F430167
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 385 | 236 | 385 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300006358|Ga0068871_100016743|Ga0068871_1000167432 |
| Length | 326 |
| Sequence | LPTRTDSSPRAPQGGNGTGPNHLSDSIGWIGTGRMGIEMAAHLAKGGADVLAWNRTKAKAEPLQKYGAKVAGGLPELAARDIVFCMVSTWDDVKEVVTRMLDGAKKVPRILIECSSISLEGSAELRQMLAARGIEYLAAPVSGNAKVIKAGRLSFVCSGPKKAFDEALPYLEMIGPSASYVGEGELARIVKICHNVFLGVVTQSLAEITVLAEKAGVPRHAFLDFMNQSVMGSTFTRYKTPAFVNLDFKVTFTPALLRKDLDLGLDAGKRFEVPMPLASATRDLIQAMMGRGWTGQDFATLLLQQAQASGVELAPENVEVSDGLSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 157 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 158 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 160 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 161 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 162 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 166 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 180 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 181 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 185 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 186 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 187 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 206 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 207 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 208 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 209 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 210 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 226 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 228 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 235 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 236 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.78 |
| Nodule | 0 |
| Rhizoplane | 5.71 |
| Rhizosphere | 90.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10000129 | 3300005327 | Bacteria | 67266 |
| 2 | Ga0070676_10001102 | 3300005328 | Bacteria | 13494 |
| 3 | Ga0070683_100100668 | 3300005329 | Bacteria | 2720 |
| 4 | Ga0070683_100247916 | 3300005329 | Bacteria | 1694 |
| 5 | Ga0070690_100049317 | 3300005330 | Bacteria | 2683 |
| 6 | Ga0070670_100113803 | 3300005331 | Bacteria | 2332 |
| 7 | Ga0068869_100000152 | 3300005334 | Bacteria | 34316 |
| 8 | Ga0068869_100169048 | 3300005334 | Bacteria | 1707 |
| 9 | Ga0070666_10013311 | 3300005335 | Bacteria | 5216 |
| 10 | Ga0070666_10110446 | 3300005335 | Bacteria | 1901 |
| 11 | Ga0070680_100023972 | 3300005336 | Bacteria | 4871 |
| 12 | Ga0070682_100013380 | 3300005337 | Bacteria | 4718 |
| 13 | Ga0070682_100044363 | 3300005337 | Bacteria | 2753 |
| 14 | Ga0070682_100133882 | 3300005337 | Bacteria | 1681 |
| 15 | Ga0068868_100007194 | 3300005338 | Bacteria | 7908 |
| 16 | Ga0070660_100002845 | 3300005339 | Bacteria | 11916 |
| 17 | Ga0070660_100110170 | 3300005339 | Bacteria | 2189 |
| 18 | Ga0070660_100118792 | 3300005339 | Bacteria | 2108 |
| 19 | Ga0070660_100227293 | 3300005339 | Bacteria | 1518 |
| 20 | Ga0070689_100064087 | 3300005340 | Bacteria | 2860 |
| 21 | Ga0070689_100093122 | 3300005340 | Bacteria | 2378 |
| 22 | Ga0070691_10135033 | 3300005341 | Bacteria | 1253 |
| 23 | Ga0070687_100017489 | 3300005343 | Bacteria | 3298 |
| 24 | Ga0070687_100081086 | 3300005343 | Bacteria | 1770 |
| 25 | Ga0070661_100005435 | 3300005344 | Bacteria | 8782 |
| 26 | Ga0070661_100056667 | 3300005344 | Bacteria | 2871 |
| 27 | Ga0070661_100311464 | 3300005344 | Bacteria | 1227 |
| 28 | Ga0070692_10064046 | 3300005345 | Bacteria | 1943 |
| 29 | Ga0070668_100010033 | 3300005347 | Bacteria | 7018 |
| 30 | Ga0070668_100081937 | 3300005347 | Bacteria | 2530 |
| 31 | Ga0070669_100033681 | 3300005353 | Bacteria | 3706 |
| 32 | Ga0070669_100048718 | 3300005353 | Bacteria | 3093 |
| 33 | Ga0070675_100463244 | 3300005354 | Unclassified | 1138 |
| 34 | Ga0070671_100024010 | 3300005355 | Bacteria | 4990 |
| 35 | Ga0070671_100139598 | 3300005355 | Bacteria | 2045 |
| 36 | Ga0070674_100011207 | 3300005356 | Bacteria | 5449 |
| 37 | Ga0070673_100000318 | 3300005364 | Bacteria | 25352 |
| 38 | Ga0070673_100017867 | 3300005364 | Bacteria | 5054 |
| 39 | Ga0070688_100005468 | 3300005365 | Bacteria | 6694 |
| 40 | Ga0070688_100044079 | 3300005365 | Bacteria | 2751 |
| 41 | Ga0070659_100000175 | 3300005366 | Bacteria | 49114 |
| 42 | Ga0070659_100087243 | 3300005366 | Bacteria | 2498 |
| 43 | Ga0070659_100328095 | 3300005366 | Bacteria | 1280 |
| 44 | Ga0070667_100002820 | 3300005367 | Bacteria | 14999 |
| 45 | Ga0070667_100143212 | 3300005367 | Bacteria | 2095 |
| 46 | Ga0070667_100543174 | 3300005367 | Bacteria | 1068 |
| 47 | Ga0070713_100020208 | 3300005436 | Bacteria | 5100 |
| 48 | Ga0070713_100075358 | 3300005436 | Bacteria | 2861 |
| 49 | Ga0070710_10010777 | 3300005437 | Bacteria | 4497 |
| 50 | Ga0070710_10018350 | 3300005437 | Bacteria | 3598 |
| 51 | Ga0070711_100000746 | 3300005439 | Bacteria | 16984 |
| 52 | Ga0070711_100036133 | 3300005439 | Bacteria | 3309 |
| 53 | Ga0070700_100253923 | 3300005441 | Bacteria | 1263 |
| 54 | Ga0070694_100014651 | 3300005444 | Bacteria | 4911 |
| 55 | Ga0070708_100000634 | 3300005445 | Bacteria | 26540 |
| 56 | Ga0070708_100003217 | 3300005445 | Bacteria | 12740 |
| 57 | Ga0070708_100079554 | 3300005445 | Unclassified | 2966 |
| 58 | Ga0070708_100493642 | 3300005445 | Bacteria | 1155 |
| 59 | Ga0070663_100002915 | 3300005455 | Bacteria | 9730 |
| 60 | Ga0070678_100093931 | 3300005456 | Bacteria | 2307 |
| 61 | Ga0070678_100321999 | 3300005456 | Bacteria | 1320 |
| 62 | Ga0070662_100000169 | 3300005457 | Bacteria | 37987 |
| 63 | Ga0070662_100019152 | 3300005457 | Bacteria | 4643 |
| 64 | Ga0070662_100075219 | 3300005457 | Bacteria | 2501 |
| 65 | Ga0070662_100206619 | 3300005457 | Bacteria | 1561 |
| 66 | Ga0070681_10187737 | 3300005458 | Bacteria | 1987 |
| 67 | Ga0070681_10300163 | 3300005458 | Bacteria | 1516 |
| 68 | Ga0068867_100003325 | 3300005459 | Bacteria | 11316 |
| 69 | Ga0068867_100137577 | 3300005459 | Bacteria | 1906 |
| 70 | Ga0070685_10021068 | 3300005466 | Bacteria | 3539 |
| 71 | Ga0070706_100000079 | 3300005467 | Bacteria | 111752 |
| 72 | Ga0070706_100114601 | 3300005467 | Bacteria | 2510 |
| 73 | Ga0070706_100301833 | 3300005467 | Bacteria | 1494 |
| 74 | Ga0070707_100000029 | 3300005468 | Bacteria | 123116 |
| 75 | Ga0070707_100570761 | 3300005468 | Bacteria | 1093 |
| 76 | Ga0070698_100212965 | 3300005471 | Bacteria | 1866 |
| 77 | Ga0070699_100078144 | 3300005518 | Bacteria | 2882 |
| 78 | Ga0070699_100226370 | 3300005518 | Bacteria | 1667 |
| 79 | Ga0070699_100411839 | 3300005518 | Bacteria | 1223 |
| 80 | Ga0070679_100038692 | 3300005530 | Bacteria | 4742 |
| 81 | Ga0070679_100080182 | 3300005530 | Bacteria | 3253 |
| 82 | Ga0070679_100136382 | 3300005530 | Bacteria | 2435 |
| 83 | Ga0070679_100269019 | 3300005530 | Bacteria | 1659 |
