F430273

General Info

Members Datasets Scaffolds Average Seq Length
385 232 770 162

Family's Representative Sequence

Representative Sequence 3300044719|Ga0466971_0256184|Ga0466971_0256184_61_603
Length 180
Sequence MGTGKLQITLNVNGLEYDVLVEGRRTLADVLRDDLGLTGTKLGCEHGVCGACTVLLDGRAVRSCLMFAVQAEGGEITTVEGLDSDGALNPVQQAFTENHGLQCGYCTPGMLLSVESFLRNHPDPSEEEIRVALSGNICRCTGYQNIVKSVAAAAAAQREAALPVGAPPRGLPASETPTGF

Samples

Sample ID Description Type Environment
1 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
67 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
146 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
149 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
150 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 5.71
Rhizosphere 91.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466971_0256184 3300044719 Bacteria 834
2 JGI24743J22301_10025432 3300001991 Bacteria 1147
3 JGI24735J21928_10057402 3300002067 Bacteria 1120
4 Ga0070658_10101374 3300005327 Bacteria 2380
5 Ga0070683_100062519 3300005329 Bacteria 3462
6 Ga0070683_100202309 3300005329 Bacteria 1886
7 Ga0070683_100833874 3300005329 Bacteria 884
8 Ga0070690_100249756 3300005330 Bacteria 1254
9 Ga0070680_100011665 3300005336 Bacteria 6810
10 Ga0070680_100029401 3300005336 Bacteria 4414
11 Ga0070680_100048461 3300005336 Bacteria 3462
12 Ga0070682_100001529 3300005337 Bacteria 12962
13 Ga0070682_100029350 3300005337 Bacteria 3311
14 Ga0068868_100998522 3300005338 Bacteria 765
15 Ga0070660_100014393 3300005339 Bacteria 5696
16 Ga0070660_100221200 3300005339 Bacteria 1539
17 Ga0070689_100660334 3300005340 Bacteria 910
18 Ga0070691_10030766 3300005341 Bacteria 2515
19 Ga0070661_100119730 3300005344 Bacteria 1971
20 Ga0070692_10156453 3300005345 Bacteria 1302
21 Ga0070692_10248516 3300005345 Bacteria 1064
22 Ga0070659_100053432 3300005366 Bacteria 3179
23 Ga0070659_100795518 3300005366 Bacteria 822
24 Ga0070703_10292303 3300005406 Bacteria 676
25 Ga0070709_10842579 3300005434 Bacteria 722
26 Ga0070714_101321017 3300005435 Bacteria 704
27 Ga0070711_100407095 3300005439 Bacteria 1105
28 Ga0070708_100231359 3300005445 Bacteria 1734
29 Ga0070662_100064525 3300005457 Bacteria 2682
30 Ga0070681_10000439 3300005458 Bacteria 33866
31 Ga0070681_10040973 3300005458 Bacteria 4640
32 Ga0070681_10163237 3300005458 Bacteria 2151
33 Ga0070685_10287332 3300005466 Bacteria 1103
34 Ga0070706_101168109 3300005467 Bacteria 708
35 Ga0070699_100000019 3300005518 Bacteria 185937
36 Ga0070699_100005832 3300005518 Bacteria 10767
37 Ga0070699_100048865 3300005518 Bacteria 3661
38 Ga0070699_100075490 3300005518 Bacteria 2933
39 Ga0070679_100006989 3300005530 Bacteria 10535
40 Ga0070679_100015030 3300005530 Bacteria 7439
41 Ga0070679_100026001 3300005530 Bacteria 5745
42 Ga0070679_100944412 3300005530 Bacteria 806
43 Ga0070684_100005081 3300005535 Bacteria 10049
44 Ga0070684_100077997 3300005535 Bacteria 2926
45 Ga0070697_100049663 3300005536 Bacteria 3405
46 Ga0068853_100487853 3300005539 Bacteria 1162
47 Ga0070686_100251438 3300005544 Bacteria 1291
48 Ga0070695_100151921 3300005545 Bacteria 1617
49 Ga0070696_100000287 3300005546 Bacteria 30454
50 Ga0070693_100084572 3300005547 Bacteria 1899
51 Ga0070693_100175840 3300005547 Bacteria 1374
52 Ga0070704_100443552 3300005549 Bacteria 1116
53 Ga0070704_100870567 3300005549 Bacteria 809
54 Ga0068855_100124096 3300005563 Bacteria 2954
55 Ga0068855_100181517 3300005563 Bacteria 2379
56 Ga0068855_101122082 3300005563 Bacteria 821
57 Ga0068855_101629715 3300005563 Bacteria 660
58 Ga0070664_100020498 3300005564 Bacteria 5444
59 Ga0070664_101259184 3300005564 Bacteria 698
60 Ga0068857_100004467 3300005577 Bacteria 11822
