F430306

General Info

Members Datasets Scaffolds Average Seq Length
385 227 770 343

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0143343|Ga0495684_0143343_428_1609
Length 382
Sequence MKTVRLTQVGKPLENADLPAPEIGPTDVLIRVAAAGICHSDAHYRAGISKIDRLPLTLGHEVAGRVEEVGSDVTHLSAGERVCVHYLVHCGSCEFCTRGLEQFCVSGQMIGKHRDGGYAEFIKVPAANAFSLPDEIPFEVGAIMMCSSATALHALNKARVKAGESIAIFGFGGLGFSALQLARAFDCGDVYVVEINPAKLASAASMGAIAIDASSEDPAEKIKEATAGRGVDVALELIGSAKTMRQVVLCLGPLGRAALVGLTAESMSIHPYTELINKEAEIIGVSDHLAAELPALIEFARSGKLRFPPETLHAVDLDAAQINAAVDALQDSIDHVRTVIVPSSDKRQVTKLTLWWRLCQPQRNITGSRVIGCYCLSYAVFS

Samples

Sample ID Description Type Environment
1 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
143 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
167 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.42
Rhizosphere 95.58
Stem 0
Stem Tuber 0
Unclassified 14.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495684_0143343 3300047471 Bacteria 1791
2 CNXas_1000003 3300000545 Bacteria 49535
3 JGI25406J46586_10000146 3300003203 Bacteria 30853
4 JGI25405J52794_10001036 3300003911 Bacteria 4416
5 JGI25405J52794_10004043 3300003911 Bacteria 2599
6 Ga0065703_1019060 3300005272 Bacteria 4159
7 Ga0065704_10006727 3300005289 Unclassified 3464
8 Ga0065704_10012943 3300005289 Bacteria 2720
9 Ga0065704_10076785 3300005289 Bacteria 4979
10 Ga0065704_10151441 3300005289 Bacteria 1418
11 Ga0065712_10007449 3300005290 Bacteria 2714
12 Ga0065712_10072778 3300005290 Bacteria 4621
13 Ga0065715_10006498 3300005293 Bacteria 9969
14 Ga0065715_10007346 3300005293 Bacteria 5147
15 Ga0065715_10009787 3300005293 Bacteria 3407
16 Ga0065707_10086117 3300005295 Bacteria 5641
17 Ga0065707_10137199 3300005295 Bacteria 1823
18 Ga0070676_10001979 3300005328 Bacteria 10411
19 Ga0070676_10018739 3300005328 Bacteria 3840
20 Ga0070683_100097678 3300005329 Bacteria 2763
21 Ga0070690_100149459 3300005330 Unclassified 1592
22 Ga0070670_100041516 3300005331 Bacteria 3954
23 Ga0070670_100193206 3300005331 Bacteria 1768
24 Ga0070670_100200142 3300005331 Unclassified 1735
25 Ga0070670_100291810 3300005331 Bacteria 1425
26 Ga0068869_100140743 3300005334 Bacteria 1863
27 Ga0070666_10017955 3300005335 Bacteria 4540
28 Ga0068868_100008442 3300005338 Bacteria 7375
29 Ga0070660_100063772 3300005339 Bacteria 2864
30 Ga0070689_100027246 3300005340 Bacteria 4308
31 Ga0070689_100110109 3300005340 Bacteria 2189
32 Ga0070668_100005087 3300005347 Bacteria 9738
33 Ga0070668_100069006 3300005347 Bacteria 2749
34 Ga0070668_100303890 3300005347 Unclassified 1339
35 Ga0070669_100043756 3300005353 Bacteria 3262
36 Ga0070669_100043891 3300005353 Bacteria 3257
37 Ga0070675_100008707 3300005354 Bacteria 7882
38 Ga0070675_100021140 3300005354 Bacteria 5197
39 Ga0070675_100040777 3300005354 Bacteria 3792
40 Ga0070675_100052214 3300005354 Bacteria 3361
41 Ga0070675_100147141 3300005354 Unclassified 2018
42 Ga0070675_100295771 3300005354 Bacteria 1425
43 Ga0070671_100008340 3300005355 Bacteria 8299
44 Ga0070671_100057036 3300005355 Bacteria 3249
45 Ga0070671_100093537 3300005355 Bacteria 2519
46 Ga0070674_100012622 3300005356 Bacteria 5192
47 Ga0070674_100025174 3300005356 Bacteria 3871
48 Ga0070674_100082403 3300005356 Unclassified 2301
49 Ga0070673_100141161 3300005364 Bacteria 2032
50 Ga0070673_100316577 3300005364 Bacteria 1377
51 Ga0070673_100318417 3300005364 Unclassified 1373
52 Ga0070688_100123760 3300005365 Bacteria 1735
53 Ga0070659_100005281 3300005366 Bacteria 9270
54 Ga0070667_100042815 3300005367 Bacteria 3799
55 Ga0070667_100066748 3300005367 Bacteria 3057
56 Ga0070667_100316156 3300005367 Bacteria 1408
57 Ga0070709_10237462 3300005434 Bacteria 1307
58 Ga0070710_10036135 3300005437 Bacteria 2699
59 Ga0070711_100041648 3300005439 Bacteria 3103