| 84 | Ga0070684_100041077 | 3300005535 | Bacteria | 3986 |
| 85 | Ga0070697_100000003 | 3300005536 | Bacteria | 322584 |
| 86 | Ga0070697_100004101 | 3300005536 | Bacteria | 11163 |
| 87 | Ga0070697_100124154 | 3300005536 | Bacteria | 2162 |
| 88 | Ga0068853_100009887 | 3300005539 | Bacteria | 7699 |
| 89 | Ga0070672_100179680 | 3300005543 | Bacteria | 1763 |
| 90 | Ga0070686_100016450 | 3300005544 | Bacteria | 4303 |
| 91 | Ga0070695_100000748 | 3300005545 | Bacteria | 17404 |
| 92 | Ga0070696_100063867 | 3300005546 | Bacteria | 2580 |
| 93 | Ga0070665_100001983 | 3300005548 | Bacteria | 23038 |
| 94 | Ga0068855_100000588 | 3300005563 | Bacteria | 44619 |
| 95 | Ga0068855_100040640 | 3300005563 | Bacteria | 5519 |
| 96 | Ga0070664_100003854 | 3300005564 | Bacteria | 12107 |
| 97 | Ga0070664_100034296 | 3300005564 | Bacteria | 4257 |
| 98 | Ga0070664_100053299 | 3300005564 | Bacteria | 3428 |
| 99 | Ga0070664_100108171 | 3300005564 | Bacteria | 2424 |
| 100 | Ga0068857_100101047 | 3300005577 | Bacteria | 2588 |
| 101 | Ga0068854_100055092 | 3300005578 | Bacteria | 2861 |
| 102 | Ga0068854_100107146 | 3300005578 | Bacteria | 2103 |
| 103 | Ga0068854_100125443 | 3300005578 | Bacteria | 1954 |
| 104 | Ga0068856_100000557 | 3300005614 | Bacteria | 41004 |
| 105 | Ga0068856_100276118 | 3300005614 | Bacteria | 1697 |
| 106 | Ga0070702_100022440 | 3300005615 | Bacteria | 3337 |
| 107 | Ga0070702_100175115 | 3300005615 | Bacteria | 1399 |
| 108 | Ga0068852_100116969 | 3300005616 | Bacteria | 2433 |
| 109 | Ga0068852_100180722 | 3300005616 | Bacteria | 1983 |
| 110 | Ga0068852_100495881 | 3300005616 | Bacteria | 1215 |
| 111 | Ga0068859_100000518 | 3300005617 | Bacteria | 38274 |
| 112 | Ga0068859_100005705 | 3300005617 | Bacteria | 12664 |
| 113 | Ga0068864_100002217 | 3300005618 | Bacteria | 16051 |
| 114 | Ga0068864_100003353 | 3300005618 | Bacteria | 13243 |
| 115 | Ga0068866_10007746 | 3300005718 | Bacteria | 4505 |
| 116 | Ga0068870_10125175 | 3300005840 | Bacteria | 1485 |
| 117 | Ga0068863_100003085 | 3300005841 | Bacteria | 16466 |
| 118 | Ga0068863_100080146 | 3300005841 | Bacteria | 3092 |
| 119 | Ga0068858_100002551 | 3300005842 | Bacteria | 18373 |
| 120 | Ga0068858_100470381 | 3300005842 | Bacteria | 1212 |
| 121 | Ga0081455_10009202 | 3300005937 | Bacteria | 10177 |
| 122 | Ga0081538_10003311 | 3300005981 | Bacteria | 15275 |
| 123 | Ga0081538_10004627 | 3300005981 | Bacteria | 12629 |
| 124 | Ga0081538_10005362 | 3300005981 | Bacteria | 11522 |
| 125 | Ga0081538_10030373 | 3300005981 | Bacteria | 3671 |
| 126 | Ga0075363_100163438 | 3300006048 | Bacteria | 1261 |
| 127 | Ga0070716_100001080 | 3300006173 | Bacteria | 11954 |
| 128 | Ga0070716_100141204 | 3300006173 | Unclassified | 1536 |
| 129 | Ga0070712_100001121 | 3300006175 | Bacteria | 16131 |
| 130 | Ga0070712_100025086 | 3300006175 | Bacteria | 3958 |
| 131 | Ga0068871_100016743 | 3300006358 | Bacteria | 5531 |
| 132 | Ga0068871_100105338 | 3300006358 | Bacteria | 2366 |
| 133 | Ga0075433_10445040 | 3300006852 | Bacteria | 1142 |
| 134 | Ga0068865_100047473 | 3300006881 | Bacteria | 2951 |
| 135 | Ga0097620_100000518 | 3300006931 | Bacteria | 38274 |
| 136 | Ga0097620_100005705 | 3300006931 | Bacteria | 12664 |
| 137 | Ga0075435_100229844 | 3300007076 | Bacteria | 1576 |
| 138 | Ga0099794_10000104 | 3300007265 | Bacteria | 31247 |
| 139 | Ga0099794_10004592 | 3300007265 | Bacteria | 5448 |
| 140 | Ga0099794_10004955 | 3300007265 | Bacteria | 5296 |
| 141 | Ga0099794_10060655 | 3300007265 | Bacteria | 1837 |
| 142 | Ga0105240_10002070 | 3300009093 | Bacteria | 32876 |
| 143 | Ga0105245_10002153 | 3300009098 | Bacteria | 17852 |
| 144 | Ga0105245_10033691 | 3300009098 | Bacteria | 4540 |
| 145 | Ga0114129_10378972 | 3300009147 | Bacteria | 1869 |
| 146 | Ga0105243_10219679 | 3300009148 | Bacteria | 1679 |
| 147 | Ga0105241_10199876 | 3300009174 | Bacteria | 1669 |
| 148 | Ga0105242_10009346 | 3300009176 | Bacteria | 7525 |
| 149 | Ga0105242_10075818 | 3300009176 | Bacteria | 2801 |
| 150 | Ga0105248_10006278 | 3300009177 | Bacteria | 13037 |
| 151 | Ga0105248_10044872 | 3300009177 | Bacteria | 4957 |
| 152 | Ga0105237_10175823 | 3300009545 | Bacteria | 2141 |
| 153 | Ga0105249_10097712 | 3300009553 | Bacteria | 2757 |
| 154 | Ga0099796_10000339 | 3300010159 | Bacteria | 7576 |
| 155 | Ga0157373_10006502 | 3300013100 | Bacteria | 8719 |
| 156 | Ga0157371_10003810 | 3300013102 | Bacteria | 13486 |
| 157 | Ga0157370_10030168 | 3300013104 | Bacteria | 5315 |
| 158 | Ga0157370_10037237 | 3300013104 | Bacteria | 4716 |
| 159 | Ga0157369_10054951 | 3300013105 | Bacteria | 4299 |
| 160 | Ga0157374_10000601 | 3300013296 | Bacteria | 31868 |
| 161 | Ga0157374_10105484 | 3300013296 | Bacteria | 2707 |
| 162 | Ga0157378_10115479 | 3300013297 | Bacteria | 2467 |
| 163 | Ga0157378_10122966 | 3300013297 | Bacteria | 2394 |
| 164 | Ga0163162_10029751 | 3300013306 | Bacteria | 5406 |
| 165 | Ga0163162_10138876 | 3300013306 | Bacteria | 2542 |
| 166 | Ga0157372_10015179 | 3300013307 | Bacteria | 8246 |
| 167 | Ga0157375_10003299 | 3300013308 | Bacteria | 13974 |
| 168 | Ga0157375_10106790 | 3300013308 | Bacteria | 2892 |
| 169 | Ga0157375_10138974 | 3300013308 | Bacteria | 2555 |
| 170 | Ga0163163_10001537 | 3300014325 | Bacteria | 19436 |
| 171 | Ga0163163_10013243 | 3300014325 | Bacteria | 7542 |
| 172 | Ga0163163_10107437 | 3300014325 | Bacteria | 2817 |
| 173 | Ga0157377_10036486 | 3300014745 | Bacteria | 2705 |
| 174 | Ga0157379_10004248 | 3300014968 | Bacteria | 12231 |
| 175 | Ga0157379_10038927 | 3300014968 | Bacteria | 4242 |
| 176 | Ga0157379_10101177 | 3300014968 | Bacteria | 2587 |
| 177 | Ga0157376_10077332 | 3300014969 | Bacteria | 2846 |
| 178 | Ga0157376_10190268 | 3300014969 | Bacteria | 1881 |
| 179 | Ga0213876_10065850 | 3300021384 | Bacteria | 1912 |
| 180 | Ga0207692_10002783 | 3300025898 | Bacteria | 6750 |
| 181 | Ga0207692_10233903 | 3300025898 | Bacteria | 1095 |
| 182 | Ga0207688_10010417 | 3300025901 | Bacteria | 5060 |
| 183 | Ga0207680_10072217 | 3300025903 | Bacteria | 2142 |
| 184 | Ga0207680_10080641 | 3300025903 | Bacteria | 2044 |
| 185 | Ga0207647_10050917 | 3300025904 | Bacteria | 2562 |
| 186 | Ga0207685_10008951 | 3300025905 | Bacteria | 2884 |
| 187 | Ga0207645_10003431 | 3300025907 | Bacteria | 12047 |
| 188 | Ga0207643_10057427 | 3300025908 | Bacteria | 2215 |
| 189 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 190 | Ga0207684_10000068 | 3300025910 | Bacteria | 191048 |
| 191 | Ga0207684_10100733 | 3300025910 | Bacteria | 2469 |
| 192 | Ga0207684_10240748 | 3300025910 | Bacteria | 1561 |
| 193 | Ga0207654_10063216 | 3300025911 | Bacteria | 2172 |
| 194 | Ga0207654_10109229 | 3300025911 | Bacteria | 1718 |
| 195 | Ga0207707_10027551 | 3300025912 | Bacteria | 4968 |
