_29458_c1 nmdc:mga00v17_29458_c1_1124_2773 464
72 3300050492 nmdc:mga0yw44_7279_c1 nmdc:mga0yw44_7279_c1_954_2603 464
73 3300005355 Ga0070671_100073640 Ga0070671_1000736401 465
74 3300006358 Ga0068871_100000819 Ga0068871_1000008192 465
75 3300013296 Ga0157374_10000249 Ga0157374_100002491 465
76 3300013297 Ga0157378_10000008 Ga0157378_1000000812 465
77 3300025931 Ga0207644_10053539 Ga0207644_100535391 465
78 3300025941 Ga0207711_10045570 Ga0207711_100455702 465
79 3300025949 Ga0207667_10001192 Ga0207667_100011929 465
80 3300026078 Ga0207702_10002159 Ga0207702_1000215918 465
81 3300026095 Ga0207676_10005952 Ga0207676_100059522 465
82 3300035691 Ga0373931_0063269 Ga0373931_0063269_196_1878 465
83 3300048929 Ga0496126_0129346 Ga0496126_0129346_22_1608 465
84 3300050489 nmdc:mga03683_27187_c1 nmdc:mga03683_27187_c1_490_2139 465
85 3300053730 Ga0500645_003853 Ga0500645_003853_387_2039 465
86 3300031995 Ga0307409_100045911 Ga0307409_1000459112 466
87 3300053156 Ga0500622_0001319 Ga0500622_0001319_12878_14485 466
88 3300048918 Ga0496115_0074994 Ga0496115_0074994_1270_2724 467
89 3300048924 Ga0496121_0000694 Ga0496121_0000694_45366_46952 467
90 3300005843 Ga0068860_100024663 Ga0068860_1000246632 468
91 3300025942 Ga0207689_10021801 Ga0207689_100218012 468
92 3300026035 Ga0207703_10040537 Ga0207703_100405372 468
93 3300028380 Ga0268265_10083576 Ga0268265_100835762 468
94 3300048917 Ga0496114_0194437 Ga0496114_0194437_314_1753 468
95 3300049577 Ga0501041_0088865 Ga0501041_0088865_459_1886 468
96 3300050490 nmdc:mga03n38_55558_c1 nmdc:mga03n38_55558_c1_17_1441 468
97 3300053156 Ga0500622_0006133 Ga0500622_0006133_5227_6870 469
98 3300006353 Ga0075370_10021926 Ga0075370_100219264 472
99 3300048918 Ga0496115_0056245 Ga0496115_0056245_1006_2601 472
100 3300048924 Ga0496121_0035274 Ga0496121_0035274_2637_4274 474
101 3300046501 Ga0495607_0092233 Ga0495607_0092233_49_1620 475
102 3300048924 Ga0496121_0003864 Ga0496121_0003864_5549_7138 477
103 3300049583 Ga0501067_0025868 Ga0501067_0025868_486_2081 477
104 3300054114 Ga0501084_0131079 Ga0501084_0131079_29_1588 477
105 3300003322 rootL2_10028665 rootL2_100286653 479
106 3300026118 Ga0207675_100046536 Ga0207675_1000465365 479
107 3300039437 Ga0436365_0346933 Ga0436365_0346933_22_1542 479
108 3300005441 Ga0070700_100045675 Ga0070700_1000456752 480
109 3300005457 Ga0070662_100010878 Ga0070662_1000108784 480
110 3300005563 Ga0068855_100097253 Ga0068855_1000972533 480
111 3300005577 Ga0068857_100131448 Ga0068857_1001314481 480
112 3300005614 Ga0068856_100192052 Ga0068856_1001920522 480
113 3300005618 Ga0068864_100004657 Ga0068864_1000046575 480
114 3300005719 Ga0068861_100022888 Ga0068861_1000228882 480
115 3300005842 Ga0068858_100016981 Ga0068858_1000169814 480
116 3300005843 Ga0068860_100020322 Ga0068860_1000203225 480
117 3300006051 Ga0075364_10005510 Ga0075364_100055105 480
118 3300006186 Ga0075369_10003155 Ga0075369_100031552 480
119 3300006237 Ga0097621_100019612 Ga0097621_1000196124 480
120 3300006353 Ga0075370_10050280 Ga0075370_100502802 480
121 3300006358 Ga0068871_100053959 Ga0068871_1000539592 480
122 3300009553 Ga0105249_10098705 Ga0105249_100987052 480
123 3300025899 Ga0207642_10013749 Ga0207642_100137492 480
124 3300025901 Ga0207688_10022304 Ga0207688_100223044 480