60 Ga0070711_100049272 3300005439 Bacteria 2884
61 Ga0070705_100035951 3300005440 Bacteria 2780
62 Ga0070705_100173657 3300005440 Unclassified 1453
63 Ga0070708_100011939 3300005445 Bacteria 7077
64 Ga0070708_100083846 3300005445 Bacteria 2890
65 Ga0070708_100084942 3300005445 Unclassified 2872
66 Ga0070708_100161394 3300005445 Bacteria 2089
67 Ga0070663_100106696 3300005455 Bacteria 2099
68 Ga0070678_100076500 3300005456 Bacteria 2521
69 Ga0070678_100158448 3300005456 Bacteria 1831
70 Ga0070662_100020747 3300005457 Bacteria 4480
71 Ga0070685_10031548 3300005466 Bacteria 2962
72 Ga0070706_100003485 3300005467 Bacteria 15473
73 Ga0070706_100020107 3300005467 Bacteria 6153
74 Ga0070706_100082197 3300005467 Unclassified 2984
75 Ga0070706_100114500 3300005467 Bacteria 2511
76 Ga0070707_100004227 3300005468 Bacteria 13443
77 Ga0070698_100064037 3300005471 Bacteria 3706
78 Ga0070698_100085977 3300005471 Unclassified 3131
79 Ga0070699_100141642 3300005518 Bacteria 2124
80 Ga0070699_100244069 3300005518 Bacteria 1604
81 Ga0070684_100002361 3300005535 Bacteria 13918
82 Ga0070697_100009646 3300005536 Bacteria 7541
83 Ga0070697_100048024 3300005536 Bacteria 3461
84 Ga0070697_100068407 3300005536 Bacteria 2907
85 Ga0070697_100081501 3300005536 Bacteria 2667
86 Ga0070697_100172807 3300005536 Bacteria 1829
87 Ga0070672_100001352 3300005543 Bacteria 15131
88 Ga0070672_100185733 3300005543 Bacteria 1734
89 Ga0070672_100337193 3300005543 Bacteria 1283
90 Ga0070686_100118716 3300005544 Unclassified 1813
91 Ga0070696_100050089 3300005546 Bacteria 2903
92 Ga0070665_100033983 3300005548 Bacteria 5129
93 Ga0070665_100081553 3300005548 Bacteria 3240
94 Ga0070665_100179132 3300005548 Bacteria 2120
95 Ga0070665_100378691 3300005548 Bacteria 1422
96 Ga0068855_100506132 3300005563 Bacteria 1312
97 Ga0070664_100038788 3300005564 Bacteria 4011
98 Ga0068856_100112845 3300005614 Bacteria 2716
99 Ga0068856_100155660 3300005614 Bacteria 2295
100 Ga0068856_100234469 3300005614 Bacteria 1850
101 Ga0070702_100022879 3300005615 Unclassified 3313
102 Ga0068852_100119144 3300005616 Bacteria 2413
103 Ga0068859_100031534 3300005617 Bacteria 5323
104 Ga0068866_10123958 3300005718 Unclassified 1460
105 Ga0068861_100063617 3300005719 Bacteria 2836
106 Ga0068863_100288608 3300005841 Bacteria 1590
107 Ga0068858_100030360 3300005842 Bacteria 5018
108 Ga0068860_100084162 3300005843 Bacteria 3026
109 Ga0068862_100051423 3300005844 Bacteria 3524
110 Ga0081455_10000718 3300005937 Bacteria 42961
111 Ga0081455_10004802 3300005937 Bacteria 15015
112 Ga0081455_10009746 3300005937 Bacteria 9839
113 Ga0081455_10069065 3300005937 Bacteria 2939
114 Ga0081455_10080648 3300005937 Bacteria 2667
115 Ga0081540_1000389 3300005983 Bacteria 44066
116 Ga0081539_10001678 3300005985 Bacteria 35835
117 Ga0081539_10002655 3300005985 Bacteria 24393
118 Ga0081539_10019151 3300005985 Bacteria 4698
119 Ga0081539_10047415 3300005985 Bacteria 2454
120 Ga0081539_10057808 3300005985 Unclassified 2143
121 Ga0070717_10027740 3300006028 Bacteria 4527
122 Ga0070715_10027944 3300006163 Bacteria 2257
123 Ga0070712_100060336 3300006175 Unclassified 2675
124 Ga0070712_100090140 3300006175 Bacteria 2244
125 Ga0070712_100163851 3300006175 Unclassified 1719
126 Ga0097621_100025808 3300006237 Unclassified 4601
127 Ga0097621_100026776 3300006237 Bacteria 4528
128 Ga0097621_100068294 3300006237 Bacteria 2931
129 Ga0097621_100087274 3300006237 Bacteria 2605
130 Ga0075428_100004947 3300006844 Bacteria 14798
131 Ga0075433_10017438 3300006852 Bacteria 5946
132 Ga0075433_10241043 3300006852 Unclassified 1605
133 Ga0075434_100001733 3300006871 Bacteria 18716
134 Ga0075434_100243789 3300006871 Unclassified 1817
135 Ga0075429_100090314 3300006880 Bacteria 2671
136 Ga0097620_100031534 3300006931 Bacteria 5323