| 196 | Ga0207707_10137645 | 3300025912 | Bacteria | 2135 |
| 197 | Ga0207707_10157711 | 3300025912 | Bacteria | 1984 |
| 198 | Ga0207707_10174981 | 3300025912 | Bacteria | 1875 |
| 199 | Ga0207695_10209833 | 3300025913 | Bacteria | 1859 |
| 200 | Ga0207693_10000236 | 3300025915 | Bacteria | 50870 |
| 201 | Ga0207693_10023856 | 3300025915 | Bacteria | 4855 |
| 202 | Ga0207663_10002612 | 3300025916 | Bacteria | 8669 |
| 203 | Ga0207663_10027596 | 3300025916 | Bacteria | 3312 |
| 204 | Ga0207662_10021359 | 3300025918 | Bacteria | 3700 |
| 205 | Ga0207657_10000540 | 3300025919 | Bacteria | 40363 |
| 206 | Ga0207657_10011959 | 3300025919 | Bacteria | 8589 |
| 207 | Ga0207657_10013760 | 3300025919 | Bacteria | 7922 |
| 208 | Ga0207657_10196833 | 3300025919 | Bacteria | 1623 |
| 209 | Ga0207649_10003134 | 3300025920 | Bacteria | 9066 |
| 210 | Ga0207649_10265763 | 3300025920 | Bacteria | 1241 |
| 211 | Ga0207652_10031331 | 3300025921 | Bacteria | 4465 |
| 212 | Ga0207652_10063999 | 3300025921 | Bacteria | 3182 |
| 213 | Ga0207652_10362134 | 3300025921 | Bacteria | 1309 |
| 214 | Ga0207652_10478882 | 3300025921 | Bacteria | 1121 |
| 215 | Ga0207646_10000142 | 3300025922 | Bacteria | 98159 |
| 216 | Ga0207646_10002399 | 3300025922 | Bacteria | 22102 |
| 217 | Ga0207681_10039190 | 3300025923 | Bacteria | 3144 |
| 218 | Ga0207681_10046910 | 3300025923 | Bacteria | 2907 |
| 219 | Ga0207650_10088944 | 3300025925 | Bacteria | 2356 |
| 220 | Ga0207650_10109775 | 3300025925 | Bacteria | 2134 |
| 221 | Ga0207687_10000769 | 3300025927 | Bacteria | 21615 |
| 222 | Ga0207700_10005113 | 3300025928 | Bacteria | 7802 |
| 223 | Ga0207644_10023822 | 3300025931 | Bacteria | 4197 |
| 224 | Ga0207644_10028807 | 3300025931 | Bacteria | 3848 |
| 225 | Ga0207690_10000388 | 3300025932 | Bacteria | 29040 |
| 226 | Ga0207690_10151669 | 3300025932 | Bacteria | 1719 |
| 227 | Ga0207706_10000550 | 3300025933 | Bacteria | 39856 |
| 228 | Ga0207706_10098246 | 3300025933 | Bacteria | 2575 |
| 229 | Ga0207686_10016145 | 3300025934 | Bacteria | 4185 |
| 230 | Ga0207670_10016815 | 3300025936 | Bacteria | 4407 |
| 231 | Ga0207670_10048786 | 3300025936 | Bacteria | 2828 |
| 232 | Ga0207670_10098810 | 3300025936 | Bacteria | 2081 |
| 233 | Ga0207704_10050354 | 3300025938 | Bacteria | 2512 |
| 234 | Ga0207665_10001314 | 3300025939 | Bacteria | 16749 |
| 235 | Ga0207665_10194038 | 3300025939 | Bacteria | 1477 |
| 236 | Ga0207665_10239258 | 3300025939 | Bacteria | 1337 |
| 237 | Ga0207691_10013633 | 3300025940 | Bacteria | 7769 |
| 238 | Ga0207691_10031444 | 3300025940 | Bacteria | 4954 |
| 239 | Ga0207691_10060486 | 3300025940 | Bacteria | 3442 |
| 240 | Ga0207691_10157392 | 3300025940 | Bacteria | 1994 |
| 241 | Ga0207711_10001869 | 3300025941 | Bacteria | 19194 |
| 242 | Ga0207711_10070106 | 3300025941 | Bacteria | 3040 |
| 243 | Ga0207711_10114110 | 3300025941 | Bacteria | 2406 |
| 244 | Ga0207689_10015529 | 3300025942 | Bacteria | 6450 |
| 245 | Ga0207689_10068122 | 3300025942 | Bacteria | 2925 |
| 246 | Ga0207689_10097671 | 3300025942 | Bacteria | 2413 |
| 247 | Ga0207661_10213686 | 3300025944 | Bacteria | 1701 |
| 248 | Ga0207679_10002903 | 3300025945 | Bacteria | 10633 |
| 249 | Ga0207679_10030228 | 3300025945 | Bacteria | 3780 |
| 250 | Ga0207679_10235815 | 3300025945 | Bacteria | 1547 |
| 251 | Ga0207679_10252882 | 3300025945 | Bacteria | 1499 |
| 252 | Ga0207667_10001137 | 3300025949 | Bacteria | 33462 |
| 253 | Ga0207651_10000525 | 3300025960 | Bacteria | 16106 |
| 254 | Ga0207651_10007157 | 3300025960 | Bacteria | 5929 |
| 255 | Ga0207668_10038262 | 3300025972 | Bacteria | 3218 |
| 256 | Ga0207668_10046654 | 3300025972 | Bacteria | 2961 |
| 257 | Ga0207640_10198234 | 3300025981 | Bacteria | 1519 |
| 258 | Ga0207658_10017123 | 3300025986 | Bacteria | 4991 |
| 259 | Ga0207658_10069978 | 3300025986 | Bacteria | 2653 |
| 260 | Ga0207658_10095153 | 3300025986 | Bacteria | 2320 |
| 261 | Ga0207677_10000241 | 3300026023 | Bacteria | 42261 |
| 262 | Ga0207703_10003696 | 3300026035 | Bacteria | 12743 |
| 263 | Ga0207703_10011474 | 3300026035 | Bacteria | 6892 |
| 264 | Ga0207703_10270209 | 3300026035 | Bacteria | 1540 |
| 265 | Ga0207639_10044253 | 3300026041 | Bacteria | 3347 |
| 266 | Ga0207639_10181439 | 3300026041 | Bacteria | 1791 |
| 267 | Ga0207678_10028294 | 3300026067 | Bacteria | 4894 |
| 268 | Ga0207678_10044240 | 3300026067 | Bacteria | 3852 |
| 269 | Ga0207678_10085525 | 3300026067 | Bacteria | 2696 |
| 270 | Ga0207678_10128348 | 3300026067 | Bacteria | 2163 |
| 271 | Ga0207708_10073386 | 3300026075 | Bacteria | 2622 |
| 272 | Ga0207702_10001785 | 3300026078 | Bacteria | 21197 |
| 273 | Ga0207702_10059856 | 3300026078 | Bacteria | 3246 |
| 274 | Ga0207702_10100335 | 3300026078 | Bacteria | 2554 |
| 275 | Ga0207702_10267382 | 3300026078 | Bacteria | 1612 |
| 276 | Ga0207641_10018404 | 3300026088 | Bacteria | 5727 |
| 277 | Ga0207648_10001002 | 3300026089 | Bacteria | 31804 |
| 278 | Ga0207676_10000520 | 3300026095 | Bacteria | 32358 |
| 279 | Ga0207676_10036349 | 3300026095 | Bacteria | 3745 |
| 280 | Ga0207674_10023672 | 3300026116 | Bacteria | 6574 |
| 281 | Ga0207674_10081779 | 3300026116 | Bacteria | 3232 |
| 282 | Ga0207675_100001191 | 3300026118 | Bacteria | 25904 |
| 283 | Ga0207683_10094364 | 3300026121 | Bacteria | 2666 |
| 284 | Ga0207683_10100390 | 3300026121 | Bacteria | 2584 |
| 285 | Ga0207698_10074527 | 3300026142 | Bacteria | 2708 |
| 286 | Ga0209588_1000009 | 3300027671 | Bacteria | 174900 |
| 287 | Ga0268266_10112325 | 3300028379 | Bacteria | 2415 |
| 288 | Ga0268266_10471993 | 3300028379 | Bacteria | 1195 |
| 289 | Ga0268265_10049406 | 3300028380 | Bacteria | 3163 |
| 290 | Ga0268264_10000854 | 3300028381 | Bacteria | 32463 |
| 291 | Ga0268264_10002755 | 3300028381 | Bacteria | 15346 |
| 292 | Ga0307515_10091130 | 3300028794 | Bacteria | 3813 |
| 293 | Ga0307512_10002822 | 3300030522 | Bacteria | 21161 |
| 294 | Ga0307512_10017252 | 3300030522 | Bacteria | 6633 |
| 295 | Ga0265320_10012678 | 3300031240 | Bacteria | 4889 |
| 296 | Ga0307513_10000535 | 3300031456 | Bacteria | 54265 |
| 297 | Ga0307513_10065765 | 3300031456 | Bacteria | 3814 |
| 298 | Ga0307513_10239397 | 3300031456 | Bacteria | 1621 |
| 299 | Ga0307509_10003240 | 3300031507 | Bacteria | 25121 |
| 300 | Ga0307508_10019986 | 3300031616 | Bacteria | 6084 |
| 301 | Ga0307516_10006918 | 3300031730 | Bacteria | 13170 |
| 302 | Ga0307409_100104891 | 3300031995 | Bacteria | 2355 |
| 303 | Ga0307411_10089407 | 3300032005 | Bacteria | 2145 |
| 304 | Ga0307510_10134249 | 3300033180 | Bacteria | 2138 |
| 305 | Ga0373923_0005852 | 3300035111 | Bacteria | 4199 |
| 306 | Ga0373953_0001104 | 3300035117 | Bacteria | 7641 |
| 307 | Ga0373954_0006818 | 3300035118 | Bacteria | 4982 |
| 308 | Ga0373956_0007816 | 3300035119 | Bacteria | 4313 |