125 3300025924 Ga0207694_10090207 Ga0207694_100902072 480
126 3300025927 Ga0207687_10004981 Ga0207687_100049816 480
127 3300025941 Ga0207711_10017667 Ga0207711_100176672 480
128 3300025942 Ga0207689_10009490 Ga0207689_100094905 480
129 3300025949 Ga0207667_10163405 Ga0207667_101634052 480
130 3300025972 Ga0207668_10022549 Ga0207668_100225494 480
131 3300026067 Ga0207678_10030891 Ga0207678_100308914 480
132 3300026078 Ga0207702_10075310 Ga0207702_100753103 480
133 3300026095 Ga0207676_10032192 Ga0207676_100321922 480
134 3300046477 Ga0495664_0041203 Ga0495664_0041203_287_1918 480
135 3300050511 nmdc:mga08y16_64020_c1 nmdc:mga08y16_64020_c1_985_2583 480
136 iso_pu_bacteria 2751185800 2753361552 480
137 iso_pu_bacteria 2937843397 2937847608 480
138 3300005983 Ga0081540_1004383 Ga0081540_10043836 481
139 3300005983 Ga0081540_1005334 Ga0081540_10053342 481
140 3300048910 Ga0496107_0023617 Ga0496107_0023617_2268_3902 482
141 iso_pu_bacteria 2879110137 2879114771 482
142 3300005548 Ga0070665_100006275 Ga0070665_1000062753 483
143 3300006846 Ga0075430_100000105 Ga0075430_10000010512 483
144 3300028379 Ga0268266_10004259 Ga0268266_100042595 483
145 3300050509 nmdc:mga0qj67_19_c1 nmdc:mga0qj67_19_c1_11475_13118 483
146 3300046491 Ga0495584_0005399 Ga0495584_0005399_1040_2632 484
147 3300048925 Ga0496122_0039852 Ga0496122_0039852_739_2298 484
148 3300048928 Ga0496125_0001155 Ga0496125_0001155_5758_7317 484
149 3300048928 Ga0496125_0066307 Ga0496125_0066307_43_1602 484
150 3300050494 nmdc:mga06z11_4798_c1 nmdc:mga06z11_4798_c1_3619_5208 484
151 3300053730 Ga0500645_000434 Ga0500645_000434_10672_12249 484
152 3300025261 Ga0209233_1007198 Ga0209233_10071982 485
153 3300044712 Ga0453684_0257268 Ga0453684_0257268_341_1978 485
154 3300053139 Ga0500568_0004484 Ga0500568_0004484_1138_2820 486
155 3300005937 Ga0081455_10015910 Ga0081455_100159104 487
156 3300025261 Ga0209233_1003744 Ga0209233_10037442 488
157 3300048921 Ga0496118_0024090 Ga0496118_0024090_179_1819 488
158 3300050510 nmdc:mga06r32_155262_c1 nmdc:mga06r32_155262_c1_469_2112 488
159 3300003659 JGI25404J52841_10002781 JGI25404J52841_100027811 489
160 3300005983 Ga0081540_1014753 Ga0081540_10147532 489
161 3300049571 Ga0501034_0197212 Ga0501034_0197212_415_1944 490
162 3300053119 Ga0500595_004932 Ga0500595_004932_2398_4035 490
163 3300049575 Ga0501039_0086801 Ga0501039_0086801_585_2276 491
164 3300049591 Ga0501075_0010771 Ga0501075_0010771_895_2589 491
165 3300049592 Ga0501076_0041968 Ga0501076_0041968_261_1955 491
166 3300053087 Ga0500643_000107 Ga0500643_000107_46087_47727 491
167 3300053095 Ga0500640_024171 Ga0500640_024171_545_2185 491
168 3300053121 Ga0500607_014736 Ga0500607_014736_1808_3511 491
169 3300053136 Ga0500559_0003507 Ga0500559_0003507_3808_5448 491
170 3300053138 Ga0500564_017105 Ga0500564_017105_615_2255 491
171 3300053154 Ga0500619_008608 Ga0500619_008608_64_1704 491
172 3300005262 Ga0065165_1001131 Ga0065165_100113137 492
173 3300025302 Ga0207426_1001889 Ga0207426_100188912 492
174 3300033180 Ga0307510_10001352 Ga0307510_1000135219 492
175 3300046507 Ga0495606_0004621 Ga0495606_0004621_1737_3326 493
176 3300048924 Ga0496121_0022855 Ga0496121_0022855_1829_3418 493
177 3300048928 Ga0496125_0031626 Ga0496125_0031626_557_2143 493