137 Ga0075435_100151133 3300007076 Bacteria 1952
138 Ga0105240_10001485 3300009093 Bacteria 39911
139 Ga0111539_10005501 3300009094 Bacteria 16392
140 Ga0111539_10662209 3300009094 Unclassified 1216
141 Ga0105245_10083487 3300009098 Bacteria 2925
142 Ga0105245_10099452 3300009098 Bacteria 2689
143 Ga0114129_10007909 3300009147 Bacteria 15135
144 Ga0114129_10016589 3300009147 Bacteria 10493
145 Ga0114129_10160807 3300009147 Bacteria 3068
146 Ga0105242_10079460 3300009176 Bacteria 2739
147 Ga0105248_10166078 3300009177 Bacteria 2488
148 Ga0105249_10033264 3300009553 Bacteria 4667
149 Ga0105249_10298861 3300009553 Bacteria 1614
150 Ga0105030_100114 3300009987 Bacteria 6212
151 Ga0099796_10004521 3300010159 Bacteria 3377
152 Ga0105239_10038746 3300010375 Bacteria 5222
153 Ga0105239_10047725 3300010375 Bacteria 4693
154 Ga0157369_10243167 3300013105 Bacteria 1879
155 Ga0157374_10049295 3300013296 Bacteria 3911
156 Ga0157374_10054499 3300013296 Bacteria 3730
157 Ga0157374_10160783 3300013296 Bacteria 2187
158 Ga0157374_10313347 3300013296 Bacteria 1554
159 Ga0157378_10063613 3300013297 Unclassified 3297
160 Ga0157378_10167870 3300013297 Bacteria 2057
161 Ga0157378_10174707 3300013297 Bacteria 2017
162 Ga0157378_10179855 3300013297 Bacteria 1989
163 Ga0157378_10200092 3300013297 Bacteria 1889
164 Ga0157378_10320440 3300013297 Bacteria 1506
165 Ga0163162_10017872 3300013306 Bacteria 6938
166 Ga0163162_10112447 3300013306 Bacteria 2822
167 Ga0163162_10134227 3300013306 Unclassified 2586
168 Ga0163162_10178030 3300013306 Bacteria 2252
169 Ga0157372_10067701 3300013307 Unclassified 4013
170 Ga0157375_10129092 3300013308 Bacteria 2646
171 Ga0157375_10311713 3300013308 Bacteria 1738
172 Ga0157380_10004686 3300014326 Bacteria 9524
173 Ga0157380_10022974 3300014326 Bacteria 4703
174 Ga0157379_10005223 3300014968 Bacteria 11149
175 Ga0157376_10033001 3300014969 Bacteria 4164
176 Ga0157376_10300202 3300014969 Unclassified 1520
177 Ga0157376_10302519 3300014969 Unclassified 1514
178 Ga0163161_10012067 3300017792 Bacteria 5992
179 Ga0207666_1000685 3300025271 Bacteria 4072
180 Ga0207697_10000515 3300025315 Bacteria 21787
181 Ga0207697_10001072 3300025315 Bacteria 15097
182 Ga0207697_10004972 3300025315 Bacteria 6265
183 Ga0207697_10005235 3300025315 Bacteria 6050
184 Ga0207697_10015341 3300025315 Bacteria 3167
185 Ga0207642_10021357 3300025899 Unclassified 2547
186 Ga0207680_10234039 3300025903 Bacteria 1263
187 Ga0207647_10008375 3300025904 Bacteria 7418
188 Ga0207699_10019038 3300025906 Bacteria 3651
189 Ga0207645_10001528 3300025907 Bacteria 18900
190 Ga0207684_10000379 3300025910 Bacteria 60091
191 Ga0207684_10005648 3300025910 Bacteria 11489
192 Ga0207684_10050517 3300025910 Bacteria 3528
193 Ga0207684_10066552 3300025910 Plasmid 3060
194 Ga0207684_10100815 3300025910 Unclassified 2468
195 Ga0207695_10093241 3300025913 Bacteria 3021
196 Ga0207693_10012989 3300025915 Bacteria 6719
197 Ga0207693_10054982 3300025915 Bacteria 3123
198 Ga0207693_10228379 3300025915 Unclassified 1462
199 Ga0207663_10013420 3300025916 Bacteria 4453
200 Ga0207662_10019296 3300025918 Bacteria 3877
201 Ga0207657_10032083 3300025919 Bacteria 4750
202 Ga0207657_10099319 3300025919 Bacteria 2418
203 Ga0207657_10118517 3300025919 Bacteria 2179
204 Ga0207646_10030043 3300025922 Bacteria 4931
205 Ga0207646_10358679 3300025922 Unclassified 1317
206 Ga0207681_10076501 3300025923 Bacteria 2350
207 Ga0207650_10176082 3300025925 Unclassified 1702
208 Ga0207659_10002522 3300025926 Bacteria 10902
209 Ga0207659_10058628 3300025926 Unclassified 2764
210 Ga0207659_10077240 3300025926 Bacteria 2450
211 Ga0207659_10078455 3300025926 Unclassified 2433
212 Ga0207659_10217823 3300025926 Bacteria 1533
213 Ga0207687_10180523 3300025927 Bacteria 1635