| 309 | Ga0373957_0008629 | 3300035120 | Bacteria | 3310 |
| 310 | Ga0373943_0220332 | 3300035170 | Bacteria | 1056 |
| 311 | Ga0373955_0001260 | 3300035172 | Bacteria | 10754 |
| 312 | Ga0373961_0010085 | 3300035241 | Bacteria | 2324 |
| 313 | Ga0373931_0175802 | 3300035691 | Unclassified | 1265 |
| 314 | Ga0373935_0319391 | 3300035692 | Bacteria | 1101 |
| 315 | Ga0373927_0092790 | 3300035695 | Bacteria | 1961 |
| 316 | Ga0373933_0012679 | 3300035724 | Bacteria | 4659 |
| 317 | Ga0373937_0008943 | 3300036401 | Bacteria | 8692 |
| 318 | Ga0373937_0324902 | 3300036401 | Bacteria | 1456 |
| 319 | Ga0436365_1596195 | 3300039437 | Bacteria | 2749 |
| 320 | Ga0436360_0323091 | 3300039438 | Bacteria | 2225 |
| 321 | Ga0436362_0802830 | 3300039453 | Bacteria | 3457 |
| 322 | Ga0436362_1093284 | 3300039453 | Bacteria | 1410 |
| 323 | Ga0451577_0253262 | 3300042876 | Bacteria | 1594 |
| 324 | Ga0466969_0002498 | 3300044656 | Bacteria | 9823 |
| 325 | Ga0466966_0033745 | 3300044684 | Bacteria | 3312 |
| 326 | Ga0466961_0006136 | 3300044693 | Bacteria | 7626 |
| 327 | Ga0466963_0043648 | 3300044694 | Bacteria | 2949 |
| 328 | Ga0466970_0013253 | 3300044765 | Bacteria | 4226 |
| 329 | Ga0466959_0030620 | 3300045049 | Bacteria | 3984 |
| 330 | Ga0466958_0083121 | 3300045836 | Bacteria | 1973 |
| 331 | Ga0495629_0248380 | 3300046459 | Bacteria | 1224 |
| 332 | Ga0495653_0219140 | 3300046463 | Bacteria | 1280 |
| 333 | Ga0495580_0075624 | 3300046472 | Bacteria | 2349 |
| 334 | Ga0495662_0037562 | 3300046476 | Bacteria | 2339 |
| 335 | Ga0495608_0107007 | 3300046511 | Bacteria | 1800 |
| 336 | Ga0495628_0043076 | 3300046516 | Bacteria | 3598 |
| 337 | Ga0495652_0155878 | 3300046529 | Bacteria | 1779 |
| 338 | Ga0495665_0046024 | 3300046531 | Bacteria | 2317 |
| 339 | Ga0495640_0178805 | 3300046533 | Bacteria | 1353 |
| 340 | Ga0495586_0087111 | 3300046535 | Bacteria | 1722 |
| 341 | Ga0495635_0020156 | 3300046663 | Bacteria | 4647 |
| 342 | Ga0495623_0071911 | 3300046679 | Bacteria | 2151 |
| 343 | Ga0495604_0019201 | 3300047317 | Bacteria | 5474 |
| 344 | Ga0496101_0021373 | 3300048904 | Bacteria | 4447 |
| 345 | Ga0496102_0013562 | 3300048905 | Bacteria | 7064 |
| 346 | Ga0496103_0029762 | 3300048906 | Bacteria | 3319 |
| 347 | Ga0496103_0246597 | 3300048906 | Bacteria | 1149 |
| 348 | Ga0496104_0026529 | 3300048907 | Bacteria | 5352 |
| 349 | Ga0496105_0066023 | 3300048908 | Bacteria | 2986 |
| 350 | Ga0496106_0208555 | 3300048909 | Bacteria | 1556 |
| 351 | Ga0496107_0001667 | 3300048910 | Bacteria | 13879 |
| 352 | Ga0496107_0041559 | 3300048910 | Bacteria | 3301 |
| 353 | Ga0496108_0011707 | 3300048911 | Bacteria | 7136 |
| 354 | Ga0496108_0021136 | 3300048911 | Bacteria | 5348 |
| 355 | Ga0496108_0115216 | 3300048911 | Bacteria | 2302 |
| 356 | Ga0496108_0165450 | 3300048911 | Bacteria | 1912 |
| 357 | Ga0496109_0063321 | 3300048912 | Bacteria | 3383 |
| 358 | Ga0496110_0251251 | 3300048913 | Bacteria | 1609 |
| 359 | Ga0496112_0004738 | 3300048915 | Bacteria | 11591 |
| 360 | Ga0496112_0137131 | 3300048915 | Bacteria | 2417 |
| 361 | Ga0496112_0357227 | 3300048915 | Unclassified | 1403 |
| 362 | Ga0496113_0061728 | 3300048916 | Bacteria | 2828 |
| 363 | Ga0496114_0021772 | 3300048917 | Bacteria | 5217 |
| 364 | Ga0496114_0251333 | 3300048917 | Unclassified | 1556 |
| 365 | Ga0496115_0113632 | 3300048918 | Bacteria | 2225 |
| 366 | Ga0501039_0127174 | 3300049575 | Bacteria | 1999 |
| 367 | Ga0501040_0226017 | 3300049576 | Bacteria | 1332 |
| 368 | Ga0501042_0105874 | 3300049578 | Bacteria | 2024 |
| 369 | Ga0501067_0125469 | 3300049583 | Bacteria | 1429 |
| 370 | Ga0501071_0155295 | 3300049587 | Bacteria | 1708 |
| 371 | Ga0501072_0084864 | 3300049588 | Bacteria | 2511 |
| 372 | Ga0501076_0070780 | 3300049592 | Bacteria | 2789 |
| 373 | Ga0501081_0118764 | 3300049743 | Bacteria | 1881 |
| 374 | Ga0501271_004885 | 3300049768 | Bacteria | 1289 |
| 375 | Ga0501045_0234112 | 3300049824 | Bacteria | 1367 |
| 376 | nmdc:mga0yw44_297259_c1 | 3300050492 | Bacteria | 1081 |
| 377 | nmdc:mga05p37_98899_c1 | 3300050507 | Bacteria | 3594 |
| 378 | nmdc:mga0rr50_241735_c1 | 3300050513 | Bacteria | 1497 |
| 379 | nmdc:mga08x19_349072_c1 | 3300050514 | Bacteria | 1033 |
| 380 | nmdc:mga0a205_411535_c1 | 3300050515 | Bacteria | 1215 |
| 381 | Ga0495595_0059851 | 3300053084 | Bacteria | 1782 |
| 382 | Ga0495619_0155976 | 3300053085 | Bacteria | 1575 |
| 383 | Ga0500646_0008591 | 3300053090 | Bacteria | 2614 |
| 384 | Ga0466962_0114698 | 3300061719 | Bacteria | 1298 |
| 385 | Ga0530510_0053156 | 3300061734 | Bacteria | 2927 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007265 | Ga0099794_10000104 | Ga0099794_1000010424 | 295 |
| 2 | 3300021384 | Ga0213876_10065850 | Ga0213876_100658501 | 297 |
| 3 | 3300031730 | Ga0307516_10006918 | Ga0307516_100069189 | 297 |
| 4 | 3300039437 | Ga0436365_1596195 | Ga0436365_1596195_1540_2478 | 297 |
| 5 | 3300039453 | Ga0436362_0802830 | Ga0436362_0802830_2392_3330 | 297 |
| 6 | 3300045836 | Ga0466958_0083121 | Ga0466958_0083121_984_1934 | 297 |
| 7 | 3300046463 | Ga0495653_0219140 | Ga0495653_0219140_294_1256 | 297 |
| 8 | 3300046511 | Ga0495608_0107007 | Ga0495608_0107007_584_1510 | 297 |
| 9 | 3300050514 | nmdc:mga08x19_349072_c1 | nmdc:mga08x19_349072_c1_37_933 | 297 |
| 10 | 3300061719 | Ga0466962_0114698 | Ga0466962_0114698_207_1157 | 297 |
| 11 | 3300007076 | Ga0075435_100229844 | Ga0075435_1002298442 | 302 |
| 12 | 3300009147 | Ga0114129_10378972 | Ga0114129_103789722 | 302 |
| 13 | 3300050507 | nmdc:mga05p37_98899_c1 | nmdc:mga05p37_98899_c1_150_1118 | 302 |
| 14 | 3300050513 | nmdc:mga0rr50_241735_c1 | nmdc:mga0rr50_241735_c1_160_1128 | 302 |
| 15 | 3300007265 | Ga0099794_10004955 | Ga0099794_100049553 | 303 |
| 16 | 3300049583 | Ga0501067_0125469 | Ga0501067_0125469_192_1178 | 303 |
| 17 | 3300005329 | Ga0070683_100247916 | Ga0070683_1002479162 | 304 |
| 18 | 3300005330 | Ga0070690_100049317 | Ga0070690_1000493172 | 304 |
| 19 | 3300005335 | Ga0070666_10013311 | Ga0070666_100133114 | 304 |
| 20 | 3300005336 | Ga0070680_100023972 | Ga0070680_1000239725 | 304 |
| 21 | 3300005338 | Ga0068868_100007194 | Ga0068868_1000071942 | 304 |
| 22 | 3300005339 | Ga0070660_100110170 | Ga0070660_1001101702 | 304 |
| 23 | 3300005339 | Ga0070660_100118792 | Ga0070660_1001187922 | 304 |
| 24 | 3300005340 | Ga0070689_100064087 | Ga0070689_1000640872 | 304 |
| 25 | 3300005341 | Ga0070691_10135033 | Ga0070691_101350332 | 304 |
| 26 | 3300005343 | Ga0070687_100017489 | Ga0070687_1000174894 | 304 |
| 27 | 3300005344 | Ga0070661_100056667 | Ga0070661_1000566673 | 304 |
| 28 | 3300005345 | Ga0070692_10064046 | Ga0070692_100640461 | 304 |
| 29 | 3300005356 | Ga0070674_100011207 | Ga0070674_1000112074 | 304 |
| 30 | 3300005364 | Ga0070673_100000318 | Ga0070673_10000031811 | 304 |