178 3300053094 Ga0500566_0000060 Ga0500566_0000060_21548_23188 495
179 3300003215 JGI25153J46596_10003254 JGI25153J46596_100032545 496
180 3300025297 Ga0209758_1005997 Ga0209758_10059974 496
181 3300033442 Ga0315911_1000009 Ga0315911_100000961 496
182 3300037853 Ga0436364_1420692 Ga0436364_1420692_3400_5025 496
183 3300009177 Ga0105248_10184360 Ga0105248_101843601 497
184 3300031548 Ga0307408_100112069 Ga0307408_1001120692 497
185 3300037853 Ga0436364_1368874 Ga0436364_1368874_38_1681 497
186 iso_pu_bacteria 2842775625 2842779785 497
187 3300009147 Ga0114129_10084372 Ga0114129_100843723 498
188 3300048911 Ga0496108_0058093 Ga0496108_0058093_844_2574 498
189 3300050492 nmdc:mga0yw44_24346_c1 nmdc:mga0yw44_24346_c1_256_1911 498
190 iso_pu_bacteria 2524023210 2524469694 499
191 iso_pu_bacteria 2996336353 2996338934 499
192 3300005937 Ga0081455_10041302 Ga0081455_100413022 500
193 3300053119 Ga0500595_022547 Ga0500595_022547_303_1931 500
194 iso_pu_bacteria 2513237087 2513589719 500
195 iso_pu_bacteria 2513237098 2513675115 500
196 iso_pu_bacteria 2513237101 2513695384 500
197 iso_pu_bacteria 2516143018 2516205195 500
198 iso_pu_bacteria 2528768022 2528855222 500
199 iso_pu_bacteria 2824661429 2824663002 500
200 iso_pu_bacteria 2885374607 2885377287 500
201 iso_pu_bacteria 2885383462 2885384534 500
202 iso_pu_bacteria 2903768456 2903777386 500
203 iso_pu_bacteria 2922368715 2922371620 500
204 iso_pu_bacteria 2929615660 2929617046 500
205 iso_pu_bacteria 2929624759 2929625789 500
206 iso_pu_bacteria 2932784394 2932790747 500
207 iso_pu_bacteria 2932809354 2932811933 500
208 iso_pu_bacteria 2932818245 2932822580 500
209 iso_pu_bacteria 2932828146 2932831166 500
210 iso_pu_bacteria 2933577622 2933577672 500
211 iso_pu_bacteria 2935616580 2935624796 500
212 iso_pu_bacteria 2935638405 2935646022 500
213 iso_pu_bacteria 2935665750 2935670639 500
214 iso_pu_bacteria 2935675223 2935679610 500
215 iso_pu_bacteria 2935684952 2935691374 500
216 iso_pu_bacteria 2935694250 2935701978 500
217 iso_pu_bacteria 2935703347 2935704605 500
218 iso_pu_bacteria 2935713505 2935719208 500
219 iso_pu_bacteria 2935722832 2935729192 500
220 iso_pu_bacteria 2935732158 2935737567 500
221 iso_pu_bacteria 2935741537 2935746943 500
222 iso_pu_bacteria 2935750917 2935758258 500
223 iso_pu_bacteria 2935760218 2935767346 500
224 iso_pu_bacteria 2935801545 2935808002 500
225 iso_pu_bacteria 2935810662 2935816409 500
226 iso_pu_bacteria 2935827899 2935835302 500
227 iso_pu_bacteria 2935837841 2935842850 500
228 iso_pu_bacteria 2935855204 2935863426 500
229 iso_pu_bacteria 2935864058 2935871538 500
230 iso_pu_bacteria 2935873716 2935881787 500
231 iso_pu_bacteria 2935992306 2935993792 500
232 iso_pu_bacteria 2936002035 2936010431 500
233 iso_pu_bacteria 2936037263 2936042639 500
234 iso_pu_bacteria 2940556831 2940563832 500
235 iso_pu_bacteria 2941499720 2941503890 500
236 iso_pu_bacteria 2941538514 2941546483 500
237 iso_pu_bacteria 3005710791 3005712224 500
238 iso_pu_bacteria 8017057580 8017060376 500
239 iso_pu_bacteria 8019586578 8019587559 500
240 iso_pu_bacteria 8019597564 8019603775 500
241 iso_pu_bacteria 8019608314 8019614758 500
242 iso_pu_bacteria 8055742211 8055748692 500
243 iso_pu_bacteria 8056681323 8056682266 500
244 3300009011 Ga0105251_10003566 Ga0105251_100035667 501