214 Ga0207700_10027807 3300025928 Bacteria 3966
215 Ga0207664_10134446 3300025929 Bacteria 2085
216 Ga0207664_10175689 3300025929 Unclassified 1836
217 Ga0207644_10026674 3300025931 Bacteria 3985
218 Ga0207706_10007923 3300025933 Bacteria 9803
219 Ga0207706_10018317 3300025933 Bacteria 6301
220 Ga0207706_10067832 3300025933 Bacteria 3139
221 Ga0207686_10163665 3300025934 Unclassified 1562
222 Ga0207670_10001210 3300025936 Bacteria 13617
223 Ga0207670_10014099 3300025936 Bacteria 4733
224 Ga0207670_10070068 3300025936 Unclassified 2421
225 Ga0207669_10049587 3300025937 Bacteria 2503
226 Ga0207704_10059245 3300025938 Bacteria 2363
227 Ga0207665_10007202 3300025939 Bacteria 7359
228 Ga0207691_10002819 3300025940 Bacteria 16947
229 Ga0207691_10005109 3300025940 Bacteria 12664
230 Ga0207691_10049037 3300025940 Bacteria 3870
231 Ga0207691_10059319 3300025940 Bacteria 3480
232 Ga0207661_10156484 3300025944 Bacteria 1974
233 Ga0207679_10032313 3300025945 Bacteria 3672
234 Ga0207667_10437510 3300025949 Unclassified 1330
235 Ga0207651_10057308 3300025960 Bacteria 2686
236 Ga0207651_10313727 3300025960 Bacteria 1308
237 Ga0207668_10057489 3300025972 Unclassified 2713
238 Ga0207668_10120914 3300025972 Bacteria 1983
239 Ga0207668_10203472 3300025972 Unclassified 1578
240 Ga0207640_10253334 3300025981 Bacteria 1368
241 Ga0207677_10013528 3300026023 Bacteria 4733
242 Ga0207703_10065393 3300026035 Bacteria 2988
243 Ga0207678_10004960 3300026067 Bacteria 11944
244 Ga0207708_10219212 3300026075 Bacteria 1524
245 Ga0207702_10200216 3300026078 Bacteria 1850
246 Ga0207641_10020136 3300026088 Bacteria 5477
247 Ga0207648_10199433 3300026089 Bacteria 1775
248 Ga0207648_10259781 3300026089 Bacteria 1549
249 Ga0207674_10039839 3300026116 Unclassified 4869
250 Ga0207675_100023077 3300026118 Bacteria 5786
251 Ga0207683_10025107 3300026121 Bacteria 5138
252 Ga0207683_10052572 3300026121 Bacteria 3570
253 Ga0209983_1015846 3300027665 Bacteria 1555
254 Ga0268266_10059482 3300028379 Bacteria 3292
255 Ga0268266_10062398 3300028379 Bacteria 3216
256 Ga0268266_10183268 3300028379 Bacteria 1908
257 Ga0268266_10201946 3300028379 Bacteria 1819
258 Ga0268265_10097206 3300028380 Bacteria 2369
259 Ga0268265_10119287 3300028380 Bacteria 2170
260 Ga0268264_10068825 3300028381 Unclassified 2993
261 Ga0265338_10022790 3300028800 Bacteria 6465
262 Ga0307408_100144799 3300031548 Bacteria 1869
263 Ga0316575_10027546 3300031665 Bacteria 2212
264 Ga0316579_10020562 3300031691 Bacteria 2931
265 Ga0316578_10065238 3300031728 Bacteria 2150
266 Ga0307405_10180128 3300031731 Bacteria 1516
267 Ga0316577_10160651 3300031733 Bacteria 1267
268 Ga0307406_10351969 3300031901 Bacteria 1151
269 Ga0307409_100370980 3300031995 Bacteria 1357
270 Ga0307416_100148119 3300032002 Bacteria 2147
271 Ga0373954_0036058 3300035118 Bacteria 2295
272 Ga0373946_0066138 3300035171 Unclassified 1549
273 Ga0316574_0018362 3300035398 Unclassified 4109
274 Ga0373931_0094469 3300035691 Unclassified 1672
275 Ga0373935_0049600 3300035692 Unclassified 2661
276 Ga0373935_0217604 3300035692 Bacteria 1326
277 Ga0373927_0012026 3300035695 Bacteria 5757
278 Ga0373927_0148846 3300035695 Unclassified 1533
279 Ga0373947_0017233 3300035725 Bacteria 4154
280 Ga0373937_0132541 3300036401 Bacteria 2328
281 Ga0373937_0148030 3300036401 Unclassified 2199
282 Ga0316582_0190163 3300036647 Bacteria 1398
283 Ga0316582_0232696 3300036647 Bacteria 1261
284 Ga0316584_0079924 3300036712 Bacteria 2450
285 Ga0373925_0001908 3300037068 Bacteria 17300
286 Ga0373925_0119831 3300037068 Unclassified 2042
287 Ga0373925_0192953 3300037068 Bacteria 1617
288 Ga0395899_0104339 3300037312 Bacteria 2043
289 Ga0395900_0002871 3300037418 Bacteria 18775
290 Ga0395898_0006707 3300037466 Bacteria 12277
291 Ga0395905_0078958 3300037471 Bacteria 3084
292 Ga0395905_0435026 3300037471 Unclassified 1209
293 Ga0395901_0004802 3300038443 Bacteria 13637
294 Ga0395901_0217841 3300038443 Bacteria 1996
295 Ga0439455_0003679 3300042012 Bacteria 2961
296 Ga0450908_004391 3300042184 Bacteria 2720
297 Ga0439434_0001205 3300042435 Bacteria 7438
298 Ga0439434_0071410 3300042435 Bacteria 1093
299 Ga0495592_0004928 3300046454 Bacteria 9828
300 Ga0495603_0144179 3300046455 Unclassified 1385
301 Ga0495641_0066173 3300046461 Unclassified 1626
302 Ga0495639_0112872 3300046475 Unclassified 1291
303 Ga0495618_0029418 3300046514 Bacteria 3428
304 Ga0495618_0196298 3300046514 Bacteria 1278
305 Ga0495630_0000077 3300046517 Bacteria 76692
306 Ga0495666_0001514 3300046526 Bacteria 11366
307 Ga0495640_0043596 3300046533 Unclassified 3123
308 Ga0495640_0094217 3300046533 Bacteria 1972
309 Ga0495586_0000044 3300046535 Bacteria 74379
310 Ga0495586_0013168 3300046535 Bacteria 4384
311 Ga0495645_0002185 3300046543 Bacteria 13294
312 Ga0495645_0017207 3300046543 Bacteria 5178
313 Ga0495667_0161820 3300046559 Bacteria 1440
314 Ga0495634_0001649 3300046642 Bacteria 19424
315 Ga0495634_0021095 3300046642 Bacteria 4612
316 Ga0495588_0046965 3300046674 Bacteria 2216
317 Ga0495599_0010996 3300046678 Bacteria 5553
318 Ga0495623_0010238 3300046679 Bacteria 6066
319 Ga0495658_0039224 3300046683 Unclassified 2627
320 Ga0495658_0108978 3300046683 Bacteria 1663
321 Ga0495658_0256228 3300046683 Bacteria 1101
322 Ga0495613_0029079 3300046689 Bacteria 4109
323 Ga0495613_0048338 3300046689 Bacteria 3141
324 Ga0495674_0007451 3300047319 Bacteria 10458
325 Ga0495676_0002487 3300047321 Bacteria 16401
326 Ga0495684_0189331 3300047471 Bacteria 1522
327 Ga0496100_0129865 3300048903 Bacteria 1773
328 Ga0496101_0035173 3300048904 Bacteria 3542
329 Ga0496102_0006075 3300048905 Bacteria 10295
330 Ga0496102_0013214 3300048905 Bacteria 7145
331 Ga0496102_0147663 3300048905 Bacteria 2208
332 Ga0496103_0005272 3300048906 Bacteria 7760
333 Ga0496104_0089909 3300048907 Bacteria 2934
334 Ga0496104_0223062 3300048907 Bacteria 1797
335 Ga0496106_0107983 3300048909 Bacteria 2164
336 Ga0496107_0041133 3300048910 Bacteria 3318
337 Ga0496110_0328184 3300048913 Bacteria 1394
338 Ga0496112_0006909 3300048915 Bacteria 10015
339 Ga0496112_0172098 3300048915 Bacteria 2131
340 Ga0496112_0236714 3300048915 Bacteria 1779
341 Ga0496112_0268662 3300048915 Unclassified 1654
342 Ga0496115_0001568 3300048918 Bacteria 16428
343 Ga0496115_0046450 3300048918 Bacteria 3471
344 Ga0501031_0021911 3300049568 Bacteria 4163
345 Ga0501032_0016362 3300049569 Bacteria 5218
346 Ga0501036_0005268 3300049572 Bacteria 10461
347 Ga0501038_0019965 3300049574 Bacteria 6032
348 Ga0501039_0001358 3300049575 Bacteria 17934
349 Ga0501040_0015768 3300049576 Bacteria 4996
350 Ga0501040_0264279 3300049576 Bacteria 1228
351 Ga0501041_0010974 3300049577 Bacteria 5349
352 Ga0501041_0127954 3300049577 Bacteria 1582
353 Ga0501048_0195986 3300049582 Bacteria 1432
354 Ga0501067_0067402 3300049583 Bacteria 1981
355 Ga0501071_0113790 3300049587 Bacteria 2001
356 Ga0501072_0101127 3300049588 Bacteria 2291
357 Ga0501072_0303877 3300049588 Bacteria 1268
358 Ga0501073_0000636 3300049589 Bacteria 24607
359 Ga0501075_0047386 3300049591 Bacteria 3230
360 Ga0501075_0163675 3300049591 Bacteria 1697
361 Ga0501076_0282034 3300049592 Bacteria 1361
362 Ga0501077_0190985 3300049593 Bacteria 1301
363 Ga0501079_0070215 3300049741 Bacteria 2704
364 Ga0501079_0169121 3300049741 Bacteria 1705
365 Ga0501080_0008556 3300049742 Bacteria 9280
366 Ga0501080_0056804 3300049742 Unclassified 3644
367 Ga0501081_0010357 3300049743 Bacteria 6086
368 Ga0501081_0080331 3300049743 Bacteria 2282
369 Ga0501081_0080890 3300049743 Bacteria 2275
370 Ga0501081_0263256 3300049743 Bacteria 1260
371 Ga0501035_0035141 3300049822 Bacteria 4549
372 Ga0501044_0086530 3300049823 Bacteria 3166
373 Ga0501045_0042401 3300049824 Bacteria 3312
374 nmdc:mga05p37_194855_c1 3300050507 Bacteria 2457
375 nmdc:mga08y16_21899_c1 3300050511 Bacteria 6747
376 nmdc:mga0n895_130149_c1 3300050512 Bacteria 2541
377 nmdc:mga0rr50_71265_c1 3300050513 Bacteria 2651
378 nmdc:mga0a205_1060_c1 3300050515 Bacteria 22900
379 nmdc:mga0a205_238343_c1 3300050515 Unclassified 1700
380 Ga0495601_0028125 3300053077 Bacteria 3480
381 Ga0501084_0064644 3300054114 Bacteria 3061
382 Ga0501082_0015438 3300060353 Bacteria 6573
383 Ga0530510_0050900 3300061734 Bacteria 2992
384 Ga0530510_0085474 3300061734 Bacteria 2298
385 Ga0530510_0136106 3300061734 Bacteria 1809
386 Ga0495684_0143343
387 CNXas_1000003
388 JGI25406J46586_10000146
389 JGI25405J52794_10001036
390 JGI25405J52794_10004043
391 Ga0065703_1019060
392 Ga0065704_10006727
393 Ga0065704_10012943
394 Ga0065704_10076785
395 Ga0065704_10151441
396 Ga0065712_10007449
397 Ga0065712_10072778
398 Ga0065715_10006498
399 Ga0065715_10007346
400 Ga0065715_10009787
401 Ga0065707_10086117
402 Ga0065707_10137199
403 Ga0070676_10001979
404 Ga0070676_10018739
405 Ga0070683_100097678
406 Ga0070690_100149459
407 Ga0070670_100041516
408 Ga0070670_100193206
409 Ga0070670_100200142
410 Ga0070670_100291810
411 Ga0068869_100140743
412 Ga0070666_10017955
413 Ga0068868_100008442
414 Ga0070660_100063772
415 Ga0070689_100027246
416 Ga0070689_100110109
417 Ga0070668_100005087
418 Ga0070668_100069006
419 Ga0070668_100303890
420 Ga0070669_100043756
421 Ga0070669_100043891
422 Ga0070675_100008707
423 Ga0070675_100021140
424 Ga0070675_100040777
425 Ga0070675_100052214
426 Ga0070675_100147141
427 Ga0070675_100295771
428 Ga0070671_100008340
429 Ga0070671_100057036
430 Ga0070671_100093537
431 Ga0070674_100012622
432 Ga0070674_100025174
433 Ga0070674_100082403
434 Ga0070673_100141161
435 Ga0070673_100316577
436 Ga0070673_100318417
437 Ga0070688_100123760
438 Ga0070659_100005281
439 Ga0070667_100042815
440 Ga0070667_100066748
441 Ga0070667_100316156
442 Ga0070709_10237462
443 Ga0070710_10036135
444 Ga0070711_100041648
445 Ga0070711_100049272
446 Ga0070705_100035951
447 Ga0070705_100173657
448 Ga0070708_100011939
449 Ga0070708_100083846
450 Ga0070708_100084942
451 Ga0070708_100161394
452 Ga0070663_100106696
453 Ga0070678_100076500
454 Ga0070678_100158448
455 Ga0070662_100020747
456 Ga0070685_10031548
457 Ga0070706_100003485
458 Ga0070706_100020107
459 Ga0070706_100082197
460 Ga0070706_100114500
461 Ga0070707_100004227
462 Ga0070698_100064037
463 Ga0070698_100085977
464 Ga0070699_100141642
465 Ga0070699_100244069
466 Ga0070684_100002361
467 Ga0070697_100009646
468 Ga0070697_100048024
469 Ga0070697_100068407
470 Ga0070697_100081501
471 Ga0070697_100172807
472 Ga0070672_100001352
473 Ga0070672_100185733
474 Ga0070672_100337193
475 Ga0070686_100118716
476 Ga0070696_100050089
477 Ga0070665_100033983
478 Ga0070665_100081553
479 Ga0070665_100179132
480 Ga0070665_100378691
481 Ga0068855_100506132
482 Ga0070664_100038788
483 Ga0068856_100112845
484 Ga0068856_100155660
485 Ga0068856_100234469
486 Ga0070702_100022879
487 Ga0068852_100119144
488 Ga0068859_100031534
489 Ga0068866_10123958
490 Ga0068861_100063617
491 Ga0068863_100288608
492 Ga0068858_100030360
493 Ga0068860_100084162
494 Ga0068862_100051423
495 Ga0081455_10000718
496 Ga0081455_10004802
497 Ga0081455_10009746
498 Ga0081455_10069065
499 Ga0081455_10080648
500 Ga0081540_1000389
501 Ga0081539_10001678
502 Ga0081539_10002655
503 Ga0081539_10019151
504 Ga0081539_10047415
505 Ga0081539_10057808
506 Ga0070717_10027740
507 Ga0070715_10027944
508 Ga0070712_100060336
509 Ga0070712_100090140
510 Ga0070712_100163851
511 Ga0097621_100025808
512 Ga0097621_100026776
513 Ga0097621_100068294
514 Ga0097621_100087274
515 Ga0075428_100004947
516 Ga0075433_10017438
517 Ga0075433_10241043
518 Ga0075434_100001733
519 Ga0075434_100243789
520 Ga0075429_100090314
521 Ga0097620_100031534
522 Ga0075435_100151133
523 Ga0105240_10001485
524 Ga0111539_10005501
525 Ga0111539_10662209
526 Ga0105245_10083487
527 Ga0105245_10099452
528 Ga0114129_10007909
529 Ga0114129_10016589
530 Ga0114129_10160807
531 Ga0105242_10079460
532 Ga0105248_10166078
533 Ga0105249_10033264
534 Ga0105249_10298861
535 Ga0105030_100114
536 Ga0099796_10004521
537 Ga0105239_10038746
538 Ga0105239_10047725
539 Ga0157369_10243167
540 Ga0157374_10049295
541 Ga0157374_10054499
542 Ga0157374_10160783
543 Ga0157374_10313347
544 Ga0157378_10063613
545 Ga0157378_10167870
546 Ga0157378_10174707
547 Ga0157378_10179855
548 Ga0157378_10200092
549 Ga0157378_10320440
550 Ga0163162_10017872
551 Ga0163162_10112447
552 Ga0163162_10134227
553 Ga0163162_10178030
554 Ga0157372_10067701
555 Ga0157375_10129092
556 Ga0157375_10311713
557 Ga0157380_10004686
558 Ga0157380_10022974
559 Ga0157379_10005223
560 Ga0157376_10033001
561 Ga0157376_10300202
562 Ga0157376_10302519
563 Ga0163161_10012067
564 Ga0207666_1000685
565 Ga0207697_10000515
566 Ga0207697_10001072
567 Ga0207697_10004972
568 Ga0207697_10005235
569 Ga0207697_10015341
570 Ga0207642_10021357
571 Ga0207680_10234039
572 Ga0207647_10008375
573 Ga0207699_10019038
574 Ga0207645_10001528
575 Ga0207684_10000379
576 Ga0207684_10005648
577 Ga0207684_10050517
578 Ga0207684_10066552
579 Ga0207684_10100815
580 Ga0207695_10093241
581 Ga0207693_10012989
582 Ga0207693_10054982
583 Ga0207693_10228379
584 Ga0207663_10013420
585 Ga0207662_10019296
586 Ga0207657_10032083
587 Ga0207657_10099319
588 Ga0207657_10118517
589 Ga0207646_10030043
590 Ga0207646_10358679
591 Ga0207681_10076501
592 Ga0207650_10176082
593 Ga0207659_10002522
594 Ga0207659_10058628
595 Ga0207659_10077240
596 Ga0207659_10078455
597 Ga0207659_10217823
598 Ga0207687_10180523
599 Ga0207700_10027807
600 Ga0207664_10134446
601 Ga0207664_10175689
602 Ga0207644_10026674
603 Ga0207706_10007923
604 Ga0207706_10018317
605 Ga0207706_10067832
606 Ga0207686_10163665
607 Ga0207670_10001210
608 Ga0207670_10014099
609 Ga0207670_10070068
610 Ga0207669_10049587
611 Ga0207704_10059245
612 Ga0207665_10007202
613 Ga0207691_10002819
614 Ga0207691_10005109
615 Ga0207691_10049037
616 Ga0207691_10059319
617 Ga0207661_10156484
618 Ga0207679_10032313
619 Ga0207667_10437510
620 Ga0207651_10057308
621 Ga0207651_10313727
622 Ga0207668_10057489
623 Ga0207668_10120914
624 Ga0207668_10203472
625 Ga0207640_10253334
626 Ga0207677_10013528
627 Ga0207703_10065393
628 Ga0207678_10004960
629 Ga0207708_10219212
630 Ga0207702_10200216
631 Ga0207641_10020136
632 Ga0207648_10199433
633 Ga0207648_10259781
634 Ga0207674_10039839
635 Ga0207675_100023077
636 Ga0207683_10025107
637 Ga0207683_10052572
638 Ga0209983_1015846
639 Ga0268266_10059482
640 Ga0268266_10062398
641 Ga0268266_10183268
642 Ga0268266_10201946
643 Ga0268265_10097206
644 Ga0268265_10119287
645 Ga0268264_10068825
646 Ga0265338_10022790
647 Ga0307408_100144799
648 Ga0316575_10027546
649 Ga0316579_10020562
650 Ga0316578_10065238
651 Ga0307405_10180128
652 Ga0316577_10160651
653 Ga0307406_10351969
654 Ga0307409_100370980
655 Ga0307416_100148119
656 Ga0373954_0036058
657 Ga0373946_0066138
658 Ga0316574_0018362
659 Ga0373931_0094469
660 Ga0373935_0049600
661 Ga0373935_0217604
662 Ga0373927_0012026
663 Ga0373927_0148846
664 Ga0373947_0017233
665 Ga0373937_0132541
666 Ga0373937_0148030
667 Ga0316582_0190163
668 Ga0316582_0232696
669 Ga0316584_0079924
670 Ga0373925_0001908
671 Ga0373925_0119831
672 Ga0373925_0192953
673 Ga0395899_0104339
674 Ga0395900_0002871
675 Ga0395898_0006707
676 Ga0395905_0078958
677 Ga0395905_0435026
678 Ga0395901_0004802
679 Ga0395901_0217841
680 Ga0439455_0003679
681 Ga0450908_004391
682 Ga0439434_0001205
683 Ga0439434_0071410
684 Ga0495592_0004928
685 Ga0495603_0144179
686 Ga0495641_0066173
687 Ga0495639_0112872
688 Ga0495618_0029418
689 Ga0495618_0196298
690 Ga0495630_0000077
691 Ga0495666_0001514
692 Ga0495640_0043596
693 Ga0495640_0094217
694 Ga0495586_0000044
695 Ga0495586_0013168
696 Ga0495645_0002185
697 Ga0495645_0017207
698 Ga0495667_0161820
699 Ga0495634_0001649
700 Ga0495634_0021095
701 Ga0495588_0046965
702 Ga0495599_0010996
703 Ga0495623_0010238
704 Ga0495658_0039224
705 Ga0495658_0108978
706 Ga0495658_0256228
707 Ga0495613_0029079
708 Ga0495613_0048338
709 Ga0495674_0007451
710 Ga0495676_0002487
711 Ga0495684_0189331
712 Ga0496100_0129865
713 Ga0496101_0035173
714 Ga0496102_0006075
715 Ga0496102_0013214
716 Ga0496102_0147663
717 Ga0496103_0005272
718 Ga0496104_0089909
719 Ga0496104_0223062
720 Ga0496106_0107983
721 Ga0496107_0041133
722 Ga0496110_0328184
723 Ga0496112_0006909
724 Ga0496112_0172098
725 Ga0496112_0236714
726 Ga0496112_0268662
727 Ga0496115_0001568
728 Ga0496115_0046450
729 Ga0501031_0021911
730 Ga0501032_0016362
731 Ga0501036_0005268
732 Ga0501038_0019965
733 Ga0501039_0001358
734 Ga0501040_0015768
735 Ga0501040_0264279
736 Ga0501041_0010974
737 Ga0501041_0127954
738 Ga0501048_0195986
739 Ga0501067_0067402
740 Ga0501071_0113790
741 Ga0501072_0101127
742 Ga0501072_0303877
743 Ga0501073_0000636
744 Ga0501075_0047386
745 Ga0501075_0163675
746 Ga0501076_0282034
747 Ga0501077_0190985
748 Ga0501079_0070215
749 Ga0501079_0169121
750 Ga0501080_0008556
751 Ga0501080_0056804
752 Ga0501081_0010357
753 Ga0501081_0080331
754 Ga0501081_0080890
755 Ga0501081_0263256
756 Ga0501035_0035141
757 Ga0501044_0086530
758 Ga0501045_0042401
759 nmdc:mga05p37_194855_c1
760 nmdc:mga08y16_21899_c1
761 nmdc:mga0n895_130149_c1
762 nmdc:mga0rr50_71265_c1
763 nmdc:mga0a205_1060_c1
764 nmdc:mga0a205_238343_c1
765 Ga0495601_0028125
766 Ga0501084_0064644
767 Ga0501082_0015438
768 Ga0530510_0050900
769 Ga0530510_0085474
770 Ga0530510_0136106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

24

134

0.97

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

173

302

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2i-assembly2.cif.gz_H crystal structure of furx nadh+:furfuryl alcohol ii 0.9587 1 342
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.9548 1 342
3meq-assembly1.cif.gz_C crystal structure of alcohol dehydrogenase from brucella melitensis 0.9479 1 341
7d4n-assembly1.cif.gz_A crystal structure of tmm from strain htcc7211 soaked with dms for 20 min 0.9458 162 193
3s2i-assembly2.cif.gz_H crystal structure of furx nadh+:furfuryl alcohol ii 0.945 1 342
ID Description Score Start End Superfamily
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9617 158 282 3.40.50.720
af_P00332_5_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.953 2 146 3.90.180.10
1lluA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9518 146 286 3.40.50.720
af_Q17334_7_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9475 2 146 3.90.180.10
5tnxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9451 151 285 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C2X7L1-F1-model_v4 Alcohol dehydrogenase 0.9854 1 342 GO:0008270
GO:0016491
AF-A0A7C2X7L1-F1-model_v4 Alcohol dehydrogenase 0.9825 1 342 GO:0008270
GO:0016491
AF-A0A7C4C5T7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9652 1 342 GO:0008270
GO:0016491
AF-A0A7C4C5T7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9623 1 342 GO:0008270
GO:0016491
AF-A0A847H269-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9588 1 342 GO:0016491
GO:0046872

Map