| 31 | 3300005365 | Ga0070688_100005468 | Ga0070688_1000054685 | 304 |
| 32 | 3300005436 | Ga0070713_100020208 | Ga0070713_1000202084 | 304 |
| 33 | 3300005436 | Ga0070713_100075358 | Ga0070713_1000753583 | 304 |
| 34 | 3300005437 | Ga0070710_10010777 | Ga0070710_100107774 | 304 |
| 35 | 3300005437 | Ga0070710_10018350 | Ga0070710_100183504 | 304 |
| 36 | 3300005439 | Ga0070711_100000746 | Ga0070711_1000007466 | 304 |
| 37 | 3300005457 | Ga0070662_100019152 | Ga0070662_1000191522 | 304 |
| 38 | 3300005457 | Ga0070662_100075219 | Ga0070662_1000752193 | 304 |
| 39 | 3300005458 | Ga0070681_10300163 | Ga0070681_103001632 | 304 |
| 40 | 3300005459 | Ga0068867_100137577 | Ga0068867_1001375772 | 304 |
| 41 | 3300005466 | Ga0070685_10021068 | Ga0070685_100210684 | 304 |
| 42 | 3300005468 | Ga0070707_100570761 | Ga0070707_1005707611 | 304 |
| 43 | 3300005530 | Ga0070679_100080182 | Ga0070679_1000801823 | 304 |
| 44 | 3300005530 | Ga0070679_100269019 | Ga0070679_1002690192 | 304 |
| 45 | 3300005536 | Ga0070697_100124154 | Ga0070697_1001241542 | 304 |
| 46 | 3300005544 | Ga0070686_100016450 | Ga0070686_1000164504 | 304 |
| 47 | 3300005548 | Ga0070665_100001983 | Ga0070665_10000198312 | 304 |
| 48 | 3300005563 | Ga0068855_100040640 | Ga0068855_1000406402 | 304 |
| 49 | 3300005564 | Ga0070664_100108171 | Ga0070664_1001081712 | 304 |
| 50 | 3300005578 | Ga0068854_100055092 | Ga0068854_1000550922 | 304 |
| 51 | 3300005615 | Ga0070702_100022440 | Ga0070702_1000224402 | 304 |
| 52 | 3300005616 | Ga0068852_100116969 | Ga0068852_1001169692 | 304 |
| 53 | 3300005616 | Ga0068852_100180722 | Ga0068852_1001807223 | 304 |
| 54 | 3300005617 | Ga0068859_100000518 | Ga0068859_10000051818 | 304 |
| 55 | 3300005618 | Ga0068864_100002217 | Ga0068864_1000022173 | 304 |
| 56 | 3300005718 | Ga0068866_10007746 | Ga0068866_100077463 | 304 |
| 57 | 3300005841 | Ga0068863_100003085 | Ga0068863_1000030853 | 304 |
| 58 | 3300005841 | Ga0068863_100080146 | Ga0068863_1000801463 | 304 |
| 59 | 3300005842 | Ga0068858_100002551 | Ga0068858_1000025512 | 304 |
| 60 | 3300006173 | Ga0070716_100001080 | Ga0070716_10000108011 | 304 |
| 61 | 3300006175 | Ga0070712_100001121 | Ga0070712_10000112112 | 304 |
| 62 | 3300006175 | Ga0070712_100025086 | Ga0070712_1000250862 | 304 |
| 63 | 3300006358 | Ga0068871_100105338 | Ga0068871_1001053383 | 304 |
| 64 | 3300006931 | Ga0097620_100000518 | Ga0097620_10000051822 | 304 |
| 65 | 3300009093 | Ga0105240_10002070 | Ga0105240_100020703 | 304 |
| 66 | 3300009098 | Ga0105245_10002153 | Ga0105245_1000215313 | 304 |
| 67 | 3300009174 | Ga0105241_10199876 | Ga0105241_101998763 | 304 |
| 68 | 3300009176 | Ga0105242_10009346 | Ga0105242_100093468 | 304 |
| 69 | 3300009176 | Ga0105242_10075818 | Ga0105242_100758183 | 304 |
| 70 | 3300009177 | Ga0105248_10006278 | Ga0105248_100062783 | 304 |
| 71 | 3300013296 | Ga0157374_10000601 | Ga0157374_1000060121 | 304 |
| 72 | 3300013297 | Ga0157378_10122966 | Ga0157378_101229662 | 304 |
| 73 | 3300013306 | Ga0163162_10029751 | Ga0163162_100297513 | 304 |
| 74 | 3300013306 | Ga0163162_10138876 | Ga0163162_101388763 | 304 |
| 75 | 3300013308 | Ga0157375_10003299 | Ga0157375_1000329913 | 304 |
| 76 | 3300014325 | Ga0163163_10001537 | Ga0163163_1000153712 | 304 |
| 77 | 3300014745 | Ga0157377_10036486 | Ga0157377_100364862 | 304 |
| 78 | 3300014968 | Ga0157379_10038927 | Ga0157379_100389274 | 304 |
| 79 | 3300014969 | Ga0157376_10077332 | Ga0157376_100773322 | 304 |
| 80 | 3300014969 | Ga0157376_10190268 | Ga0157376_101902683 | 304 |
| 81 | 3300025898 | Ga0207692_10002783 | Ga0207692_100027833 | 304 |
| 82 | 3300025905 | Ga0207685_10008951 | Ga0207685_100089513 | 304 |
| 83 | 3300025911 | Ga0207654_10063216 | Ga0207654_100632161 | 304 |
| 84 | 3300025911 | Ga0207654_10109229 | Ga0207654_101092291 | 304 |
| 85 | 3300025912 | Ga0207707_10027551 | Ga0207707_100275512 | 304 |
| 86 | 3300025913 | Ga0207695_10209833 | Ga0207695_102098332 | 304 |
| 87 | 3300025915 | Ga0207693_10000236 | Ga0207693_1000023622 | 304 |
| 88 | 3300025915 | Ga0207693_10023856 | Ga0207693_100238564 | 304 |
| 89 | 3300025916 | Ga0207663_10002612 | Ga0207663_100026125 | 304 |
| 90 | 3300025919 | Ga0207657_10011959 | Ga0207657_100119592 | 304 |
| 91 | 3300025919 | Ga0207657_10013760 | Ga0207657_100137603 | 304 |
| 92 | 3300025921 | Ga0207652_10031331 | Ga0207652_100313315 | 304 |
| 93 | 3300025921 | Ga0207652_10478882 | Ga0207652_104788822 | 304 |
| 94 | 3300025927 | Ga0207687_10000769 | Ga0207687_1000076921 | 304 |
| 95 | 3300025928 | Ga0207700_10005113 | Ga0207700_100051138 | 304 |
| 96 | 3300025931 | Ga0207644_10023822 | Ga0207644_100238222 | 304 |
| 97 | 3300025934 | Ga0207686_10016145 | Ga0207686_100161454 | 304 |
| 98 | 3300025936 | Ga0207670_10048786 | Ga0207670_100487862 | 304 |
| 99 | 3300025939 | Ga0207665_10001314 | Ga0207665_1000131415 | 304 |
| 100 | 3300025940 | Ga0207691_10031444 | Ga0207691_100314444 | 304 |
| 101 | 3300025941 | Ga0207711_10001869 | Ga0207711_1000186911 | 304 |
| 102 | 3300025942 | Ga0207689_10068122 | Ga0207689_100681222 | 304 |
| 103 | 3300025945 | Ga0207679_10235815 | Ga0207679_102358152 | 304 |
| 104 | 3300025945 | Ga0207679_10252882 | Ga0207679_102528822 | 304 |
| 105 | 3300025960 | Ga0207651_10000525 | Ga0207651_100005258 | 304 |
| 106 | 3300025981 | Ga0207640_10198234 | Ga0207640_101982342 | 304 |
| 107 | 3300025986 | Ga0207658_10017123 | Ga0207658_100171233 | 304 |
| 108 | 3300026023 | Ga0207677_10000241 | Ga0207677_1000024129 | 304 |
| 109 | 3300026035 | Ga0207703_10003696 | Ga0207703_100036966 | 304 |
| 110 | 3300026078 | Ga0207702_10059856 | Ga0207702_100598563 | 304 |
| 111 | 3300026088 | Ga0207641_10018404 | Ga0207641_100184044 | 304 |
| 112 | 3300026095 | Ga0207676_10000520 | Ga0207676_1000052010 | 304 |
| 113 | 3300026142 | Ga0207698_10074527 | Ga0207698_100745273 | 304 |
| 114 | 3300028379 | Ga0268266_10112325 | Ga0268266_101123252 | 304 |
| 115 | 3300028381 | Ga0268264_10002755 | Ga0268264_100027556 | 304 |
| 116 | 3300035111 | Ga0373923_0005852 | Ga0373923_0005852_1474_2400 | 304 |
| 117 | 3300035117 | Ga0373953_0001104 | Ga0373953_0001104_5554_6480 | 304 |
| 118 | 3300035118 | Ga0373954_0006818 | Ga0373954_0006818_1476_2402 | 304 |
| 119 | 3300035119 | Ga0373956_0007816 | Ga0373956_0007816_1679_2605 | 304 |
| 120 | 3300035120 | Ga0373957_0008629 | Ga0373957_0008629_521_1447 | 304 |
| 121 | 3300035170 | Ga0373943_0220332 | Ga0373943_0220332_52_978 | 304 |
| 122 | 3300035172 | Ga0373955_0001260 | Ga0373955_0001260_1476_2402 | 304 |
| 123 | 3300035692 | Ga0373935_0319391 | Ga0373935_0319391_151_1077 | 304 |
| 124 | 3300035695 | Ga0373927_0092790 | Ga0373927_0092790_512_1438 | 304 |
| 125 | 3300035724 | Ga0373933_0012679 | Ga0373933_0012679_907_1833 | 304 |
| 126 | 3300036401 | Ga0373937_0008943 | Ga0373937_0008943_3255_4181 | 304 |
| 127 | 3300044694 | Ga0466963_0043648 | Ga0466963_0043648_1371_2324 | 304 |