245 iso_pu_bacteria 2513237096 2513658429 501
246 iso_pu_bacteria 2513237145 2513920078 501
247 iso_pu_bacteria 2517572143 2517893447 501
248 iso_pu_bacteria 2524023228 2524537955 501
249 iso_pu_bacteria 2721755755 2723843768 501
250 iso_pu_bacteria 2824600985 2824607922 501
251 iso_pu_bacteria 2824609381 2824609956 501
252 iso_pu_bacteria 2828305725 2828310089 501
253 iso_pu_bacteria 2857509624 2857510066 501
254 iso_pu_bacteria 2874604998 2874612242 501
255 iso_pu_bacteria 2888419890 2888423139 501
256 iso_pu_bacteria 2889033259 2889042026 501
257 iso_pu_bacteria 2903748898 2903755602 501
258 iso_pu_bacteria 2906635258 2906640664 501
259 iso_pu_bacteria 2906660503 2906665883 501
260 iso_pu_bacteria 2922361189 2922366100 501
261 iso_pu_bacteria 2922386360 2922386811 501
262 iso_pu_bacteria 2932794094 2932797416 501
263 iso_pu_bacteria 2932801729 2932804702 501
264 iso_pu_bacteria 2935883170 2935885067 501
265 iso_pu_bacteria 2935959822 2935963447 501
266 iso_pu_bacteria 3005474847 3005479178 501
267 iso_pu_bacteria 3005710791 3005713605 501
268 iso_pu_bacteria 8006933436 8006942176 501
269 iso_pu_bacteria 8006964411 8006965015 501
270 iso_pu_bacteria 8006973647 8006981910 501
271 iso_pu_bacteria 8006994254 8006994376 501
272 iso_pu_bacteria 8019648815 8019656571 501
273 iso_pu_bacteria 8056673599 8056679846 501
274 3300005347 Ga0070668_100051939 Ga0070668_1000519392 502
275 3300005455 Ga0070663_100068601 Ga0070663_1000686012 502
276 3300006847 Ga0075431_100019913 Ga0075431_1000199135 502
277 3300009101 Ga0105247_10004435 Ga0105247_100044352 502
278 3300009545 Ga0105237_10171193 Ga0105237_101711932 502
279 3300013306 Ga0163162_10004730 Ga0163162_100047303 502
280 3300025302 Ga0207426_1009701 Ga0207426_10097013 502
281 3300026067 Ga0207678_10004089 Ga0207678_100040893 502
282 3300045051 Ga0451576_0046365 Ga0451576_0046365_2091_3776 502
283 3300046524 Ga0495648_0059900 Ga0495648_0059900_296_1945 502
284 3300046692 Ga0495671_0059594 Ga0495671_0059594_64_1713 502
285 3300048903 Ga0496100_0083482 Ga0496100_0083482_29_1678 502
286 3300048920 Ga0496117_0022619 Ga0496117_0022619_635_2284 502
287 3300048925 Ga0496122_0012818 Ga0496122_0012818_5439_7052 502
288 3300048926 Ga0496123_0043054 Ga0496123_0043054_656_2269 502
289 3300050510 nmdc:mga06r32_3780_c2 nmdc:mga06r32_3780_c2_1974_3629 502
290 3300053111 Ga0500572_001921 Ga0500572_001921_260_1909 502
291 3300053177 Ga0500636_0000014 Ga0500636_0000014_62100_63749 502
292 3300003659 JGI25404J52841_10005355 JGI25404J52841_100053553 503
293 3300005439 Ga0070711_100105092 Ga0070711_1001050921 503
294 3300005983 Ga0081540_1003623 Ga0081540_10036236 503
295 3300006051 Ga0075364_10001020 Ga0075364_100010204 503
296 3300006175 Ga0070712_100128175 Ga0070712_1001281751 503
297 3300006852 Ga0075433_10061478 Ga0075433_100614782 503
298 3300006871 Ga0075434_100036693 Ga0075434_1000366933 503
299 3300010375 Ga0105239_10095909 Ga0105239_100959091 503
300 3300011119 Ga0105246_10084631 Ga0105246_100846312 503
301 3300013306 Ga0163162_10252720 Ga0163162_102527202 503
302 3300013308 Ga0157375_10104430 Ga0157375_101044302 503
303 3300026067 Ga0207678_10001795 Ga0207678_1000179519 503
304 3300028379 Ga0268266_10062821 Ga0268266_100628212 503