61 Ga0068854_100008014 3300005578 Bacteria 6768
62 Ga0068854_100099667 3300005578 Bacteria 2176
63 Ga0068856_100006918 3300005614 Bacteria 11095
64 Ga0068856_100019001 3300005614 Bacteria 6668
65 Ga0068859_100084791 3300005617 Bacteria 3213
66 Ga0068851_10026649 3300005834 Bacteria 2843
67 Ga0068851_10098485 3300005834 Bacteria 1548
68 Ga0068858_100600841 3300005842 Bacteria 1067
69 Ga0081455_10001553 3300005937 Bacteria 28234
70 Ga0081538_10010011 3300005981 Bacteria 7819
71 Ga0081538_10011403 3300005981 Bacteria 7202
72 Ga0081540_1000081 3300005983 Bacteria 102423
73 Ga0081540_1098024 3300005983 Bacteria 1270
74 Ga0070717_10054187 3300006028 Bacteria 3307
75 Ga0070717_10299116 3300006028 Bacteria 1430
76 Ga0070712_100112921 3300006175 Bacteria 2031
77 Ga0070712_100170623 3300006175 Bacteria 1688
78 Ga0070712_100922382 3300006175 Bacteria 754
79 Ga0075431_100194971 3300006847 Bacteria 2074
80 Ga0075434_100001961 3300006871 Bacteria 17843
81 Ga0075434_101029731 3300006871 Bacteria 837
82 Ga0075436_100000407 3300006914 Bacteria 27718
83 Ga0075436_100021554 3300006914 Bacteria 4423
84 Ga0075436_100108059 3300006914 Bacteria 1940
85 Ga0075436_100498406 3300006914 Bacteria 891
86 Ga0097620_100084791 3300006931 Bacteria 3213
87 Ga0075435_100003656 3300007076 Bacteria 10471
88 Ga0075435_100057548 3300007076 Bacteria 3145
89 Ga0105251_10024628 3300009011 Bacteria 3088
90 Ga0105240_10067461 3300009093 Bacteria 4434
91 Ga0105240_10129215 3300009093 Bacteria 3032
92 Ga0111539_10009878 3300009094 Bacteria 12043
93 Ga0105245_10070525 3300009098 Bacteria 3171
94 Ga0105245_10578957 3300009098 Bacteria 1147
95 Ga0105247_10008491 3300009101 Bacteria 6254
96 Ga0105243_10455914 3300009148 Bacteria 1201
97 Ga0105241_10449732 3300009174 Bacteria 1139
98 Ga0105242_10224008 3300009176 Bacteria 1682
99 Ga0105248_10046267 3300009177 Bacteria 4876
100 Ga0105237_10361926 3300009545 Bacteria 1455
101 Ga0105237_10666384 3300009545 Bacteria 1047
102 Ga0105238_11881922 3300009551 Bacteria 631
103 Ga0105239_10003148 3300010375 Bacteria 20476
104 Ga0105239_10067584 3300010375 Bacteria 3926
105 Ga0105246_10154062 3300011119 Bacteria 1743
106 Ga0105246_10212974 3300011119 Bacteria 1509
107 Ga0157344_1009661 3300012476 Bacteria 682
108 Ga0157336_1018781 3300012477 Bacteria 608
109 Ga0157370_10057769 3300013104 Bacteria 3688
110 Ga0157370_10337578 3300013104 Bacteria 1389
111 Ga0157369_10015400 3300013105 Bacteria 8620
112 Ga0157369_10120829 3300013105 Bacteria 2780
113 Ga0163162_10407052 3300013306 Bacteria 1493
114 Ga0157372_10004418 3300013307 Bacteria 14995
115 Ga0157372_10196682 3300013307 Bacteria 2335
116 Ga0182008_10320481 3300014497 Bacteria 815
117 Ga0157377_10003777 3300014745 Bacteria 6874
118 Ga0157377_10127378 3300014745 Bacteria 1551
119 Ga0157379_10133659 3300014968 Bacteria 2234
120 Ga0157379_10184669 3300014968 Bacteria 1884
121 Ga0163161_10106476 3300017792 Bacteria 2092
122 Ga0224572_1014407 3300024225 Bacteria 1511
123 Ga0224572_1023866 3300024225 Bacteria 1175
124 Ga0207692_10665389 3300025898 Bacteria 674
125 Ga0207692_10676759 3300025898 Bacteria 668
126 Ga0207710_10237803 3300025900 Bacteria 908
127 Ga0207688_10037237 3300025901 Bacteria 2697
128 Ga0207699_10013764 3300025906 Bacteria 4150
129 Ga0207643_10386071 3300025908 Bacteria 883
130 Ga0207705_10131927 3300025909 Bacteria 1860
131 Ga0207684_10020572 3300025910 Bacteria 5638
132 Ga0207684_10810652 3300025910 Bacteria 791
133 Ga0207654_10265147 3300025911 Bacteria 1156
134 Ga0207707_10001155 3300025912 Bacteria 25051
135 Ga0207707_10012798 3300025912 Bacteria 7297
136 Ga0207695_10036697 3300025913 Bacteria 5295
137 Ga0207695_10212946 3300025913 Bacteria 1842