| 128 | 3300046459 | Ga0495629_0248380 | Ga0495629_0248380_118_1044 | 304 |
| 129 | 3300046472 | Ga0495580_0075624 | Ga0495580_0075624_793_1719 | 304 |
| 130 | 3300046476 | Ga0495662_0037562 | Ga0495662_0037562_1284_2210 | 304 |
| 131 | 3300046516 | Ga0495628_0043076 | Ga0495628_0043076_68_994 | 304 |
| 132 | 3300046531 | Ga0495665_0046024 | Ga0495665_0046024_617_1543 | 304 |
| 133 | 3300046533 | Ga0495640_0178805 | Ga0495640_0178805_403_1329 | 304 |
| 134 | 3300046535 | Ga0495586_0087111 | Ga0495586_0087111_576_1502 | 304 |
| 135 | 3300046663 | Ga0495635_0020156 | Ga0495635_0020156_3134_4060 | 304 |
| 136 | 3300046679 | Ga0495623_0071911 | Ga0495623_0071911_267_1193 | 304 |
| 137 | 3300047317 | Ga0495604_0019201 | Ga0495604_0019201_2441_3367 | 304 |
| 138 | 3300048904 | Ga0496101_0021373 | Ga0496101_0021373_3111_4037 | 304 |
| 139 | 3300048907 | Ga0496104_0026529 | Ga0496104_0026529_4045_4971 | 304 |
| 140 | 3300048908 | Ga0496105_0066023 | Ga0496105_0066023_1950_2876 | 304 |
| 141 | 3300048909 | Ga0496106_0208555 | Ga0496106_0208555_79_1005 | 304 |
| 142 | 3300048911 | Ga0496108_0165450 | Ga0496108_0165450_882_1808 | 304 |
| 143 | 3300048912 | Ga0496109_0063321 | Ga0496109_0063321_105_1031 | 304 |
| 144 | 3300048915 | Ga0496112_0004738 | Ga0496112_0004738_4244_5170 | 304 |
| 145 | 3300048917 | Ga0496114_0021772 | Ga0496114_0021772_157_1083 | 304 |
| 146 | 3300048918 | Ga0496115_0113632 | Ga0496115_0113632_991_1917 | 304 |
| 147 | 3300053084 | Ga0495595_0059851 | Ga0495595_0059851_490_1416 | 304 |
| 148 | 3300053085 | Ga0495619_0155976 | Ga0495619_0155976_93_1019 | 304 |
| 149 | 3300005344 | Ga0070661_100311464 | Ga0070661_1003114642 | 305 |
| 150 | 3300005355 | Ga0070671_100139598 | Ga0070671_1001395982 | 305 |
| 151 | 3300025920 | Ga0207649_10265763 | Ga0207649_102657632 | 305 |
| 152 | 3300026067 | Ga0207678_10128348 | Ga0207678_101283481 | 305 |
| 153 | 3300028379 | Ga0268266_10471993 | Ga0268266_104719931 | 305 |
| 154 | 3300030522 | Ga0307512_10002822 | Ga0307512_100028228 | 306 |
| 155 | 3300030522 | Ga0307512_10017252 | Ga0307512_100172522 | 306 |
| 156 | 3300031456 | Ga0307513_10065765 | Ga0307513_100657652 | 306 |
| 157 | 3300031507 | Ga0307509_10003240 | Ga0307509_1000324014 | 306 |
| 158 | 3300033180 | Ga0307510_10134249 | Ga0307510_101342493 | 306 |
| 159 | 3300005334 | Ga0068869_100169048 | Ga0068869_1001690483 | 307 |
| 160 | 3300005564 | Ga0070664_100034296 | Ga0070664_1000342965 | 307 |
| 161 | 3300025939 | Ga0207665_10194038 | Ga0207665_101940382 | 307 |
| 162 | 3300025945 | Ga0207679_10030228 | Ga0207679_100302284 | 307 |
| 163 | 3300031240 | Ga0265320_10012678 | Ga0265320_100126785 | 307 |
| 164 | 3300035241 | Ga0373961_0010085 | Ga0373961_0010085_1299_2231 | 307 |
| 165 | 3300048915 | Ga0496112_0137131 | Ga0496112_0137131_128_1063 | 307 |
| 166 | 3300005456 | Ga0070678_100093931 | Ga0070678_1000939313 | 308 |
| 167 | 3300006358 | Ga0068871_100016743 | Ga0068871_1000167432 | 308 |
| 168 | 3300007265 | Ga0099794_10004592 | Ga0099794_100045925 | 308 |
| 169 | 3300007265 | Ga0099794_10060655 | Ga0099794_100606551 | 308 |
| 170 | 3300025940 | Ga0207691_10060486 | Ga0207691_100604862 | 308 |
| 171 | 3300025972 | Ga0207668_10046654 | Ga0207668_100466542 | 308 |
| 172 | 3300026121 | Ga0207683_10100390 | Ga0207683_101003902 | 308 |
| 173 | 3300028794 | Ga0307515_10091130 | Ga0307515_100911303 | 308 |
| 174 | 3300031616 | Ga0307508_10019986 | Ga0307508_100199862 | 308 |
| 175 | 3300053090 | Ga0500646_0008591 | Ga0500646_0008591_148_1083 | 308 |
| 176 | 3300005337 | Ga0070682_100013380 | Ga0070682_1000133802 | 309 |
| 177 | 3300005343 | Ga0070687_100081086 | Ga0070687_1000810862 | 309 |
| 178 | 3300005365 | Ga0070688_100044079 | Ga0070688_1000440793 | 309 |
| 179 | 3300005367 | Ga0070667_100543174 | Ga0070667_1005431741 | 309 |
| 180 | 3300005439 | Ga0070711_100036133 | Ga0070711_1000361331 | 309 |
| 181 | 3300005441 | Ga0070700_100253923 | Ga0070700_1002539231 | 309 |
| 182 | 3300005444 | Ga0070694_100014651 | Ga0070694_1000146514 | 309 |
| 183 | 3300005445 | Ga0070708_100000634 | Ga0070708_1000006345 | 309 |
| 184 | 3300005456 | Ga0070678_100321999 | Ga0070678_1003219991 | 309 |
| 185 | 3300005457 | Ga0070662_100206619 | Ga0070662_1002066191 | 309 |
| 186 | 3300005467 | Ga0070706_100000079 | Ga0070706_10000007940 | 309 |
| 187 | 3300005467 | Ga0070706_100114601 | Ga0070706_1001146012 | 309 |
| 188 | 3300005518 | Ga0070699_100078144 | Ga0070699_1000781442 | 309 |
| 189 | 3300005518 | Ga0070699_100226370 | Ga0070699_1002263702 | 309 |
| 190 | 3300005530 | Ga0070679_100038692 | Ga0070679_1000386926 | 309 |
| 191 | 3300005545 | Ga0070695_100000748 | Ga0070695_10000074817 | 309 |
| 192 | 3300005578 | Ga0068854_100125443 | Ga0068854_1001254431 | 309 |
| 193 | 3300005614 | Ga0068856_100276118 | Ga0068856_1002761182 | 309 |
| 194 | 3300005615 | Ga0070702_100175115 | Ga0070702_1001751151 | 309 |
| 195 | 3300005616 | Ga0068852_100495881 | Ga0068852_1004958812 | 309 |
| 196 | 3300005842 | Ga0068858_100470381 | Ga0068858_1004703812 | 309 |
| 197 | 3300009148 | Ga0105243_10219679 | Ga0105243_102196791 | 309 |
| 198 | 3300009553 | Ga0105249_10097712 | Ga0105249_100977123 | 309 |
| 199 | 3300013296 | Ga0157374_10105484 | Ga0157374_101054842 | 309 |
| 200 | 3300013308 | Ga0157375_10106790 | Ga0157375_101067902 | 309 |
| 201 | 3300013308 | Ga0157375_10138974 | Ga0157375_101389742 | 309 |
| 202 | 3300014968 | Ga0157379_10101177 | Ga0157379_101011772 | 309 |
| 203 | 3300025898 | Ga0207692_10233903 | Ga0207692_102339031 | 309 |
| 204 | 3300025901 | Ga0207688_10010417 | Ga0207688_100104175 | 309 |
| 205 | 3300025910 | Ga0207684_10000068 | Ga0207684_10000068138 | 309 |
| 206 | 3300025910 | Ga0207684_10100733 | Ga0207684_101007332 | 309 |
| 207 | 3300025912 | Ga0207707_10157711 | Ga0207707_101577112 | 309 |
| 208 | 3300025916 | Ga0207663_10027596 | Ga0207663_100275961 | 309 |
| 209 | 3300025918 | Ga0207662_10021359 | Ga0207662_100213593 | 309 |
| 210 | 3300025919 | Ga0207657_10196833 | Ga0207657_101968332 | 309 |
| 211 | 3300025933 | Ga0207706_10098246 | Ga0207706_100982462 | 309 |
| 212 | 3300025936 | Ga0207670_10016815 | Ga0207670_100168152 | 309 |
| 213 | 3300025941 | Ga0207711_10070106 | Ga0207711_100701062 | 309 |
| 214 | 3300025942 | Ga0207689_10097671 | Ga0207689_100976712 | 309 |
| 215 | 3300026035 | Ga0207703_10270209 | Ga0207703_102702092 | 309 |
| 216 | 3300026078 | Ga0207702_10100335 | Ga0207702_101003352 | 309 |
| 217 | 3300026078 | Ga0207702_10267382 | Ga0207702_102673822 | 309 |
| 218 | 3300026121 | Ga0207683_10094364 | Ga0207683_100943643 | 309 |
| 219 | 3300042876 | Ga0451577_0253262 | Ga0451577_0253262_272_1231 | 309 |
| 220 | 3300048911 | Ga0496108_0115216 | Ga0496108_0115216_41_1027 | 309 |
| 221 | 3300048913 | Ga0496110_0251251 | Ga0496110_0251251_392_1378 | 309 |