305 3300033180 Ga0307510_10077521 Ga0307510_100775212 503
306 3300035112 Ga0373932_0010433 Ga0373932_0010433_501_2153 503
307 3300035691 Ga0373931_0019492 Ga0373931_0019492_1219_2871 503
308 3300035695 Ga0373927_0009095 Ga0373927_0009095_3620_5272 503
309 3300037068 Ga0373925_0041743 Ga0373925_0041743_1725_3377 503
310 3300045051 Ga0451576_0001024 Ga0451576_0001024_18122_19771 503
311 3300046689 Ga0495613_0100613 Ga0495613_0100613_92_1744 503
312 3300048904 Ga0496101_0049417 Ga0496101_0049417_804_2456 503
313 3300048907 Ga0496104_0158268 Ga0496104_0158268_128_1780 503
314 3300048909 Ga0496106_0065772 Ga0496106_0065772_762_2414 503
315 3300048919 Ga0496116_0057548 Ga0496116_0057548_547_2196 503
316 3300048924 Ga0496121_0001662 Ga0496121_0001662_27026_28678 503
317 3300048929 Ga0496126_0008969 Ga0496126_0008969_4651_6297 503
318 3300049570 Ga0501033_0033848 Ga0501033_0033848_1458_3074 503
319 3300049581 Ga0501047_0014603 Ga0501047_0014603_3810_5426 503
320 3300049822 Ga0501035_0039057 Ga0501035_0039057_2613_4229 503
321 3300049823 Ga0501044_0033866 Ga0501044_0033866_3174_4790 503
322 3300050490 nmdc:mga03n38_459_c1 nmdc:mga03n38_459_c1_6834_8489 503
323 3300050491 nmdc:mga00v17_13885_c1 nmdc:mga00v17_13885_c1_598_2253 503
324 3300050494 nmdc:mga06z11_377_c1 nmdc:mga06z11_377_c1_13394_15049 503
325 3300050512 nmdc:mga0n895_261372_c1 nmdc:mga0n895_261372_c1_30_1682 503
326 3300050513 nmdc:mga0rr50_31465_c1 nmdc:mga0rr50_31465_c1_1026_2678 503
327 3300050515 nmdc:mga0a205_91250_c1 nmdc:mga0a205_91250_c1_1220_2872 503
328 3300002987 JGI25159J45721_1000354 JGI25159J45721_100035422 504
329 3300003354 JGI25160J50197_1000026 JGI25160J50197_100002690 504
330 3300003374 JGI25161J50226_1000014 JGI25161J50226_1000014100 504
331 3300004625 Ga0055543_1000052 Ga0055543_100005217 504
332 3300005262 Ga0065165_1000073 Ga0065165_100007377 504
333 3300005564 Ga0070664_100020054 Ga0070664_1000200543 504
334 3300005615 Ga0070702_100044169 Ga0070702_1000441692 504
335 3300005616 Ga0068852_100095519 Ga0068852_1000955192 504
336 3300005618 Ga0068864_100069316 Ga0068864_1000693162 504
337 3300005719 Ga0068861_100123534 Ga0068861_1001235342 504
338 3300005981 Ga0081538_10011784 Ga0081538_100117845 504
339 3300006038 Ga0075365_10015811 Ga0075365_100158114 504
340 3300006038 Ga0075365_10022900 Ga0075365_100229003 504
341 3300006038 Ga0075365_10101566 Ga0075365_101015662 504
342 3300006042 Ga0075368_10023247 Ga0075368_100232472 504
343 3300006048 Ga0075363_100062552 Ga0075363_1000625522 504
344 3300006051 Ga0075364_10064521 Ga0075364_100645212 504
345 3300006051 Ga0075364_10114816 Ga0075364_101148161 504
346 3300006178 Ga0075367_10014652 Ga0075367_100146522 504
347 3300006178 Ga0075367_10067675 Ga0075367_100676752 504
348 3300006942 Ga0099824_1016566 Ga0099824_10165665 504
349 3300009101 Ga0105247_10034168 Ga0105247_100341682 504
350 3300009148 Ga0105243_10028117 Ga0105243_100281172 504
351 3300009176 Ga0105242_10055287 Ga0105242_100552872 504
352 3300014325 Ga0163163_10219163 Ga0163163_102191632 504
353 3300017792 Ga0163161_10022824 Ga0163161_100228242 504
354 3300025284 Ga0209130_1000121 Ga0209130_1000121116 504
355 3300025284 Ga0209130_1001796 Ga0209130_10017968 504
356 3300025302 Ga0207426_1000075 Ga0207426_1000075116 504