138 Ga0207671_10406995 3300025914 Bacteria 1082
139 Ga0207693_10072242 3300025915 Bacteria 2702
140 Ga0207660_10007277 3300025917 Bacteria 7162
141 Ga0207660_10032629 3300025917 Bacteria 3595
142 Ga0207657_10027260 3300025919 Bacteria 5233
143 Ga0207657_10699789 3300025919 Bacteria 787
144 Ga0207652_10002381 3300025921 Bacteria 15884
145 Ga0207652_10009274 3300025921 Bacteria 7912
146 Ga0207652_10057103 3300025921 Bacteria 3361
147 Ga0207652_10680670 3300025921 Bacteria 919
148 Ga0207646_10294503 3300025922 Bacteria 1466
149 Ga0207659_10025687 3300025926 Bacteria 3962
150 Ga0207687_10161668 3300025927 Bacteria 1719
151 Ga0207687_10282714 3300025927 Bacteria 1330
152 Ga0207700_10858315 3300025928 Bacteria 812
153 Ga0207664_10003487 3300025929 Bacteria 10494
154 Ga0207690_10061038 3300025932 Bacteria 2561
155 Ga0207690_10252908 3300025932 Bacteria 1362
156 Ga0207706_10004798 3300025933 Bacteria 12661
157 Ga0207709_10297698 3300025935 Bacteria 1198
158 Ga0207670_10740585 3300025936 Bacteria 816
159 Ga0207669_10035447 3300025937 Bacteria 2839
160 Ga0207665_10016565 3300025939 Bacteria 4843
161 Ga0207711_10066748 3300025941 Bacteria 3111
162 Ga0207661_10000471 3300025944 Bacteria 26005
163 Ga0207661_10325724 3300025944 Bacteria 1382
164 Ga0207679_10010943 3300025945 Bacteria 5853
165 Ga0207679_11540539 3300025945 Bacteria 609
166 Ga0207667_10237536 3300025949 Bacteria 1865
167 Ga0207651_10201684 3300025960 Bacteria 1595
168 Ga0207703_10014788 3300026035 Bacteria 6089
169 Ga0207703_10572126 3300026035 Bacteria 1067
170 Ga0207639_10032239 3300026041 Bacteria 3856
171 Ga0207702_10003501 3300026078 Bacteria 14310
172 Ga0207702_10090160 3300026078 Bacteria 2682
173 Ga0207648_10615920 3300026089 Bacteria 1001
174 Ga0207683_10069177 3300026121 Bacteria 3118
175 Ga0207698_10053459 3300026142 Bacteria 3101
176 Ga0207428_10048272 3300027907 Bacteria 3416
177 Ga0307515_10088041 3300028794 Bacteria 3931
178 Ga0307511_10114236 3300030521 Bacteria 1703
179 Ga0307513_10276298 3300031456 Bacteria 1460
180 Ga0307408_100245849 3300031548 Bacteria 1473
181 Ga0316575_10003775 3300031665 Bacteria 5268
182 Ga0307405_10004877 3300031731 Bacteria 6403
183 Ga0307413_10283084 3300031824 Bacteria 1248
184 Ga0307410_10057924 3300031852 Bacteria 2640
185 Ga0307409_100027417 3300031995 Bacteria 4036
186 Ga0307416_100005910 3300032002 Bacteria 7598
187 Ga0307416_100910986 3300032002 Bacteria 980
188 Ga0307415_100000146 3300032126 Bacteria 31400
189 Ga0373934_0021770 3300035086 Bacteria 2471
190 Ga0373944_0236684 3300035089 Bacteria 671
191 Ga0373923_0108525 3300035111 Bacteria 1230
192 Ga0373932_0054276 3300035112 Bacteria 1199
193 Ga0373936_0054546 3300035113 Bacteria 1621
194 Ga0373954_0027743 3300035118 Bacteria 2601
195 Ga0373954_0129735 3300035118 Bacteria 1227
196 Ga0373957_0197703 3300035120 Bacteria 837
197 Ga0373955_0092615 3300035172 Bacteria 1724
198 Ga0373961_0136209 3300035241 Bacteria 826
199 Ga0373962_0086906 3300035242 Bacteria 958
200 Ga0316574_0018259 3300035398 Bacteria 4119
201 Ga0373927_0279585 3300035695 Bacteria 1098
202 Ga0373933_0019012 3300035724 Bacteria 3872
203 Ga0373937_0041688 3300036401 Bacteria 4187
204 Ga0316582_0069414 3300036647 Bacteria 2278
205 Ga0395900_0160675 3300037418 Bacteria 2292
206 Ga0395898_0282867 3300037466 Bacteria 1582
207 Ga0436365_1102411 3300039437 Bacteria 666
208 Ga0436362_0505286 3300039453 Bacteria 1219
209 Ga0439441_002040 3300042001 Bacteria 2780
210 Ga0439463_001883 3300042016 Bacteria 5442
211 Ga0439435_0073158 3300042436 Bacteria 1018
212 Ga0439444_0000076 3300042437 Bacteria 7420
213 Ga0439459_0059119 3300042438 Bacteria 862
214 Ga0439464_0002696 3300042439 Bacteria 4406
215 Ga0439464_0280203 3300042439 Bacteria 542
216 Ga0439460_0001052 3300042461 Bacteria 6414
217 Ga0439460_0255189 3300042461 Bacteria 607
218 Ga0439440_0000045 3300042993 Bacteria 15840
219 Ga0466963_0025779 3300044694 Bacteria 3753
220 Ga0466963_0145725 3300044694 Bacteria 1643
221 Ga0466957_0657786 3300044842 Bacteria 737
222 Ga0466967_0084919 3300045976 Bacteria 2865
223 Ga0466967_0152888 3300045976 Bacteria 2159
224 Ga0466967_1073875 3300045976 Bacteria 802
225 Ga0495592_0066245 3300046454 Bacteria 2643
226 Ga0495653_0010030 3300046463 Bacteria 7749
227 Ga0495653_0182779 3300046463 Bacteria 1437
228 Ga0495664_0843936 3300046477 Bacteria 537
229 Ga0495608_0276611 3300046511 Bacteria 1043
230 Ga0495628_0244926 3300046516 Bacteria 1340
231 Ga0495666_0361281 3300046526 Bacteria 654
232 Ga0495587_0120603 3300046536 Bacteria 1502
233 Ga0495587_0129935 3300046536 Bacteria 1440
234 Ga0495645_0231054 3300046543 Bacteria 1239
235 Ga0495667_0010216 3300046559 Bacteria 6353
236 Ga0495667_0038701 3300046559 Bacteria 3175
237 Ga0495635_0013919 3300046663 Bacteria 5628
238 Ga0495657_0063930 3300046675 Bacteria 2425
239 Ga0495657_0089726 3300046675 Bacteria 1974
240 Ga0495600_0120140 3300046809 Bacteria 1709
241 Ga0495680_0009759 3300047322 Bacteria 8612
242 Ga0495675_0252111 3300047444 Bacteria 1060
243 Ga0495684_0020946 3300047471 Bacteria 5037
244 Ga0495684_0063842 3300047471 Bacteria 2799
245 Ga0495602_0115418 3300048088 Bacteria 2172
246 Ga0495602_0926509 3300048088 Bacteria 578
247 Ga0496100_0102947 3300048903 Bacteria 1971
248 Ga0496101_0100960 3300048904 Bacteria 2160
249 Ga0496101_0247154 3300048904 Bacteria 1389
250 Ga0496102_0179227 3300048905 Bacteria 1996
251 Ga0496103_0028230 3300048906 Bacteria 3404
252 Ga0496104_0051111 3300048907 Bacteria 3900
253 Ga0496105_0008277 3300048908 Bacteria 8088
254 Ga0496105_0083874 3300048908 Bacteria 2632
255 Ga0496106_0452748 3300048909 Bacteria 1031
256 Ga0496108_0001520 3300048911 Bacteria 18346
257 Ga0496108_0212902 3300048911 Bacteria 1678
258 Ga0496109_0003014 3300048912 Bacteria 14054
259 Ga0496110_0005501 3300048913 Bacteria 9937
260 Ga0496110_0019092 3300048913 Bacteria 5763
261 Ga0496110_0511886 3300048913 Bacteria 1092
262 Ga0496111_0002553 3300048914 Bacteria 11000
263 Ga0496112_0117458 3300048915 Bacteria 2630
264 Ga0496113_0604060 3300048916 Bacteria 878
265 Ga0496114_0114800 3300048917 Bacteria 2310
266 Ga0496114_0276855 3300048917 Bacteria 1479
267 Ga0496114_0770062 3300048917 Bacteria 840
268 Ga0496115_0051849 3300048918 Bacteria 3290
269 Ga0496125_0184412 3300048928 Bacteria 1386
270 Ga0496126_0000037 3300048929 Bacteria 353425
271 Ga0501031_0004353 3300049568 Bacteria 9161
272 Ga0501031_0006512 3300049568 Bacteria 7612
273 Ga0501031_0365223 3300049568 Bacteria 934
274 Ga0501032_0102969 3300049569 Bacteria 1892
275 Ga0501033_0048847 3300049570 Bacteria 3142
276 Ga0501033_0084167 3300049570 Bacteria 2331
277 Ga0501033_0173774 3300049570 Bacteria 1547
278 Ga0501036_0000401 3300049572 Bacteria 30497
279 Ga0501036_0077071 3300049572 Bacteria 2820
280 Ga0501037_0023951 3300049573 Bacteria 4514
281 Ga0501037_0049562 3300049573 Bacteria 3075
282 Ga0501038_0002119 3300049574 Bacteria 18418
283 Ga0501038_0032394 3300049574 Bacteria 4612
284 Ga0501038_0049426 3300049574 Bacteria 3636
285 Ga0501039_0000206 3300049575 Bacteria 42987
286 Ga0501039_0014005 3300049575 Bacteria 6136
287 Ga0501039_0120919 3300049575 Bacteria 2052
288 Ga0501039_0838203 3300049575 Bacteria 717
289 Ga0501040_0000358 3300049576 Bacteria 26900
290 Ga0501040_0017641 3300049576 Bacteria 4738
291 Ga0501040_0029205 3300049576 Bacteria 3721
292 Ga0501040_0040891 3300049576 Bacteria 3156
293 Ga0501041_0000545 3300049577 Bacteria 19472
294 Ga0501041_0008055 3300049577 Bacteria 6201
295 Ga0501041_0011825 3300049577 Bacteria 5165
296 Ga0501042_0000500 3300049578 Bacteria 20399
297 Ga0501042_0005297 3300049578 Bacteria 8293
298 Ga0501042_0048426 3300049578 Bacteria 3030
299 Ga0501043_0125587 3300049579 Bacteria 2012
300 Ga0501043_0286419 3300049579 Bacteria 1262
301 Ga0501043_0586519 3300049579 Bacteria 825
302 Ga0501046_0004344 3300049580 Bacteria 12906
303 Ga0501046_0012956 3300049580 Bacteria 7085
304 Ga0501046_0041279 3300049580 Bacteria 3682
305 Ga0501048_0000029 3300049582 Bacteria 66343
306 Ga0501048_0013499 3300049582 Bacteria 6062
307 Ga0501048_0013887 3300049582 Bacteria 5972
308 Ga0501048_0702557 3300049582 Bacteria 726
309 Ga0501068_0010496 3300049584 Bacteria 5206
310 Ga0501068_0171326 3300049584 Bacteria 1370
311 Ga0501070_0118459 3300049586 Bacteria 2188
312 Ga0501071_0004882 3300049587 Bacteria 8547
313 Ga0501071_0005348 3300049587 Bacteria 8246
314 Ga0501071_0020971 3300049587 Bacteria 4548
315 Ga0501071_0093802 3300049587 Bacteria 2207
316 Ga0501072_0000545 3300049588 Bacteria 27090
317 Ga0501072_0002380 3300049588 Bacteria 14110
318 Ga0501072_0125921 3300049588 Bacteria 2041
319 Ga0501073_0969316 3300049589 Bacteria 585
320 Ga0501074_0000746 3300049590 Bacteria 20444
321 Ga0501074_0055133 3300049590 Bacteria 2865
322 Ga0501075_0000085 3300049591 Bacteria 42516
323 Ga0501075_0016558 3300049591 Bacteria 5313
324 Ga0501075_0072723 3300049591 Bacteria 2599
325 Ga0501076_0001660 3300049592 Bacteria 15036
326 Ga0501076_0006251 3300049592 Bacteria 8625
327 Ga0501076_0008690 3300049592 Bacteria 7459
328 Ga0501076_0042368 3300049592 Bacteria 3583
329 Ga0501076_0151349 3300049592 Bacteria 1887
330 Ga0501076_0548006 3300049592 Bacteria 954
331 Ga0501077_0002640 3300049593 Bacteria 10734
332 Ga0501077_0042013 3300049593 Bacteria 2909
333 Ga0501077_0574178 3300049593 Bacteria 724
334 Ga0501079_0000319 3300049741 Bacteria 30216
335 Ga0501079_0008044 3300049741 Bacteria 7990
336 Ga0501079_0018691 3300049741 Bacteria 5295
337 Ga0501080_0005743 3300049742 Bacteria 11097
338 Ga0501080_0007457 3300049742 Bacteria 9874
339 Ga0501080_0019880 3300049742 Bacteria 6219
340 Ga0501080_0555399 3300049742 Bacteria 1022
341 Ga0501081_0001667 3300049743 Bacteria 13740
342 Ga0501081_0015646 3300049743 Bacteria 5006
343 Ga0501081_0099026 3300049743 Bacteria 2059
344 Ga0501083_0013525 3300049744 Bacteria 5705
345 Ga0501083_0098370 3300049744 Bacteria 1930
346 Ga0501083_0513045 3300049744 Bacteria 780
347 Ga0501083_0698612 3300049744 Bacteria 660
348 Ga0501035_0011388 3300049822 Bacteria 8243
349 Ga0501035_0184662 3300049822 Bacteria 1795
350 Ga0501044_1033034 3300049823 Bacteria 693
351 Ga0501045_0000231 3300049824 Bacteria 32325
352 Ga0501045_0005589 3300049824 Bacteria 8701
353 Ga0501045_0014827 3300049824 Bacteria 5528
354 Ga0501045_0065571 3300049824 Bacteria 2666
355 Ga0501045_0150092 3300049824 Bacteria 1734
356 nmdc:mga06z11_616814_c1 3300050494 Bacteria 660
357 nmdc:mga05p37_117466_c1 3300050507 Bacteria 3269
358 nmdc:mga06r32_232288_c1 3300050510 Bacteria 1832
359 nmdc:mga08y16_351217_c1 3300050511 Bacteria 1515
360 nmdc:mga0n895_13824_c1 3300050512 Bacteria 7304
361 nmdc:mga0n895_147124_c1 3300050512 Bacteria 2386
362 nmdc:mga0n895_1675234_c1 3300050512 Bacteria 599
363 nmdc:mga08x19_13074_c1 3300050514 Bacteria 4424
364 nmdc:mga08x19_213930_c1 3300050514 Bacteria 1323
365 nmdc:mga08x19_255511_c1 3300050514 Bacteria 1211
366 nmdc:mga08x19_465376_c1 3300050514 Bacteria 891
367 Ga0495612_0013235 3300053078 Bacteria 3323
368 Ga0495619_0063735 3300053085 Bacteria 2456
369 Ga0500593_021108 3300053117 Bacteria 2866
370 Ga0500616_0011069 3300053153 Bacteria 5360
371 Ga0500616_0040498 3300053153 Bacteria 2505
372 Ga0501084_0001054 3300054114 Bacteria 21409
373 Ga0501084_0003490 3300054114 Bacteria 12779
374 Ga0501084_0053433 3300054114 Bacteria 3379
375 Ga0501084_0071331 3300054114 Bacteria 2908
376 Ga0501084_0263708 3300054114 Bacteria 1454
377 Ga0590075_001081 3300059424 Bacteria 7052
378 Ga0590077_001472 3300059426 Bacteria 5498
379 Ga0501082_0001319 3300060353 Bacteria 21725
380 Ga0501082_0004767 3300060353 Bacteria 11832
381 Ga0501082_0023140 3300060353 Bacteria 5358
382 Ga0501082_0477907 3300060353 Bacteria 1089
383 Ga0530510_0000166 3300061734 Bacteria 39903
384 Ga0530510_0007839 3300061734 Bacteria 7447
385 Ga0530510_0132474 3300061734 Bacteria 1834
386 Ga0466971_0256184
387 JGI24743J22301_10025432
388 JGI24735J21928_10057402
389 Ga0070658_10101374
390 Ga0070683_100062519
391 Ga0070683_100202309
392 Ga0070683_100833874
393 Ga0070690_100249756
394 Ga0070680_100011665
395 Ga0070680_100029401
396 Ga0070680_100048461
397 Ga0070682_100001529
398 Ga0070682_100029350
399 Ga0068868_100998522
400 Ga0070660_100014393
401 Ga0070660_100221200
402 Ga0070689_100660334
403 Ga0070691_10030766
404 Ga0070661_100119730
405 Ga0070692_10156453
406 Ga0070692_10248516
407 Ga0070659_100053432
408 Ga0070659_100795518
409 Ga0070703_10292303
410 Ga0070709_10842579
411 Ga0070714_101321017
412 Ga0070711_100407095
413 Ga0070708_100231359
414 Ga0070662_100064525
415 Ga0070681_10000439
416 Ga0070681_10040973
417 Ga0070681_10163237
418 Ga0070685_10287332
419 Ga0070706_101168109
420 Ga0070699_100000019
421 Ga0070699_100005832
422 Ga0070699_100048865
423 Ga0070699_100075490
424 Ga0070679_100006989
425 Ga0070679_100015030
426 Ga0070679_100026001
427 Ga0070679_100944412
428 Ga0070684_100005081
429 Ga0070684_100077997
430 Ga0070697_100049663
431 Ga0068853_100487853
432 Ga0070686_100251438
433 Ga0070695_100151921
434 Ga0070696_100000287
435 Ga0070693_100084572
436 Ga0070693_100175840
437 Ga0070704_100443552
438 Ga0070704_100870567
439 Ga0068855_100124096
440 Ga0068855_100181517
441 Ga0068855_101122082
442 Ga0068855_101629715
443 Ga0070664_100020498
444 Ga0070664_101259184
445 Ga0068857_100004467
446 Ga0068854_100008014
447 Ga0068854_100099667
448 Ga0068856_100006918
449 Ga0068856_100019001
450 Ga0068859_100084791
451 Ga0068851_10026649
452 Ga0068851_10098485
453 Ga0068858_100600841
454 Ga0081455_10001553
455 Ga0081538_10010011
456 Ga0081538_10011403
457 Ga0081540_1000081
458 Ga0081540_1098024
459 Ga0070717_10054187
460 Ga0070717_10299116
461 Ga0070712_100112921
462 Ga0070712_100170623
463 Ga0070712_100922382
464 Ga0075431_100194971
465 Ga0075434_100001961
466 Ga0075434_101029731
467 Ga0075436_100000407
468 Ga0075436_100021554
469 Ga0075436_100108059
470 Ga0075436_100498406
471 Ga0097620_100084791
472 Ga0075435_100003656
473 Ga0075435_100057548
474 Ga0105251_10024628
475 Ga0105240_10067461
476 Ga0105240_10129215
477 Ga0111539_10009878
478 Ga0105245_10070525
479 Ga0105245_10578957
480 Ga0105247_10008491
481 Ga0105243_10455914
482 Ga0105241_10449732
483 Ga0105242_10224008
484 Ga0105248_10046267
485 Ga0105237_10361926
486 Ga0105237_10666384
487 Ga0105238_11881922
488 Ga0105239_10003148
489 Ga0105239_10067584
490 Ga0105246_10154062
491 Ga0105246_10212974
492 Ga0157344_1009661
493 Ga0157336_1018781
494 Ga0157370_10057769
495 Ga0157370_10337578
496 Ga0157369_10015400
497 Ga0157369_10120829
498 Ga0163162_10407052
499 Ga0157372_10004418
500 Ga0157372_10196682
501 Ga0182008_10320481
502 Ga0157377_10003777
503 Ga0157377_10127378
504 Ga0157379_10133659
505 Ga0157379_10184669
506 Ga0163161_10106476
507 Ga0224572_1014407
508 Ga0224572_1023866
509 Ga0207692_10665389
510 Ga0207692_10676759
511 Ga0207710_10237803
512 Ga0207688_10037237
513 Ga0207699_10013764
514 Ga0207643_10386071
515 Ga0207705_10131927
516 Ga0207684_10020572
517 Ga0207684_10810652
518 Ga0207654_10265147
519 Ga0207707_10001155
520 Ga0207707_10012798
521 Ga0207695_10036697
522 Ga0207695_10212946
523 Ga0207671_10406995
524 Ga0207693_10072242
525 Ga0207660_10007277
526 Ga0207660_10032629
527 Ga0207657_10027260
528 Ga0207657_10699789
529 Ga0207652_10002381
530 Ga0207652_10009274
531 Ga0207652_10057103
532 Ga0207652_10680670
533 Ga0207646_10294503
534 Ga0207659_10025687
535 Ga0207687_10161668
536 Ga0207687_10282714
537 Ga0207700_10858315
538 Ga0207664_10003487
539 Ga0207690_10061038
540 Ga0207690_10252908
541 Ga0207706_10004798
542 Ga0207709_10297698
543 Ga0207670_10740585
544 Ga0207669_10035447
545 Ga0207665_10016565
546 Ga0207711_10066748
547 Ga0207661_10000471
548 Ga0207661_10325724
549 Ga0207679_10010943
550 Ga0207679_11540539
551 Ga0207667_10237536
552 Ga0207651_10201684
553 Ga0207703_10014788
554 Ga0207703_10572126
555 Ga0207639_10032239
556 Ga0207702_10003501
557 Ga0207702_10090160
558 Ga0207648_10615920
559 Ga0207683_10069177
560 Ga0207698_10053459
561 Ga0207428_10048272
562 Ga0307515_10088041
563 Ga0307511_10114236
564 Ga0307513_10276298
565 Ga0307408_100245849
566 Ga0316575_10003775
567 Ga0307405_10004877
568 Ga0307413_10283084
569 Ga0307410_10057924
570 Ga0307409_100027417
571 Ga0307416_100005910
572 Ga0307416_100910986
573 Ga0307415_100000146
574 Ga0373934_0021770
575 Ga0373944_0236684
576 Ga0373923_0108525
577 Ga0373932_0054276
578 Ga0373936_0054546
579 Ga0373954_0027743
580 Ga0373954_0129735
581 Ga0373957_0197703
582 Ga0373955_0092615
583 Ga0373961_0136209
584 Ga0373962_0086906
585 Ga0316574_0018259
586 Ga0373927_0279585
587 Ga0373933_0019012
588 Ga0373937_0041688
589 Ga0316582_0069414
590 Ga0395900_0160675
591 Ga0395898_0282867
592 Ga0436365_1102411
593 Ga0436362_0505286
594 Ga0439441_002040
595 Ga0439463_001883
596 Ga0439435_0073158
597 Ga0439444_0000076
598 Ga0439459_0059119
599 Ga0439464_0002696
600 Ga0439464_0280203
601 Ga0439460_0001052
602 Ga0439460_0255189
603 Ga0439440_0000045
604 Ga0466963_0025779
605 Ga0466963_0145725
606 Ga0466957_0657786
607 Ga0466967_0084919
608 Ga0466967_0152888
609 Ga0466967_1073875
610 Ga0495592_0066245
611 Ga0495653_0010030
612 Ga0495653_0182779
613 Ga0495664_0843936
614 Ga0495608_0276611
615 Ga0495628_0244926
616 Ga0495666_0361281
617 Ga0495587_0120603
618 Ga0495587_0129935
619 Ga0495645_0231054
620 Ga0495667_0010216
621 Ga0495667_0038701
622 Ga0495635_0013919
623 Ga0495657_0063930
624 Ga0495657_0089726
625 Ga0495600_0120140
626 Ga0495680_0009759
627 Ga0495675_0252111
628 Ga0495684_0020946
629 Ga0495684_0063842
630 Ga0495602_0115418
631 Ga0495602_0926509
632 Ga0496100_0102947
633 Ga0496101_0100960
634 Ga0496101_0247154
635 Ga0496102_0179227
636 Ga0496103_0028230
637 Ga0496104_0051111
638 Ga0496105_0008277
639 Ga0496105_0083874
640 Ga0496106_0452748
641 Ga0496108_0001520
642 Ga0496108_0212902
643 Ga0496109_0003014
644 Ga0496110_0005501
645 Ga0496110_0019092
646 Ga0496110_0511886
647 Ga0496111_0002553
648 Ga0496112_0117458
649 Ga0496113_0604060
650 Ga0496114_0114800
651 Ga0496114_0276855
652 Ga0496114_0770062
653 Ga0496115_0051849
654 Ga0496125_0184412
655 Ga0496126_0000037
656 Ga0501031_0004353
657 Ga0501031_0006512
658 Ga0501031_0365223
659 Ga0501032_0102969
660 Ga0501033_0048847
661 Ga0501033_0084167
662 Ga0501033_0173774
663 Ga0501036_0000401
664 Ga0501036_0077071
665 Ga0501037_0023951
666 Ga0501037_0049562
667 Ga0501038_0002119
668 Ga0501038_0032394
669 Ga0501038_0049426
670 Ga0501039_0000206
671 Ga0501039_0014005
672 Ga0501039_0120919
673 Ga0501039_0838203
674 Ga0501040_0000358
675 Ga0501040_0017641
676 Ga0501040_0029205
677 Ga0501040_0040891
678 Ga0501041_0000545
679 Ga0501041_0008055
680 Ga0501041_0011825
681 Ga0501042_0000500
682 Ga0501042_0005297
683 Ga0501042_0048426
684 Ga0501043_0125587
685 Ga0501043_0286419
686 Ga0501043_0586519
687 Ga0501046_0004344
688 Ga0501046_0012956
689 Ga0501046_0041279
690 Ga0501048_0000029
691 Ga0501048_0013499
692 Ga0501048_0013887
693 Ga0501048_0702557
694 Ga0501068_0010496
695 Ga0501068_0171326
696 Ga0501070_0118459
697 Ga0501071_0004882
698 Ga0501071_0005348
699 Ga0501071_0020971
700 Ga0501071_0093802
701 Ga0501072_0000545
702 Ga0501072_0002380
703 Ga0501072_0125921
704 Ga0501073_0969316
705 Ga0501074_0000746
706 Ga0501074_0055133
707 Ga0501075_0000085
708 Ga0501075_0016558
709 Ga0501075_0072723
710 Ga0501076_0001660
711 Ga0501076_0006251
712 Ga0501076_0008690
713 Ga0501076_0042368
714 Ga0501076_0151349
715 Ga0501076_0548006
716 Ga0501077_0002640
717 Ga0501077_0042013
718 Ga0501077_0574178
719 Ga0501079_0000319
720 Ga0501079_0008044
721 Ga0501079_0018691
722 Ga0501080_0005743
723 Ga0501080_0007457
724 Ga0501080_0019880
725 Ga0501080_0555399
726 Ga0501081_0001667
727 Ga0501081_0015646
728 Ga0501081_0099026
729 Ga0501083_0013525
730 Ga0501083_0098370
731 Ga0501083_0513045
732 Ga0501083_0698612
733 Ga0501035_0011388
734 Ga0501035_0184662
735 Ga0501044_1033034
736 Ga0501045_0000231
737 Ga0501045_0005589
738 Ga0501045_0014827
739 Ga0501045_0065571
740 Ga0501045_0150092
741 nmdc:mga06z11_616814_c1
742 nmdc:mga05p37_117466_c1
743 nmdc:mga06r32_232288_c1
744 nmdc:mga08y16_351217_c1
745 nmdc:mga0n895_13824_c1
746 nmdc:mga0n895_147124_c1
747 nmdc:mga0n895_1675234_c1
748 nmdc:mga08x19_13074_c1
749 nmdc:mga08x19_213930_c1
750 nmdc:mga08x19_255511_c1
751 nmdc:mga08x19_465376_c1
752 Ga0495612_0013235
753 Ga0495619_0063735
754 Ga0500593_021108
755 Ga0500616_0011069
756 Ga0500616_0040498
757 Ga0501084_0001054
758 Ga0501084_0003490
759 Ga0501084_0053433
760 Ga0501084_0071331
761 Ga0501084_0263708
762 Ga0590075_001081
763 Ga0590077_001472
764 Ga0501082_0001319
765 Ga0501082_0004767
766 Ga0501082_0023140
767 Ga0501082_0477907
768 Ga0530510_0000166
769 Ga0530510_0007839
770 Ga0530510_0132474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

78

151

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

10

78

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9832 4 158
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9815 4 157
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9803 3 156
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9734 2 157
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9701 2 157
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9913 2 76 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9827 80 156 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9799 2 78 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9791 4 78 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9788 80 156 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A5S4GXX3-F1-model_v4 (2Fe-2S)-binding protein 0.9937 3 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A7H8LZ10-F1-model_v4 (2Fe-2S)-binding protein 0.9935 3 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A850JEZ1-F1-model_v4 (2Fe-2S)-binding protein 0.9931 3 158 GO:0016491
GO:0046872
GO:0051537
AF-A0A543IHI8-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.9929 2 157 GO:0016491
GO:0046872
GO:0051537
AF-A0A239CI46-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.9928 3 160 GO:0016491
GO:0046872
GO:0051537

Map