| 222 | 3300049576 | Ga0501040_0226017 | Ga0501040_0226017_159_1094 | 309 |
| 223 | 3300049578 | Ga0501042_0105874 | Ga0501042_0105874_468_1403 | 309 |
| 224 | 3300049587 | Ga0501071_0155295 | Ga0501071_0155295_137_1072 | 309 |
| 225 | 3300049588 | Ga0501072_0084864 | Ga0501072_0084864_280_1215 | 309 |
| 226 | 3300049592 | Ga0501076_0070780 | Ga0501076_0070780_587_1522 | 309 |
| 227 | 3300049743 | Ga0501081_0118764 | Ga0501081_0118764_26_961 | 309 |
| 228 | 3300049824 | Ga0501045_0234112 | Ga0501045_0234112_216_1151 | 309 |
| 229 | 3300061734 | Ga0530510_0053156 | Ga0530510_0053156_721_1656 | 309 |
| 230 | 3300005329 | Ga0070683_100100668 | Ga0070683_1001006682 | 310 |
| 231 | 3300005335 | Ga0070666_10110446 | Ga0070666_101104462 | 310 |
| 232 | 3300005337 | Ga0070682_100044363 | Ga0070682_1000443631 | 310 |
| 233 | 3300005339 | Ga0070660_100002845 | Ga0070660_1000028457 | 310 |
| 234 | 3300005344 | Ga0070661_100005435 | Ga0070661_1000054352 | 310 |
| 235 | 3300005347 | Ga0070668_100081937 | Ga0070668_1000819373 | 310 |
| 236 | 3300005353 | Ga0070669_100048718 | Ga0070669_1000487182 | 310 |
| 237 | 3300005354 | Ga0070675_100463244 | Ga0070675_1004632441 | 310 |
| 238 | 3300005355 | Ga0070671_100024010 | Ga0070671_1000240104 | 310 |
| 239 | 3300005364 | Ga0070673_100017867 | Ga0070673_1000178674 | 310 |
| 240 | 3300005366 | Ga0070659_100000175 | Ga0070659_10000017537 | 310 |
| 241 | 3300005367 | Ga0070667_100143212 | Ga0070667_1001432122 | 310 |
| 242 | 3300005445 | Ga0070708_100003217 | Ga0070708_1000032176 | 310 |
| 243 | 3300005445 | Ga0070708_100493642 | Ga0070708_1004936421 | 310 |
| 244 | 3300005455 | Ga0070663_100002915 | Ga0070663_1000029152 | 310 |
| 245 | 3300005457 | Ga0070662_100000169 | Ga0070662_10000016922 | 310 |
| 246 | 3300005458 | Ga0070681_10187737 | Ga0070681_101877372 | 310 |
| 247 | 3300005467 | Ga0070706_100301833 | Ga0070706_1003018332 | 310 |
| 248 | 3300005536 | Ga0070697_100004101 | Ga0070697_1000041013 | 310 |
| 249 | 3300005539 | Ga0068853_100009887 | Ga0068853_1000098872 | 310 |
| 250 | 3300005563 | Ga0068855_100000588 | Ga0068855_10000058835 | 310 |
| 251 | 3300005564 | Ga0070664_100003854 | Ga0070664_1000038547 | 310 |
| 252 | 3300005564 | Ga0070664_100053299 | Ga0070664_1000532993 | 310 |
| 253 | 3300005578 | Ga0068854_100107146 | Ga0068854_1001071462 | 310 |
| 254 | 3300005614 | Ga0068856_100000557 | Ga0068856_1000005579 | 310 |
| 255 | 3300005981 | Ga0081538_10003311 | Ga0081538_100033116 | 310 |
| 256 | 3300005981 | Ga0081538_10004627 | Ga0081538_1000462710 | 310 |
| 257 | 3300005981 | Ga0081538_10030373 | Ga0081538_100303734 | 310 |
| 258 | 3300006048 | Ga0075363_100163438 | Ga0075363_1001634382 | 310 |
| 259 | 3300009098 | Ga0105245_10033691 | Ga0105245_100336914 | 310 |
| 260 | 3300009545 | Ga0105237_10175823 | Ga0105237_101758232 | 310 |
| 261 | 3300013100 | Ga0157373_10006502 | Ga0157373_100065024 | 310 |
| 262 | 3300013102 | Ga0157371_10003810 | Ga0157371_1000381010 | 310 |
| 263 | 3300013104 | Ga0157370_10037237 | Ga0157370_100372374 | 310 |
| 264 | 3300013105 | Ga0157369_10054951 | Ga0157369_100549512 | 310 |
| 265 | 3300013307 | Ga0157372_10015179 | Ga0157372_100151793 | 310 |
| 266 | 3300014325 | Ga0163163_10107437 | Ga0163163_101074372 | 310 |
| 267 | 3300025903 | Ga0207680_10072217 | Ga0207680_100722173 | 310 |
| 268 | 3300025910 | Ga0207684_10240748 | Ga0207684_102407482 | 310 |
| 269 | 3300025912 | Ga0207707_10137645 | Ga0207707_101376452 | 310 |
| 270 | 3300025919 | Ga0207657_10000540 | Ga0207657_1000054016 | 310 |
| 271 | 3300025920 | Ga0207649_10003134 | Ga0207649_100031344 | 310 |
| 272 | 3300025923 | Ga0207681_10039190 | Ga0207681_100391902 | 310 |
| 273 | 3300025925 | Ga0207650_10109775 | Ga0207650_101097752 | 310 |
| 274 | 3300025931 | Ga0207644_10028807 | Ga0207644_100288072 | 310 |
| 275 | 3300025932 | Ga0207690_10000388 | Ga0207690_1000038814 | 310 |
| 276 | 3300025933 | Ga0207706_10000550 | Ga0207706_1000055014 | 310 |
| 277 | 3300025940 | Ga0207691_10013633 | Ga0207691_100136338 | 310 |
| 278 | 3300025945 | Ga0207679_10002903 | Ga0207679_100029036 | 310 |
| 279 | 3300025949 | Ga0207667_10001137 | Ga0207667_100011375 | 310 |
| 280 | 3300025960 | Ga0207651_10007157 | Ga0207651_100071575 | 310 |
| 281 | 3300025972 | Ga0207668_10038262 | Ga0207668_100382623 | 310 |
| 282 | 3300025986 | Ga0207658_10095153 | Ga0207658_100951532 | 310 |
| 283 | 3300026041 | Ga0207639_10044253 | Ga0207639_100442533 | 310 |
| 284 | 3300026067 | Ga0207678_10028294 | Ga0207678_100282945 | 310 |
| 285 | 3300026067 | Ga0207678_10085525 | Ga0207678_100855252 | 310 |
| 286 | 3300026078 | Ga0207702_10001785 | Ga0207702_1000178520 | 310 |
| 287 | 3300026116 | Ga0207674_10081779 | Ga0207674_100817792 | 310 |
| 288 | 3300035691 | Ga0373931_0175802 | Ga0373931_0175802_29_1027 | 310 |
| 289 | 3300044656 | Ga0466969_0002498 | Ga0466969_0002498_4411_5343 | 310 |
| 290 | 3300044684 | Ga0466966_0033745 | Ga0466966_0033745_59_991 | 310 |
| 291 | 3300044693 | Ga0466961_0006136 | Ga0466961_0006136_4343_5275 | 310 |
| 292 | 3300044765 | Ga0466970_0013253 | Ga0466970_0013253_2948_3880 | 310 |
| 293 | 3300045049 | Ga0466959_0030620 | Ga0466959_0030620_761_1693 | 310 |
| 294 | 3300048905 | Ga0496102_0013562 | Ga0496102_0013562_2441_3439 | 310 |
| 295 | 3300048906 | Ga0496103_0029762 | Ga0496103_0029762_1234_2232 | 310 |
| 296 | 3300048906 | Ga0496103_0246597 | Ga0496103_0246597_121_1071 | 310 |
| 297 | 3300048910 | Ga0496107_0001667 | Ga0496107_0001667_4837_5835 | 310 |
| 298 | 3300050492 | nmdc:mga0yw44_297259_c1 | nmdc:mga0yw44_297259_c1_110_1060 | 310 |
| 299 | 3300005445 | Ga0070708_100079554 | Ga0070708_1000795542 | 311 |
| 300 | 3300005468 | Ga0070707_100000029 | Ga0070707_10000002947 | 311 |
| 301 | 3300005471 | Ga0070698_100212965 | Ga0070698_1002129652 | 311 |
| 302 | 3300005518 | Ga0070699_100411839 | Ga0070699_1004118392 | 311 |
| 303 | 3300005530 | Ga0070679_100136382 | Ga0070679_1001363822 | 311 |
| 304 | 3300005535 | Ga0070684_100041077 | Ga0070684_1000410772 | 311 |
| 305 | 3300005536 | Ga0070697_100000003 | Ga0070697_10000000391 | 311 |
| 306 | 3300005937 | Ga0081455_10009202 | Ga0081455_1000920211 | 311 |
| 307 | 3300005981 | Ga0081538_10005362 | Ga0081538_100053621 | 311 |
| 308 | 3300010159 | Ga0099796_10000339 | Ga0099796_100003395 | 311 |
| 309 | 3300025912 | Ga0207707_10174981 | Ga0207707_101749811 | 311 |
| 310 | 3300025921 | Ga0207652_10063999 | Ga0207652_100639994 | 311 |
| 311 | 3300025922 | Ga0207646_10000142 | Ga0207646_1000014280 | 311 |
| 312 | 3300025922 | Ga0207646_10002399 | Ga0207646_100023998 | 311 |
| 313 | 3300025944 | Ga0207661_10213686 | Ga0207661_102136862 | 311 |
| 314 | 3300026075 | Ga0207708_10073386 | Ga0207708_100733862 | 311 |
| 315 | 3300027671 | Ga0209588_1000009 | Ga0209588_100000943 | 311 |