357 3300025302 Ga0207426_1000102 Ga0207426_10001027 504
358 3300025933 Ga0207706_10019237 Ga0207706_100192373 504
359 3300025938 Ga0207704_10028728 Ga0207704_100287282 504
360 3300026075 Ga0207708_10008852 Ga0207708_100088522 504
361 3300026089 Ga0207648_10022541 Ga0207648_100225413 504
362 3300026118 Ga0207675_100008340 Ga0207675_1000083405 504
363 3300026121 Ga0207683_10045349 Ga0207683_100453492 504
364 3300027357 Ga0209589_1000030 Ga0209589_1000030145 504
365 3300027361 Ga0209489_100056 Ga0209489_100056145 504
366 3300027363 Ga0209700_100059 Ga0209700_100059145 504
367 3300027866 Ga0209813_10014587 Ga0209813_100145872 504
368 3300031548 Ga0307408_100014910 Ga0307408_1000149105 504
369 3300047472 Ga0495686_0031036 Ga0495686_0031036_328_1980 504
370 3300048906 Ga0496103_0031162 Ga0496103_0031162_664_2397 504
371 3300048907 Ga0496104_0030742 Ga0496104_0030742_3050_4705 504
372 3300048908 Ga0496105_0038063 Ga0496105_0038063_1298_2953 504
373 3300048909 Ga0496106_0008572 Ga0496106_0008572_3686_5341 504
374 3300049568 Ga0501031_0016011 Ga0501031_0016011_1042_2661 504
375 3300049569 Ga0501032_0000051 Ga0501032_0000051_50164_51783 504
376 3300049570 Ga0501033_0000114 Ga0501033_0000114_61527_63146 504
377 3300049571 Ga0501034_0000094 Ga0501034_0000094_27114_28733 504
378 3300049572 Ga0501036_0000129 Ga0501036_0000129_13683_15302 504
379 3300049573 Ga0501037_0000057 Ga0501037_0000057_83667_85286 504
380 3300049574 Ga0501038_0000031 Ga0501038_0000031_8293_9912 504
381 3300049575 Ga0501039_0000099 Ga0501039_0000099_50164_51783 504
382 3300049579 Ga0501043_0000040 Ga0501043_0000040_37583_39202 504
383 3300049822 Ga0501035_0000154 Ga0501035_0000154_49580_51199 504
384 3300049823 Ga0501044_0040101 Ga0501044_0040101_495_2114 504
385 iso_pu_bacteria 2824653114 2824659716 504

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

44

452

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7893 8 489
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.7874 21 490
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.7776 21 490
7d5q-assembly2.cif.gz_B structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.7727 19 490
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.7659 18 488
ID Description Score Start End Superfamily
af_P9WG91_255_421_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9213 247 413 1.20.1250.20
af_P9WG91_255_421_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9058 247 413 1.20.1250.20
af_P9WJW9_258_425_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8695 249 416 1.20.1250.20
af_A0A1D6L677_1_148_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8669 39 160 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8587 18 172 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7U7J4Z2-F1-model_v4 Membrane protein 0.9327 123 504 GO:0005886
GO:0022857
AF-A0A382NHF8-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8783 43 415 GO:0005886
GO:0022857
AF-A0A1M5CVX8-F1-model_v4 Drug resistance transporter, EmrB/QacA subfamily 0.8726 19 497 GO:0016020
GO:0022857
AF-A0A353DBH9-F1-model_v4 MFS transporter 0.8688 14 176 GO:0016020
GO:0022857
AF-A0A399ZCT5-F1-model_v4 MFS transporter 0.8682 259 490 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
73.11 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map