| 316 | 3300031456 | Ga0307513_10000535 | Ga0307513_1000053513 | 311 |
| 317 | 3300031456 | Ga0307513_10239397 | Ga0307513_102393972 | 311 |
| 318 | 3300036401 | Ga0373937_0324902 | Ga0373937_0324902_275_1285 | 311 |
| 319 | 3300039438 | Ga0436360_0323091 | Ga0436360_0323091_101_1063 | 311 |
| 320 | 3300046529 | Ga0495652_0155878 | Ga0495652_0155878_353_1363 | 311 |
| 321 | 3300048910 | Ga0496107_0041559 | Ga0496107_0041559_745_1746 | 311 |
| 322 | 3300048911 | Ga0496108_0011707 | Ga0496108_0011707_4319_5320 | 311 |
| 323 | 3300048915 | Ga0496112_0357227 | Ga0496112_0357227_239_1207 | 311 |
| 324 | 3300048916 | Ga0496113_0061728 | Ga0496113_0061728_986_1987 | 311 |
| 325 | 3300048917 | Ga0496114_0251333 | Ga0496114_0251333_406_1353 | 311 |
| 326 | 3300049575 | Ga0501039_0127174 | Ga0501039_0127174_848_1804 | 311 |
| 327 | 3300005328 | Ga0070676_10001102 | Ga0070676_100011022 | 312 |
| 328 | 3300005331 | Ga0070670_100113803 | Ga0070670_1001138031 | 312 |
| 329 | 3300005334 | Ga0068869_100000152 | Ga0068869_1000001525 | 312 |
| 330 | 3300005340 | Ga0070689_100093122 | Ga0070689_1000931222 | 312 |
| 331 | 3300005347 | Ga0070668_100010033 | Ga0070668_1000100339 | 312 |
| 332 | 3300005353 | Ga0070669_100033681 | Ga0070669_1000336813 | 312 |
| 333 | 3300005366 | Ga0070659_100328095 | Ga0070659_1003280952 | 312 |
| 334 | 3300005367 | Ga0070667_100002820 | Ga0070667_10000282015 | 312 |
| 335 | 3300005459 | Ga0068867_100003325 | Ga0068867_10000332511 | 312 |
| 336 | 3300005543 | Ga0070672_100179680 | Ga0070672_1001796802 | 312 |
| 337 | 3300005546 | Ga0070696_100063867 | Ga0070696_1000638672 | 312 |
| 338 | 3300005577 | Ga0068857_100101047 | Ga0068857_1001010472 | 312 |
| 339 | 3300005617 | Ga0068859_100005705 | Ga0068859_1000057055 | 312 |
| 340 | 3300005618 | Ga0068864_100003353 | Ga0068864_10000335315 | 312 |
| 341 | 3300005840 | Ga0068870_10125175 | Ga0068870_101251752 | 312 |
| 342 | 3300006852 | Ga0075433_10445040 | Ga0075433_104450401 | 312 |
| 343 | 3300006881 | Ga0068865_100047473 | Ga0068865_1000474734 | 312 |
| 344 | 3300006931 | Ga0097620_100005705 | Ga0097620_1000057055 | 312 |
| 345 | 3300009177 | Ga0105248_10044872 | Ga0105248_100448724 | 312 |
| 346 | 3300013297 | Ga0157378_10115479 | Ga0157378_101154792 | 312 |
| 347 | 3300014325 | Ga0163163_10013243 | Ga0163163_100132436 | 312 |
| 348 | 3300014968 | Ga0157379_10004248 | Ga0157379_100042483 | 312 |
| 349 | 3300025903 | Ga0207680_10080641 | Ga0207680_100806412 | 312 |
| 350 | 3300025907 | Ga0207645_10003431 | Ga0207645_100034312 | 312 |
| 351 | 3300025908 | Ga0207643_10057427 | Ga0207643_100574272 | 312 |
| 352 | 3300025921 | Ga0207652_10362134 | Ga0207652_103621342 | 312 |
| 353 | 3300025923 | Ga0207681_10046910 | Ga0207681_100469103 | 312 |
| 354 | 3300025925 | Ga0207650_10088944 | Ga0207650_100889441 | 312 |
| 355 | 3300025936 | Ga0207670_10098810 | Ga0207670_100988102 | 312 |
| 356 | 3300025938 | Ga0207704_10050354 | Ga0207704_100503542 | 312 |
| 357 | 3300025940 | Ga0207691_10157392 | Ga0207691_101573922 | 312 |
| 358 | 3300025941 | Ga0207711_10114110 | Ga0207711_101141103 | 312 |
| 359 | 3300025942 | Ga0207689_10015529 | Ga0207689_100155293 | 312 |
| 360 | 3300025986 | Ga0207658_10069978 | Ga0207658_100699782 | 312 |
| 361 | 3300026035 | Ga0207703_10011474 | Ga0207703_100114742 | 312 |
| 362 | 3300026041 | Ga0207639_10181439 | Ga0207639_101814392 | 312 |
| 363 | 3300026089 | Ga0207648_10001002 | Ga0207648_1000100228 | 312 |
| 364 | 3300026095 | Ga0207676_10036349 | Ga0207676_100363493 | 312 |
| 365 | 3300026116 | Ga0207674_10023672 | Ga0207674_100236722 | 312 |
| 366 | 3300026118 | Ga0207675_100001191 | Ga0207675_1000011917 | 312 |
| 367 | 3300028380 | Ga0268265_10049406 | Ga0268265_100494063 | 312 |
| 368 | 3300028381 | Ga0268264_10000854 | Ga0268264_100008542 | 312 |
| 369 | 3300039453 | Ga0436362_1093284 | Ga0436362_1093284_218_1189 | 312 |
| 370 | 3300048911 | Ga0496108_0021136 | Ga0496108_0021136_2269_3237 | 312 |
| 371 | 3300050515 | nmdc:mga0a205_411535_c1 | nmdc:mga0a205_411535_c1_73_1041 | 312 |
| 372 | 3300005327 | Ga0070658_10000129 | Ga0070658_1000012947 | 313 |
| 373 | 3300005337 | Ga0070682_100133882 | Ga0070682_1001338821 | 313 |
| 374 | 3300005339 | Ga0070660_100227293 | Ga0070660_1002272932 | 313 |
| 375 | 3300005366 | Ga0070659_100087243 | Ga0070659_1000872432 | 313 |
| 376 | 3300006173 | Ga0070716_100141204 | Ga0070716_1001412041 | 313 |
| 377 | 3300013104 | Ga0157370_10030168 | Ga0157370_100301683 | 313 |
| 378 | 3300025904 | Ga0207647_10050917 | Ga0207647_100509172 | 313 |
| 379 | 3300025909 | Ga0207705_10000001 | Ga0207705_10000001929 | 313 |
| 380 | 3300025932 | Ga0207690_10151669 | Ga0207690_101516692 | 313 |
| 381 | 3300025939 | Ga0207665_10239258 | Ga0207665_102392582 | 313 |
| 382 | 3300026067 | Ga0207678_10044240 | Ga0207678_100442404 | 313 |
| 383 | 3300031995 | Ga0307409_100104891 | Ga0307409_1001048912 | 313 |
| 384 | 3300032005 | Ga0307411_10089407 | Ga0307411_100894071 | 313 |
| 385 | 3300049768 | Ga0501271_004885 | Ga0501271_004885_250_1227 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF14833
NAD_binding_11
NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
185
304
0.96
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dll-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9286 | 8 | 295 |
| 4dll-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9224 | 8 | 295 |
| 4dll-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.922 | 7 | 292 |
| 1vpd-assembly1.cif.gz_A | x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] | 0.9202 | 8 | 299 |
| 3doj-assembly1.cif.gz_A | structure of glyoxylate reductase 1 from arabidopsis (atglyr1) | 0.9188 | 8 | 290 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3pefB02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9604 | 175 | 290 | 1.10.1040.10 |
| 3pduA02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.954 | 175 | 289 | 1.10.1040.10 |
| af_Q8T079_480_601_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9497 | 175 | 288 | 1.10.1040.10 |
| 4dllA02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9467 | 166 | 292 | 1.10.1040.10 |
| af_P77161_159_292_1.10.1040.10 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9466 | 166 | 296 | 1.10.1040.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535BFU4-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9895 | 15 | 121 |
GO:0050661
|
| AF-A0A6L8I436-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9856 | 5 | 93 |
GO:0050661
|
| AF-A0A536VG48-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9807 | 17 | 186 |
GO:0050661
|
| AF-A0A535BFU4-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9715 | 15 | 121 |
GO:0050661
|
| AF-A0A536VG48-F1-model_v4 | NAD(P)-dependent oxidoreductase | 0.9695 | 17 | 186 |
GO:0050661
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar