F430167

General Info

Members Datasets Scaffolds Average Seq Length
385 236 385 317

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100016743|Ga0068871_1000167432
Length 326
Sequence LPTRTDSSPRAPQGGNGTGPNHLSDSIGWIGTGRMGIEMAAHLAKGGADVLAWNRTKAKAEPLQKYGAKVAGGLPELAARDIVFCMVSTWDDVKEVVTRMLDGAKKVPRILIECSSISLEGSAELRQMLAARGIEYLAAPVSGNAKVIKAGRLSFVCSGPKKAFDEALPYLEMIGPSASYVGEGELARIVKICHNVFLGVVTQSLAEITVLAEKAGVPRHAFLDFMNQSVMGSTFTRYKTPAFVNLDFKVTFTPALLRKDLDLGLDAGKRFEVPMPLASATRDLIQAMMGRGWTGQDFATLLLQQAQASGVELAPENVEVSDGLSK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
160 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 5.71
Rhizosphere 90.39
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000129 3300005327 Bacteria 67266
2 Ga0070676_10001102 3300005328 Bacteria 13494
3 Ga0070683_100100668 3300005329 Bacteria 2720
4 Ga0070683_100247916 3300005329 Bacteria 1694
5 Ga0070690_100049317 3300005330 Bacteria 2683
6 Ga0070670_100113803 3300005331 Bacteria 2332
7 Ga0068869_100000152 3300005334 Bacteria 34316
8 Ga0068869_100169048 3300005334 Bacteria 1707
9 Ga0070666_10013311 3300005335 Bacteria 5216
10 Ga0070666_10110446 3300005335 Bacteria 1901
11 Ga0070680_100023972 3300005336 Bacteria 4871
12 Ga0070682_100013380 3300005337 Bacteria 4718
13 Ga0070682_100044363 3300005337 Bacteria 2753
14 Ga0070682_100133882 3300005337 Bacteria 1681
15 Ga0068868_100007194 3300005338 Bacteria 7908
16 Ga0070660_100002845 3300005339 Bacteria 11916
17 Ga0070660_100110170 3300005339 Bacteria 2189
18 Ga0070660_100118792 3300005339 Bacteria 2108
19 Ga0070660_100227293 3300005339 Bacteria 1518
20 Ga0070689_100064087 3300005340 Bacteria 2860
21 Ga0070689_100093122 3300005340 Bacteria 2378
22 Ga0070691_10135033 3300005341 Bacteria 1253
23 Ga0070687_100017489 3300005343 Bacteria 3298
24 Ga0070687_100081086 3300005343 Bacteria 1770
25 Ga0070661_100005435 3300005344 Bacteria 8782
26 Ga0070661_100056667 3300005344 Bacteria 2871
27 Ga0070661_100311464 3300005344 Bacteria 1227
28 Ga0070692_10064046 3300005345 Bacteria 1943
29 Ga0070668_100010033 3300005347 Bacteria 7018
30 Ga0070668_100081937 3300005347 Bacteria 2530
31 Ga0070669_100033681 3300005353 Bacteria 3706
32 Ga0070669_100048718 3300005353 Bacteria 3093
33 Ga0070675_100463244 3300005354 Unclassified 1138
34 Ga0070671_100024010 3300005355 Bacteria 4990
35 Ga0070671_100139598 3300005355 Bacteria 2045
36 Ga0070674_100011207 3300005356 Bacteria 5449
37 Ga0070673_100000318 3300005364 Bacteria 25352
38 Ga0070673_100017867 3300005364 Bacteria 5054
39 Ga0070688_100005468 3300005365 Bacteria 6694
40 Ga0070688_100044079 3300005365 Bacteria 2751
41 Ga0070659_100000175 3300005366 Bacteria 49114
42 Ga0070659_100087243 3300005366 Bacteria 2498
43 Ga0070659_100328095 3300005366 Bacteria 1280
44 Ga0070667_100002820 3300005367 Bacteria 14999
45 Ga0070667_100143212 3300005367 Bacteria 2095
46 Ga0070667_100543174 3300005367 Bacteria 1068
47 Ga0070713_100020208 3300005436 Bacteria 5100
48 Ga0070713_100075358 3300005436 Bacteria 2861
49 Ga0070710_10010777 3300005437 Bacteria 4497
50 Ga0070710_10018350 3300005437 Bacteria 3598
51 Ga0070711_100000746 3300005439 Bacteria 16984
52 Ga0070711_100036133 3300005439 Bacteria 3309
53 Ga0070700_100253923 3300005441 Bacteria 1263
54 Ga0070694_100014651 3300005444 Bacteria 4911
55 Ga0070708_100000634 3300005445 Bacteria 26540
56 Ga0070708_100003217 3300005445 Bacteria 12740
57 Ga0070708_100079554 3300005445 Unclassified 2966
58 Ga0070708_100493642 3300005445 Bacteria 1155
59 Ga0070663_100002915 3300005455 Bacteria 9730
60 Ga0070678_100093931 3300005456 Bacteria 2307
61 Ga0070678_100321999 3300005456 Bacteria 1320
62 Ga0070662_100000169 3300005457 Bacteria 37987
63 Ga0070662_100019152 3300005457 Bacteria 4643
64 Ga0070662_100075219 3300005457 Bacteria 2501
65 Ga0070662_100206619 3300005457 Bacteria 1561
66 Ga0070681_10187737 3300005458 Bacteria 1987
67 Ga0070681_10300163 3300005458 Bacteria 1516
68 Ga0068867_100003325 3300005459 Bacteria 11316
69 Ga0068867_100137577 3300005459 Bacteria 1906
70 Ga0070685_10021068 3300005466 Bacteria 3539
71 Ga0070706_100000079 3300005467 Bacteria 111752
72 Ga0070706_100114601 3300005467 Bacteria 2510
73 Ga0070706_100301833 3300005467 Bacteria 1494
74 Ga0070707_100000029 3300005468 Bacteria 123116
75 Ga0070707_100570761 3300005468 Bacteria 1093
76 Ga0070698_100212965 3300005471 Bacteria 1866
77 Ga0070699_100078144 3300005518 Bacteria 2882
78 Ga0070699_100226370 3300005518 Bacteria 1667
79 Ga0070699_100411839 3300005518 Bacteria 1223
80 Ga0070679_100038692 3300005530 Bacteria 4742
81 Ga0070679_100080182 3300005530 Bacteria 3253
82 Ga0070679_100136382 3300005530 Bacteria 2435
83 Ga0070679_100269019 3300005530 Bacteria 1659
84 Ga0070684_100041077 3300005535 Bacteria 3986
85 Ga0070697_100000003 3300005536 Bacteria 322584
86 Ga0070697_100004101 3300005536 Bacteria 11163
87 Ga0070697_100124154 3300005536 Bacteria 2162
88 Ga0068853_100009887 3300005539 Bacteria 7699
89 Ga0070672_100179680 3300005543 Bacteria 1763
90 Ga0070686_100016450 3300005544 Bacteria 4303
91 Ga0070695_100000748 3300005545 Bacteria 17404
92 Ga0070696_100063867 3300005546 Bacteria 2580
93 Ga0070665_100001983 3300005548 Bacteria 23038
94 Ga0068855_100000588 3300005563 Bacteria 44619
95 Ga0068855_100040640 3300005563 Bacteria 5519
96 Ga0070664_100003854 3300005564 Bacteria 12107
97 Ga0070664_100034296 3300005564 Bacteria 4257
98 Ga0070664_100053299 3300005564 Bacteria 3428
99 Ga0070664_100108171 3300005564 Bacteria 2424
100 Ga0068857_100101047 3300005577 Bacteria 2588
101 Ga0068854_100055092 3300005578 Bacteria 2861
102 Ga0068854_100107146 3300005578 Bacteria 2103
103 Ga0068854_100125443 3300005578 Bacteria 1954
104 Ga0068856_100000557 3300005614 Bacteria 41004
105 Ga0068856_100276118 3300005614 Bacteria 1697
106 Ga0070702_100022440 3300005615 Bacteria 3337
107 Ga0070702_100175115 3300005615 Bacteria 1399
108 Ga0068852_100116969 3300005616 Bacteria 2433
109 Ga0068852_100180722 3300005616 Bacteria 1983
110 Ga0068852_100495881 3300005616 Bacteria 1215
111 Ga0068859_100000518 3300005617 Bacteria 38274
112 Ga0068859_100005705 3300005617 Bacteria 12664
113 Ga0068864_100002217 3300005618 Bacteria 16051
114 Ga0068864_100003353 3300005618 Bacteria 13243
115 Ga0068866_10007746 3300005718 Bacteria 4505
116 Ga0068870_10125175 3300005840 Bacteria 1485
117 Ga0068863_100003085 3300005841 Bacteria 16466
118 Ga0068863_100080146 3300005841 Bacteria 3092
119 Ga0068858_100002551 3300005842 Bacteria 18373
120 Ga0068858_100470381 3300005842 Bacteria 1212
121 Ga0081455_10009202 3300005937 Bacteria 10177
122 Ga0081538_10003311 3300005981 Bacteria 15275
123 Ga0081538_10004627 3300005981 Bacteria 12629
124 Ga0081538_10005362 3300005981 Bacteria 11522
125 Ga0081538_10030373 3300005981 Bacteria 3671
126 Ga0075363_100163438 3300006048 Bacteria 1261
127 Ga0070716_100001080 3300006173 Bacteria 11954
128 Ga0070716_100141204 3300006173 Unclassified 1536
129 Ga0070712_100001121 3300006175 Bacteria 16131
130 Ga0070712_100025086 3300006175 Bacteria 3958
131 Ga0068871_100016743 3300006358 Bacteria 5531
132 Ga0068871_100105338 3300006358 Bacteria 2366
133 Ga0075433_10445040 3300006852 Bacteria 1142
134 Ga0068865_100047473 3300006881 Bacteria 2951
135 Ga0097620_100000518 3300006931 Bacteria 38274
136 Ga0097620_100005705 3300006931 Bacteria 12664
137 Ga0075435_100229844 3300007076 Bacteria 1576
138 Ga0099794_10000104 3300007265 Bacteria 31247
139 Ga0099794_10004592 3300007265 Bacteria 5448
140 Ga0099794_10004955 3300007265 Bacteria 5296
141 Ga0099794_10060655 3300007265 Bacteria 1837
142 Ga0105240_10002070 3300009093 Bacteria 32876
143 Ga0105245_10002153 3300009098 Bacteria 17852
144 Ga0105245_10033691 3300009098 Bacteria 4540
145 Ga0114129_10378972 3300009147 Bacteria 1869
146 Ga0105243_10219679 3300009148 Bacteria 1679
147 Ga0105241_10199876 3300009174 Bacteria 1669
148 Ga0105242_10009346 3300009176 Bacteria 7525
149 Ga0105242_10075818 3300009176 Bacteria 2801
150 Ga0105248_10006278 3300009177 Bacteria 13037
151 Ga0105248_10044872 3300009177 Bacteria 4957
152 Ga0105237_10175823 3300009545 Bacteria 2141
153 Ga0105249_10097712 3300009553 Bacteria 2757
154 Ga0099796_10000339 3300010159 Bacteria 7576
155 Ga0157373_10006502 3300013100 Bacteria 8719
156 Ga0157371_10003810 3300013102 Bacteria 13486
157 Ga0157370_10030168 3300013104 Bacteria 5315
158 Ga0157370_10037237 3300013104 Bacteria 4716
159 Ga0157369_10054951 3300013105 Bacteria 4299
160 Ga0157374_10000601 3300013296 Bacteria 31868
161 Ga0157374_10105484 3300013296 Bacteria 2707
162 Ga0157378_10115479 3300013297 Bacteria 2467
163 Ga0157378_10122966 3300013297 Bacteria 2394
164 Ga0163162_10029751 3300013306 Bacteria 5406
165 Ga0163162_10138876 3300013306 Bacteria 2542
166 Ga0157372_10015179 3300013307 Bacteria 8246
167 Ga0157375_10003299 3300013308 Bacteria 13974
168 Ga0157375_10106790 3300013308 Bacteria 2892
169 Ga0157375_10138974 3300013308 Bacteria 2555
170 Ga0163163_10001537 3300014325 Bacteria 19436
171 Ga0163163_10013243 3300014325 Bacteria 7542
172 Ga0163163_10107437 3300014325 Bacteria 2817
173 Ga0157377_10036486 3300014745 Bacteria 2705
174 Ga0157379_10004248 3300014968 Bacteria 12231
175 Ga0157379_10038927 3300014968 Bacteria 4242
176 Ga0157379_10101177 3300014968 Bacteria 2587
177 Ga0157376_10077332 3300014969 Bacteria 2846
178 Ga0157376_10190268 3300014969 Bacteria 1881
179 Ga0213876_10065850 3300021384 Bacteria 1912
180 Ga0207692_10002783 3300025898 Bacteria 6750
181 Ga0207692_10233903 3300025898 Bacteria 1095
182 Ga0207688_10010417 3300025901 Bacteria 5060
183 Ga0207680_10072217 3300025903 Bacteria 2142
184 Ga0207680_10080641 3300025903 Bacteria 2044
185 Ga0207647_10050917 3300025904 Bacteria 2562
186 Ga0207685_10008951 3300025905 Bacteria 2884
187 Ga0207645_10003431 3300025907 Bacteria 12047
188 Ga0207643_10057427 3300025908 Bacteria 2215
189 Ga0207705_10000001 3300025909 Bacteria 2061880
190 Ga0207684_10000068 3300025910 Bacteria 191048
191 Ga0207684_10100733 3300025910 Bacteria 2469
192 Ga0207684_10240748 3300025910 Bacteria 1561
193 Ga0207654_10063216 3300025911 Bacteria 2172
194 Ga0207654_10109229 3300025911 Bacteria 1718
195 Ga0207707_10027551 3300025912 Bacteria 4968
196 Ga0207707_10137645 3300025912 Bacteria 2135
197 Ga0207707_10157711 3300025912 Bacteria 1984
198 Ga0207707_10174981 3300025912 Bacteria 1875
199 Ga0207695_10209833 3300025913 Bacteria 1859
200 Ga0207693_10000236 3300025915 Bacteria 50870
201 Ga0207693_10023856 3300025915 Bacteria 4855
202 Ga0207663_10002612 3300025916 Bacteria 8669
203 Ga0207663_10027596 3300025916 Bacteria 3312
204 Ga0207662_10021359 3300025918 Bacteria 3700
205 Ga0207657_10000540 3300025919 Bacteria 40363
206 Ga0207657_10011959 3300025919 Bacteria 8589
207 Ga0207657_10013760 3300025919 Bacteria 7922
208 Ga0207657_10196833 3300025919 Bacteria 1623
209 Ga0207649_10003134 3300025920 Bacteria 9066
210 Ga0207649_10265763 3300025920 Bacteria 1241
211 Ga0207652_10031331 3300025921 Bacteria 4465
212 Ga0207652_10063999 3300025921 Bacteria 3182
213 Ga0207652_10362134 3300025921 Bacteria 1309
214 Ga0207652_10478882 3300025921 Bacteria 1121
215 Ga0207646_10000142 3300025922 Bacteria 98159
216 Ga0207646_10002399 3300025922 Bacteria 22102
217 Ga0207681_10039190 3300025923 Bacteria 3144
218 Ga0207681_10046910 3300025923 Bacteria 2907
219 Ga0207650_10088944 3300025925 Bacteria 2356
220 Ga0207650_10109775 3300025925 Bacteria 2134
221 Ga0207687_10000769 3300025927 Bacteria 21615
222 Ga0207700_10005113 3300025928 Bacteria 7802
223 Ga0207644_10023822 3300025931 Bacteria 4197
224 Ga0207644_10028807 3300025931 Bacteria 3848
225 Ga0207690_10000388 3300025932 Bacteria 29040
226 Ga0207690_10151669 3300025932 Bacteria 1719
227 Ga0207706_10000550 3300025933 Bacteria 39856
228 Ga0207706_10098246 3300025933 Bacteria 2575
229 Ga0207686_10016145 3300025934 Bacteria 4185
230 Ga0207670_10016815 3300025936 Bacteria 4407
231 Ga0207670_10048786 3300025936 Bacteria 2828
232 Ga0207670_10098810 3300025936 Bacteria 2081
233 Ga0207704_10050354 3300025938 Bacteria 2512
234 Ga0207665_10001314 3300025939 Bacteria 16749
235 Ga0207665_10194038 3300025939 Bacteria 1477
236 Ga0207665_10239258 3300025939 Bacteria 1337
237 Ga0207691_10013633 3300025940 Bacteria 7769
238 Ga0207691_10031444 3300025940 Bacteria 4954
239 Ga0207691_10060486 3300025940 Bacteria 3442
240 Ga0207691_10157392 3300025940 Bacteria 1994
241 Ga0207711_10001869 3300025941 Bacteria 19194
242 Ga0207711_10070106 3300025941 Bacteria 3040
243 Ga0207711_10114110 3300025941 Bacteria 2406
244 Ga0207689_10015529 3300025942 Bacteria 6450
245 Ga0207689_10068122 3300025942 Bacteria 2925
246 Ga0207689_10097671 3300025942 Bacteria 2413
247 Ga0207661_10213686 3300025944 Bacteria 1701
248 Ga0207679_10002903 3300025945 Bacteria 10633
249 Ga0207679_10030228 3300025945 Bacteria 3780
250 Ga0207679_10235815 3300025945 Bacteria 1547
251 Ga0207679_10252882 3300025945 Bacteria 1499
252 Ga0207667_10001137 3300025949 Bacteria 33462
253 Ga0207651_10000525 3300025960 Bacteria 16106
254 Ga0207651_10007157 3300025960 Bacteria 5929
255 Ga0207668_10038262 3300025972 Bacteria 3218
256 Ga0207668_10046654 3300025972 Bacteria 2961
257 Ga0207640_10198234 3300025981 Bacteria 1519
258 Ga0207658_10017123 3300025986 Bacteria 4991
259 Ga0207658_10069978 3300025986 Bacteria 2653
260 Ga0207658_10095153 3300025986 Bacteria 2320
261 Ga0207677_10000241 3300026023 Bacteria 42261
262 Ga0207703_10003696 3300026035 Bacteria 12743
263 Ga0207703_10011474 3300026035 Bacteria 6892
264 Ga0207703_10270209 3300026035 Bacteria 1540
265 Ga0207639_10044253 3300026041 Bacteria 3347
266 Ga0207639_10181439 3300026041 Bacteria 1791
267 Ga0207678_10028294 3300026067 Bacteria 4894
268 Ga0207678_10044240 3300026067 Bacteria 3852
269 Ga0207678_10085525 3300026067 Bacteria 2696
270 Ga0207678_10128348 3300026067 Bacteria 2163
271 Ga0207708_10073386 3300026075 Bacteria 2622
272 Ga0207702_10001785 3300026078 Bacteria 21197
273 Ga0207702_10059856 3300026078 Bacteria 3246
274 Ga0207702_10100335 3300026078 Bacteria 2554
275 Ga0207702_10267382 3300026078 Bacteria 1612
276 Ga0207641_10018404 3300026088 Bacteria 5727
277 Ga0207648_10001002 3300026089 Bacteria 31804
278 Ga0207676_10000520 3300026095 Bacteria 32358
279 Ga0207676_10036349 3300026095 Bacteria 3745
280 Ga0207674_10023672 3300026116 Bacteria 6574
281 Ga0207674_10081779 3300026116 Bacteria 3232
282 Ga0207675_100001191 3300026118 Bacteria 25904
283 Ga0207683_10094364 3300026121 Bacteria 2666
284 Ga0207683_10100390 3300026121 Bacteria 2584
285 Ga0207698_10074527 3300026142 Bacteria 2708
286 Ga0209588_1000009 3300027671 Bacteria 174900
287 Ga0268266_10112325 3300028379 Bacteria 2415
288 Ga0268266_10471993 3300028379 Bacteria 1195
289 Ga0268265_10049406 3300028380 Bacteria 3163
290 Ga0268264_10000854 3300028381 Bacteria 32463
291 Ga0268264_10002755 3300028381 Bacteria 15346
292 Ga0307515_10091130 3300028794 Bacteria 3813
293 Ga0307512_10002822 3300030522 Bacteria 21161
294 Ga0307512_10017252 3300030522 Bacteria 6633
295 Ga0265320_10012678 3300031240 Bacteria 4889
296 Ga0307513_10000535 3300031456 Bacteria 54265
297 Ga0307513_10065765 3300031456 Bacteria 3814
298 Ga0307513_10239397 3300031456 Bacteria 1621
299 Ga0307509_10003240 3300031507 Bacteria 25121
300 Ga0307508_10019986 3300031616 Bacteria 6084
301 Ga0307516_10006918 3300031730 Bacteria 13170
302 Ga0307409_100104891 3300031995 Bacteria 2355
303 Ga0307411_10089407 3300032005 Bacteria 2145
304 Ga0307510_10134249 3300033180 Bacteria 2138
305 Ga0373923_0005852 3300035111 Bacteria 4199
306 Ga0373953_0001104 3300035117 Bacteria 7641
307 Ga0373954_0006818 3300035118 Bacteria 4982
308 Ga0373956_0007816 3300035119 Bacteria 4313
309 Ga0373957_0008629 3300035120 Bacteria 3310
310 Ga0373943_0220332 3300035170 Bacteria 1056
311 Ga0373955_0001260 3300035172 Bacteria 10754
312 Ga0373961_0010085 3300035241 Bacteria 2324
313 Ga0373931_0175802 3300035691 Unclassified 1265
314 Ga0373935_0319391 3300035692 Bacteria 1101
315 Ga0373927_0092790 3300035695 Bacteria 1961
316 Ga0373933_0012679 3300035724 Bacteria 4659
317 Ga0373937_0008943 3300036401 Bacteria 8692
318 Ga0373937_0324902 3300036401 Bacteria 1456
319 Ga0436365_1596195 3300039437 Bacteria 2749
320 Ga0436360_0323091 3300039438 Bacteria 2225
321 Ga0436362_0802830 3300039453 Bacteria 3457
322 Ga0436362_1093284 3300039453 Bacteria 1410
323 Ga0451577_0253262 3300042876 Bacteria 1594
324 Ga0466969_0002498 3300044656 Bacteria 9823
325 Ga0466966_0033745 3300044684 Bacteria 3312
326 Ga0466961_0006136 3300044693 Bacteria 7626
327 Ga0466963_0043648 3300044694 Bacteria 2949
328 Ga0466970_0013253 3300044765 Bacteria 4226
329 Ga0466959_0030620 3300045049 Bacteria 3984
330 Ga0466958_0083121 3300045836 Bacteria 1973
331 Ga0495629_0248380 3300046459 Bacteria 1224
332 Ga0495653_0219140 3300046463 Bacteria 1280
333 Ga0495580_0075624 3300046472 Bacteria 2349
334 Ga0495662_0037562 3300046476 Bacteria 2339
335 Ga0495608_0107007 3300046511 Bacteria 1800
336 Ga0495628_0043076 3300046516 Bacteria 3598
337 Ga0495652_0155878 3300046529 Bacteria 1779
338 Ga0495665_0046024 3300046531 Bacteria 2317
339 Ga0495640_0178805 3300046533 Bacteria 1353
340 Ga0495586_0087111 3300046535 Bacteria 1722
341 Ga0495635_0020156 3300046663 Bacteria 4647
342 Ga0495623_0071911 3300046679 Bacteria 2151
343 Ga0495604_0019201 3300047317 Bacteria 5474
344 Ga0496101_0021373 3300048904 Bacteria 4447
345 Ga0496102_0013562 3300048905 Bacteria 7064
346 Ga0496103_0029762 3300048906 Bacteria 3319
347 Ga0496103_0246597 3300048906 Bacteria 1149
348 Ga0496104_0026529 3300048907 Bacteria 5352
349 Ga0496105_0066023 3300048908 Bacteria 2986
350 Ga0496106_0208555 3300048909 Bacteria 1556
351 Ga0496107_0001667 3300048910 Bacteria 13879
352 Ga0496107_0041559 3300048910 Bacteria 3301
353 Ga0496108_0011707 3300048911 Bacteria 7136
354 Ga0496108_0021136 3300048911 Bacteria 5348
355 Ga0496108_0115216 3300048911 Bacteria 2302
356 Ga0496108_0165450 3300048911 Bacteria 1912
357 Ga0496109_0063321 3300048912 Bacteria 3383
358 Ga0496110_0251251 3300048913 Bacteria 1609
359 Ga0496112_0004738 3300048915 Bacteria 11591
360 Ga0496112_0137131 3300048915 Bacteria 2417
361 Ga0496112_0357227 3300048915 Unclassified 1403
362 Ga0496113_0061728 3300048916 Bacteria 2828
363 Ga0496114_0021772 3300048917 Bacteria 5217
364 Ga0496114_0251333 3300048917 Unclassified 1556
365 Ga0496115_0113632 3300048918 Bacteria 2225
366 Ga0501039_0127174 3300049575 Bacteria 1999
367 Ga0501040_0226017 3300049576 Bacteria 1332
368 Ga0501042_0105874 3300049578 Bacteria 2024
369 Ga0501067_0125469 3300049583 Bacteria 1429
370 Ga0501071_0155295 3300049587 Bacteria 1708
371 Ga0501072_0084864 3300049588 Bacteria 2511
372 Ga0501076_0070780 3300049592 Bacteria 2789
373 Ga0501081_0118764 3300049743 Bacteria 1881
374 Ga0501271_004885 3300049768 Bacteria 1289
375 Ga0501045_0234112 3300049824 Bacteria 1367
376 nmdc:mga0yw44_297259_c1 3300050492 Bacteria 1081
377 nmdc:mga05p37_98899_c1 3300050507 Bacteria 3594
378 nmdc:mga0rr50_241735_c1 3300050513 Bacteria 1497
379 nmdc:mga08x19_349072_c1 3300050514 Bacteria 1033
380 nmdc:mga0a205_411535_c1 3300050515 Bacteria 1215
381 Ga0495595_0059851 3300053084 Bacteria 1782
382 Ga0495619_0155976 3300053085 Bacteria 1575
383 Ga0500646_0008591 3300053090 Bacteria 2614
384 Ga0466962_0114698 3300061719 Bacteria 1298
385 Ga0530510_0053156 3300061734 Bacteria 2927

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10000104 Ga0099794_1000010424 295
2 3300021384 Ga0213876_10065850 Ga0213876_100658501 297
3 3300031730 Ga0307516_10006918 Ga0307516_100069189 297
4 3300039437 Ga0436365_1596195 Ga0436365_1596195_1540_2478 297
5 3300039453 Ga0436362_0802830 Ga0436362_0802830_2392_3330 297
6 3300045836 Ga0466958_0083121 Ga0466958_0083121_984_1934 297
7 3300046463 Ga0495653_0219140 Ga0495653_0219140_294_1256 297
8 3300046511 Ga0495608_0107007 Ga0495608_0107007_584_1510 297
9 3300050514 nmdc:mga08x19_349072_c1 nmdc:mga08x19_349072_c1_37_933 297
10 3300061719 Ga0466962_0114698 Ga0466962_0114698_207_1157 297
11 3300007076 Ga0075435_100229844 Ga0075435_1002298442 302
12 3300009147 Ga0114129_10378972 Ga0114129_103789722 302
13 3300050507 nmdc:mga05p37_98899_c1 nmdc:mga05p37_98899_c1_150_1118 302
14 3300050513 nmdc:mga0rr50_241735_c1 nmdc:mga0rr50_241735_c1_160_1128 302
15 3300007265 Ga0099794_10004955 Ga0099794_100049553 303
16 3300049583 Ga0501067_0125469 Ga0501067_0125469_192_1178 303
17 3300005329 Ga0070683_100247916 Ga0070683_1002479162 304
18 3300005330 Ga0070690_100049317 Ga0070690_1000493172 304
19 3300005335 Ga0070666_10013311 Ga0070666_100133114 304
20 3300005336 Ga0070680_100023972 Ga0070680_1000239725 304
21 3300005338 Ga0068868_100007194 Ga0068868_1000071942 304
22 3300005339 Ga0070660_100110170 Ga0070660_1001101702 304
23 3300005339 Ga0070660_100118792 Ga0070660_1001187922 304
24 3300005340 Ga0070689_100064087 Ga0070689_1000640872 304
25 3300005341 Ga0070691_10135033 Ga0070691_101350332 304
26 3300005343 Ga0070687_100017489 Ga0070687_1000174894 304
27 3300005344 Ga0070661_100056667 Ga0070661_1000566673 304
28 3300005345 Ga0070692_10064046 Ga0070692_100640461 304
29 3300005356 Ga0070674_100011207 Ga0070674_1000112074 304
30 3300005364 Ga0070673_100000318 Ga0070673_10000031811 304
31 3300005365 Ga0070688_100005468 Ga0070688_1000054685 304
32 3300005436 Ga0070713_100020208 Ga0070713_1000202084 304
33 3300005436 Ga0070713_100075358 Ga0070713_1000753583 304
34 3300005437 Ga0070710_10010777 Ga0070710_100107774 304
35 3300005437 Ga0070710_10018350 Ga0070710_100183504 304
36 3300005439 Ga0070711_100000746 Ga0070711_1000007466 304
37 3300005457 Ga0070662_100019152 Ga0070662_1000191522 304
38 3300005457 Ga0070662_100075219 Ga0070662_1000752193 304
39 3300005458 Ga0070681_10300163 Ga0070681_103001632 304
40 3300005459 Ga0068867_100137577 Ga0068867_1001375772 304
41 3300005466 Ga0070685_10021068 Ga0070685_100210684 304
42 3300005468 Ga0070707_100570761 Ga0070707_1005707611 304
43 3300005530 Ga0070679_100080182 Ga0070679_1000801823 304
44 3300005530 Ga0070679_100269019 Ga0070679_1002690192 304
45 3300005536 Ga0070697_100124154 Ga0070697_1001241542 304
46 3300005544 Ga0070686_100016450 Ga0070686_1000164504 304
47 3300005548 Ga0070665_100001983 Ga0070665_10000198312 304
48 3300005563 Ga0068855_100040640 Ga0068855_1000406402 304
49 3300005564 Ga0070664_100108171 Ga0070664_1001081712 304
50 3300005578 Ga0068854_100055092 Ga0068854_1000550922 304
51 3300005615 Ga0070702_100022440 Ga0070702_1000224402 304
52 3300005616 Ga0068852_100116969 Ga0068852_1001169692 304
53 3300005616 Ga0068852_100180722 Ga0068852_1001807223 304
54 3300005617 Ga0068859_100000518 Ga0068859_10000051818 304
55 3300005618 Ga0068864_100002217 Ga0068864_1000022173 304
56 3300005718 Ga0068866_10007746 Ga0068866_100077463 304
57 3300005841 Ga0068863_100003085 Ga0068863_1000030853 304
58 3300005841 Ga0068863_100080146 Ga0068863_1000801463 304
59 3300005842 Ga0068858_100002551 Ga0068858_1000025512 304
60 3300006173 Ga0070716_100001080 Ga0070716_10000108011 304
61 3300006175 Ga0070712_100001121 Ga0070712_10000112112 304
62 3300006175 Ga0070712_100025086 Ga0070712_1000250862 304
63 3300006358 Ga0068871_100105338 Ga0068871_1001053383 304
64 3300006931 Ga0097620_100000518 Ga0097620_10000051822 304
65 3300009093 Ga0105240_10002070 Ga0105240_100020703 304
66 3300009098 Ga0105245_10002153 Ga0105245_1000215313 304
67 3300009174 Ga0105241_10199876 Ga0105241_101998763 304
68 3300009176 Ga0105242_10009346 Ga0105242_100093468 304
69 3300009176 Ga0105242_10075818 Ga0105242_100758183 304
70 3300009177 Ga0105248_10006278 Ga0105248_100062783 304
71 3300013296 Ga0157374_10000601 Ga0157374_1000060121 304
72 3300013297 Ga0157378_10122966 Ga0157378_101229662 304
73 3300013306 Ga0163162_10029751 Ga0163162_100297513 304
74 3300013306 Ga0163162_10138876 Ga0163162_101388763 304
75 3300013308 Ga0157375_10003299 Ga0157375_1000329913 304
76 3300014325 Ga0163163_10001537 Ga0163163_1000153712 304
77 3300014745 Ga0157377_10036486 Ga0157377_100364862 304
78 3300014968 Ga0157379_10038927 Ga0157379_100389274 304
79 3300014969 Ga0157376_10077332 Ga0157376_100773322 304
80 3300014969 Ga0157376_10190268 Ga0157376_101902683 304
81 3300025898 Ga0207692_10002783 Ga0207692_100027833 304
82 3300025905 Ga0207685_10008951 Ga0207685_100089513 304
83 3300025911 Ga0207654_10063216 Ga0207654_100632161 304
84 3300025911 Ga0207654_10109229 Ga0207654_101092291 304
85 3300025912 Ga0207707_10027551 Ga0207707_100275512 304
86 3300025913 Ga0207695_10209833 Ga0207695_102098332 304
87 3300025915 Ga0207693_10000236 Ga0207693_1000023622 304
88 3300025915 Ga0207693_10023856 Ga0207693_100238564 304
89 3300025916 Ga0207663_10002612 Ga0207663_100026125 304
90 3300025919 Ga0207657_10011959 Ga0207657_100119592 304
91 3300025919 Ga0207657_10013760 Ga0207657_100137603 304
92 3300025921 Ga0207652_10031331 Ga0207652_100313315 304
93 3300025921 Ga0207652_10478882 Ga0207652_104788822 304
94 3300025927 Ga0207687_10000769 Ga0207687_1000076921 304
95 3300025928 Ga0207700_10005113 Ga0207700_100051138 304
96 3300025931 Ga0207644_10023822 Ga0207644_100238222 304
97 3300025934 Ga0207686_10016145 Ga0207686_100161454 304
98 3300025936 Ga0207670_10048786 Ga0207670_100487862 304
99 3300025939 Ga0207665_10001314 Ga0207665_1000131415 304
100 3300025940 Ga0207691_10031444 Ga0207691_100314444 304
101 3300025941 Ga0207711_10001869 Ga0207711_1000186911 304
102 3300025942 Ga0207689_10068122 Ga0207689_100681222 304
103 3300025945 Ga0207679_10235815 Ga0207679_102358152 304
104 3300025945 Ga0207679_10252882 Ga0207679_102528822 304
105 3300025960 Ga0207651_10000525 Ga0207651_100005258 304
106 3300025981 Ga0207640_10198234 Ga0207640_101982342 304
107 3300025986 Ga0207658_10017123 Ga0207658_100171233 304
108 3300026023 Ga0207677_10000241 Ga0207677_1000024129 304
109 3300026035 Ga0207703_10003696 Ga0207703_100036966 304
110 3300026078 Ga0207702_10059856 Ga0207702_100598563 304
111 3300026088 Ga0207641_10018404 Ga0207641_100184044 304
112 3300026095 Ga0207676_10000520 Ga0207676_1000052010 304
113 3300026142 Ga0207698_10074527 Ga0207698_100745273 304
114 3300028379 Ga0268266_10112325 Ga0268266_101123252 304
115 3300028381 Ga0268264_10002755 Ga0268264_100027556 304
116 3300035111 Ga0373923_0005852 Ga0373923_0005852_1474_2400 304
117 3300035117 Ga0373953_0001104 Ga0373953_0001104_5554_6480 304
118 3300035118 Ga0373954_0006818 Ga0373954_0006818_1476_2402 304
119 3300035119 Ga0373956_0007816 Ga0373956_0007816_1679_2605 304
120 3300035120 Ga0373957_0008629 Ga0373957_0008629_521_1447 304
121 3300035170 Ga0373943_0220332 Ga0373943_0220332_52_978 304
122 3300035172 Ga0373955_0001260 Ga0373955_0001260_1476_2402 304
123 3300035692 Ga0373935_0319391 Ga0373935_0319391_151_1077 304
124 3300035695 Ga0373927_0092790 Ga0373927_0092790_512_1438 304
125 3300035724 Ga0373933_0012679 Ga0373933_0012679_907_1833 304
126 3300036401 Ga0373937_0008943 Ga0373937_0008943_3255_4181 304
127 3300044694 Ga0466963_0043648 Ga0466963_0043648_1371_2324 304
128 3300046459 Ga0495629_0248380 Ga0495629_0248380_118_1044 304
129 3300046472 Ga0495580_0075624 Ga0495580_0075624_793_1719 304
130 3300046476 Ga0495662_0037562 Ga0495662_0037562_1284_2210 304
131 3300046516 Ga0495628_0043076 Ga0495628_0043076_68_994 304
132 3300046531 Ga0495665_0046024 Ga0495665_0046024_617_1543 304
133 3300046533 Ga0495640_0178805 Ga0495640_0178805_403_1329 304
134 3300046535 Ga0495586_0087111 Ga0495586_0087111_576_1502 304
135 3300046663 Ga0495635_0020156 Ga0495635_0020156_3134_4060 304
136 3300046679 Ga0495623_0071911 Ga0495623_0071911_267_1193 304
137 3300047317 Ga0495604_0019201 Ga0495604_0019201_2441_3367 304
138 3300048904 Ga0496101_0021373 Ga0496101_0021373_3111_4037 304
139 3300048907 Ga0496104_0026529 Ga0496104_0026529_4045_4971 304
140 3300048908 Ga0496105_0066023 Ga0496105_0066023_1950_2876 304
141 3300048909 Ga0496106_0208555 Ga0496106_0208555_79_1005 304
142 3300048911 Ga0496108_0165450 Ga0496108_0165450_882_1808 304
143 3300048912 Ga0496109_0063321 Ga0496109_0063321_105_1031 304
144 3300048915 Ga0496112_0004738 Ga0496112_0004738_4244_5170 304
145 3300048917 Ga0496114_0021772 Ga0496114_0021772_157_1083 304
146 3300048918 Ga0496115_0113632 Ga0496115_0113632_991_1917 304
147 3300053084 Ga0495595_0059851 Ga0495595_0059851_490_1416 304
148 3300053085 Ga0495619_0155976 Ga0495619_0155976_93_1019 304
149 3300005344 Ga0070661_100311464 Ga0070661_1003114642 305
150 3300005355 Ga0070671_100139598 Ga0070671_1001395982 305
151 3300025920 Ga0207649_10265763 Ga0207649_102657632 305
152 3300026067 Ga0207678_10128348 Ga0207678_101283481 305
153 3300028379 Ga0268266_10471993 Ga0268266_104719931 305
154 3300030522 Ga0307512_10002822 Ga0307512_100028228 306
155 3300030522 Ga0307512_10017252 Ga0307512_100172522 306
156 3300031456 Ga0307513_10065765 Ga0307513_100657652 306
157 3300031507 Ga0307509_10003240 Ga0307509_1000324014 306
158 3300033180 Ga0307510_10134249 Ga0307510_101342493 306
159 3300005334 Ga0068869_100169048 Ga0068869_1001690483 307
160 3300005564 Ga0070664_100034296 Ga0070664_1000342965 307
161 3300025939 Ga0207665_10194038 Ga0207665_101940382 307
162 3300025945 Ga0207679_10030228 Ga0207679_100302284 307
163 3300031240 Ga0265320_10012678 Ga0265320_100126785 307
164 3300035241 Ga0373961_0010085 Ga0373961_0010085_1299_2231 307
165 3300048915 Ga0496112_0137131 Ga0496112_0137131_128_1063 307
166 3300005456 Ga0070678_100093931 Ga0070678_1000939313 308
167 3300006358 Ga0068871_100016743 Ga0068871_1000167432 308
168 3300007265 Ga0099794_10004592 Ga0099794_100045925 308
169 3300007265 Ga0099794_10060655 Ga0099794_100606551 308
170 3300025940 Ga0207691_10060486 Ga0207691_100604862 308
171 3300025972 Ga0207668_10046654 Ga0207668_100466542 308
172 3300026121 Ga0207683_10100390 Ga0207683_101003902 308
173 3300028794 Ga0307515_10091130 Ga0307515_100911303 308
174 3300031616 Ga0307508_10019986 Ga0307508_100199862 308
175 3300053090 Ga0500646_0008591 Ga0500646_0008591_148_1083 308
176 3300005337 Ga0070682_100013380 Ga0070682_1000133802 309
177 3300005343 Ga0070687_100081086 Ga0070687_1000810862 309
178 3300005365 Ga0070688_100044079 Ga0070688_1000440793 309
179 3300005367 Ga0070667_100543174 Ga0070667_1005431741 309
180 3300005439 Ga0070711_100036133 Ga0070711_1000361331 309
181 3300005441 Ga0070700_100253923 Ga0070700_1002539231 309
182 3300005444 Ga0070694_100014651 Ga0070694_1000146514 309
183 3300005445 Ga0070708_100000634 Ga0070708_1000006345 309
184 3300005456 Ga0070678_100321999 Ga0070678_1003219991 309
185 3300005457 Ga0070662_100206619 Ga0070662_1002066191 309
186 3300005467 Ga0070706_100000079 Ga0070706_10000007940 309
187 3300005467 Ga0070706_100114601 Ga0070706_1001146012 309
188 3300005518 Ga0070699_100078144 Ga0070699_1000781442 309
189 3300005518 Ga0070699_100226370 Ga0070699_1002263702 309
190 3300005530 Ga0070679_100038692 Ga0070679_1000386926 309
191 3300005545 Ga0070695_100000748 Ga0070695_10000074817 309
192 3300005578 Ga0068854_100125443 Ga0068854_1001254431 309
193 3300005614 Ga0068856_100276118 Ga0068856_1002761182 309
194 3300005615 Ga0070702_100175115 Ga0070702_1001751151 309
195 3300005616 Ga0068852_100495881 Ga0068852_1004958812 309
196 3300005842 Ga0068858_100470381 Ga0068858_1004703812 309
197 3300009148 Ga0105243_10219679 Ga0105243_102196791 309
198 3300009553 Ga0105249_10097712 Ga0105249_100977123 309
199 3300013296 Ga0157374_10105484 Ga0157374_101054842 309
200 3300013308 Ga0157375_10106790 Ga0157375_101067902 309
201 3300013308 Ga0157375_10138974 Ga0157375_101389742 309
202 3300014968 Ga0157379_10101177 Ga0157379_101011772 309
203 3300025898 Ga0207692_10233903 Ga0207692_102339031 309
204 3300025901 Ga0207688_10010417 Ga0207688_100104175 309
205 3300025910 Ga0207684_10000068 Ga0207684_10000068138 309
206 3300025910 Ga0207684_10100733 Ga0207684_101007332 309
207 3300025912 Ga0207707_10157711 Ga0207707_101577112 309
208 3300025916 Ga0207663_10027596 Ga0207663_100275961 309
209 3300025918 Ga0207662_10021359 Ga0207662_100213593 309
210 3300025919 Ga0207657_10196833 Ga0207657_101968332 309
211 3300025933 Ga0207706_10098246 Ga0207706_100982462 309
212 3300025936 Ga0207670_10016815 Ga0207670_100168152 309
213 3300025941 Ga0207711_10070106 Ga0207711_100701062 309
214 3300025942 Ga0207689_10097671 Ga0207689_100976712 309
215 3300026035 Ga0207703_10270209 Ga0207703_102702092 309
216 3300026078 Ga0207702_10100335 Ga0207702_101003352 309
217 3300026078 Ga0207702_10267382 Ga0207702_102673822 309
218 3300026121 Ga0207683_10094364 Ga0207683_100943643 309
219 3300042876 Ga0451577_0253262 Ga0451577_0253262_272_1231 309
220 3300048911 Ga0496108_0115216 Ga0496108_0115216_41_1027 309
221 3300048913 Ga0496110_0251251 Ga0496110_0251251_392_1378 309
222 3300049576 Ga0501040_0226017 Ga0501040_0226017_159_1094 309
223 3300049578 Ga0501042_0105874 Ga0501042_0105874_468_1403 309
224 3300049587 Ga0501071_0155295 Ga0501071_0155295_137_1072 309
225 3300049588 Ga0501072_0084864 Ga0501072_0084864_280_1215 309
226 3300049592 Ga0501076_0070780 Ga0501076_0070780_587_1522 309
227 3300049743 Ga0501081_0118764 Ga0501081_0118764_26_961 309
228 3300049824 Ga0501045_0234112 Ga0501045_0234112_216_1151 309
229 3300061734 Ga0530510_0053156 Ga0530510_0053156_721_1656 309
230 3300005329 Ga0070683_100100668 Ga0070683_1001006682 310
231 3300005335 Ga0070666_10110446 Ga0070666_101104462 310
232 3300005337 Ga0070682_100044363 Ga0070682_1000443631 310
233 3300005339 Ga0070660_100002845 Ga0070660_1000028457 310
234 3300005344 Ga0070661_100005435 Ga0070661_1000054352 310
235 3300005347 Ga0070668_100081937 Ga0070668_1000819373 310
236 3300005353 Ga0070669_100048718 Ga0070669_1000487182 310
237 3300005354 Ga0070675_100463244 Ga0070675_1004632441 310
238 3300005355 Ga0070671_100024010 Ga0070671_1000240104 310
239 3300005364 Ga0070673_100017867 Ga0070673_1000178674 310
240 3300005366 Ga0070659_100000175 Ga0070659_10000017537 310
241 3300005367 Ga0070667_100143212 Ga0070667_1001432122 310
242 3300005445 Ga0070708_100003217 Ga0070708_1000032176 310
243 3300005445 Ga0070708_100493642 Ga0070708_1004936421 310
244 3300005455 Ga0070663_100002915 Ga0070663_1000029152 310
245 3300005457 Ga0070662_100000169 Ga0070662_10000016922 310
246 3300005458 Ga0070681_10187737 Ga0070681_101877372 310
247 3300005467 Ga0070706_100301833 Ga0070706_1003018332 310
248 3300005536 Ga0070697_100004101 Ga0070697_1000041013 310
249 3300005539 Ga0068853_100009887 Ga0068853_1000098872 310
250 3300005563 Ga0068855_100000588 Ga0068855_10000058835 310
251 3300005564 Ga0070664_100003854 Ga0070664_1000038547 310
252 3300005564 Ga0070664_100053299 Ga0070664_1000532993 310
253 3300005578 Ga0068854_100107146 Ga0068854_1001071462 310
254 3300005614 Ga0068856_100000557 Ga0068856_1000005579 310
255 3300005981 Ga0081538_10003311 Ga0081538_100033116 310
256 3300005981 Ga0081538_10004627 Ga0081538_1000462710 310
257 3300005981 Ga0081538_10030373 Ga0081538_100303734 310
258 3300006048 Ga0075363_100163438 Ga0075363_1001634382 310
259 3300009098 Ga0105245_10033691 Ga0105245_100336914 310
260 3300009545 Ga0105237_10175823 Ga0105237_101758232 310
261 3300013100 Ga0157373_10006502 Ga0157373_100065024 310
262 3300013102 Ga0157371_10003810 Ga0157371_1000381010 310
263 3300013104 Ga0157370_10037237 Ga0157370_100372374 310
264 3300013105 Ga0157369_10054951 Ga0157369_100549512 310
265 3300013307 Ga0157372_10015179 Ga0157372_100151793 310
266 3300014325 Ga0163163_10107437 Ga0163163_101074372 310
267 3300025903 Ga0207680_10072217 Ga0207680_100722173 310
268 3300025910 Ga0207684_10240748 Ga0207684_102407482 310
269 3300025912 Ga0207707_10137645 Ga0207707_101376452 310
270 3300025919 Ga0207657_10000540 Ga0207657_1000054016 310
271 3300025920 Ga0207649_10003134 Ga0207649_100031344 310
272 3300025923 Ga0207681_10039190 Ga0207681_100391902 310
273 3300025925 Ga0207650_10109775 Ga0207650_101097752 310
274 3300025931 Ga0207644_10028807 Ga0207644_100288072 310
275 3300025932 Ga0207690_10000388 Ga0207690_1000038814 310
276 3300025933 Ga0207706_10000550 Ga0207706_1000055014 310
277 3300025940 Ga0207691_10013633 Ga0207691_100136338 310
278 3300025945 Ga0207679_10002903 Ga0207679_100029036 310
279 3300025949 Ga0207667_10001137 Ga0207667_100011375 310
280 3300025960 Ga0207651_10007157 Ga0207651_100071575 310
281 3300025972 Ga0207668_10038262 Ga0207668_100382623 310
282 3300025986 Ga0207658_10095153 Ga0207658_100951532 310
283 3300026041 Ga0207639_10044253 Ga0207639_100442533 310
284 3300026067 Ga0207678_10028294 Ga0207678_100282945 310
285 3300026067 Ga0207678_10085525 Ga0207678_100855252 310
286 3300026078 Ga0207702_10001785 Ga0207702_1000178520 310
287 3300026116 Ga0207674_10081779 Ga0207674_100817792 310
288 3300035691 Ga0373931_0175802 Ga0373931_0175802_29_1027 310
289 3300044656 Ga0466969_0002498 Ga0466969_0002498_4411_5343 310
290 3300044684 Ga0466966_0033745 Ga0466966_0033745_59_991 310
291 3300044693 Ga0466961_0006136 Ga0466961_0006136_4343_5275 310
292 3300044765 Ga0466970_0013253 Ga0466970_0013253_2948_3880 310
293 3300045049 Ga0466959_0030620 Ga0466959_0030620_761_1693 310
294 3300048905 Ga0496102_0013562 Ga0496102_0013562_2441_3439 310
295 3300048906 Ga0496103_0029762 Ga0496103_0029762_1234_2232 310
296 3300048906 Ga0496103_0246597 Ga0496103_0246597_121_1071 310
297 3300048910 Ga0496107_0001667 Ga0496107_0001667_4837_5835 310
298 3300050492 nmdc:mga0yw44_297259_c1 nmdc:mga0yw44_297259_c1_110_1060 310
299 3300005445 Ga0070708_100079554 Ga0070708_1000795542 311
300 3300005468 Ga0070707_100000029 Ga0070707_10000002947 311
301 3300005471 Ga0070698_100212965 Ga0070698_1002129652 311
302 3300005518 Ga0070699_100411839 Ga0070699_1004118392 311
303 3300005530 Ga0070679_100136382 Ga0070679_1001363822 311
304 3300005535 Ga0070684_100041077 Ga0070684_1000410772 311
305 3300005536 Ga0070697_100000003 Ga0070697_10000000391 311
306 3300005937 Ga0081455_10009202 Ga0081455_1000920211 311
307 3300005981 Ga0081538_10005362 Ga0081538_100053621 311
308 3300010159 Ga0099796_10000339 Ga0099796_100003395 311
309 3300025912 Ga0207707_10174981 Ga0207707_101749811 311
310 3300025921 Ga0207652_10063999 Ga0207652_100639994 311
311 3300025922 Ga0207646_10000142 Ga0207646_1000014280 311
312 3300025922 Ga0207646_10002399 Ga0207646_100023998 311
313 3300025944 Ga0207661_10213686 Ga0207661_102136862 311
314 3300026075 Ga0207708_10073386 Ga0207708_100733862 311
315 3300027671 Ga0209588_1000009 Ga0209588_100000943 311
316 3300031456 Ga0307513_10000535 Ga0307513_1000053513 311
317 3300031456 Ga0307513_10239397 Ga0307513_102393972 311
318 3300036401 Ga0373937_0324902 Ga0373937_0324902_275_1285 311
319 3300039438 Ga0436360_0323091 Ga0436360_0323091_101_1063 311
320 3300046529 Ga0495652_0155878 Ga0495652_0155878_353_1363 311
321 3300048910 Ga0496107_0041559 Ga0496107_0041559_745_1746 311
322 3300048911 Ga0496108_0011707 Ga0496108_0011707_4319_5320 311
323 3300048915 Ga0496112_0357227 Ga0496112_0357227_239_1207 311
324 3300048916 Ga0496113_0061728 Ga0496113_0061728_986_1987 311
325 3300048917 Ga0496114_0251333 Ga0496114_0251333_406_1353 311
326 3300049575 Ga0501039_0127174 Ga0501039_0127174_848_1804 311
327 3300005328 Ga0070676_10001102 Ga0070676_100011022 312
328 3300005331 Ga0070670_100113803 Ga0070670_1001138031 312
329 3300005334 Ga0068869_100000152 Ga0068869_1000001525 312
330 3300005340 Ga0070689_100093122 Ga0070689_1000931222 312
331 3300005347 Ga0070668_100010033 Ga0070668_1000100339 312
332 3300005353 Ga0070669_100033681 Ga0070669_1000336813 312
333 3300005366 Ga0070659_100328095 Ga0070659_1003280952 312
334 3300005367 Ga0070667_100002820 Ga0070667_10000282015 312
335 3300005459 Ga0068867_100003325 Ga0068867_10000332511 312
336 3300005543 Ga0070672_100179680 Ga0070672_1001796802 312
337 3300005546 Ga0070696_100063867 Ga0070696_1000638672 312
338 3300005577 Ga0068857_100101047 Ga0068857_1001010472 312
339 3300005617 Ga0068859_100005705 Ga0068859_1000057055 312
340 3300005618 Ga0068864_100003353 Ga0068864_10000335315 312
341 3300005840 Ga0068870_10125175 Ga0068870_101251752 312
342 3300006852 Ga0075433_10445040 Ga0075433_104450401 312
343 3300006881 Ga0068865_100047473 Ga0068865_1000474734 312
344 3300006931 Ga0097620_100005705 Ga0097620_1000057055 312
345 3300009177 Ga0105248_10044872 Ga0105248_100448724 312
346 3300013297 Ga0157378_10115479 Ga0157378_101154792 312
347 3300014325 Ga0163163_10013243 Ga0163163_100132436 312
348 3300014968 Ga0157379_10004248 Ga0157379_100042483 312
349 3300025903 Ga0207680_10080641 Ga0207680_100806412 312
350 3300025907 Ga0207645_10003431 Ga0207645_100034312 312
351 3300025908 Ga0207643_10057427 Ga0207643_100574272 312
352 3300025921 Ga0207652_10362134 Ga0207652_103621342 312
353 3300025923 Ga0207681_10046910 Ga0207681_100469103 312
354 3300025925 Ga0207650_10088944 Ga0207650_100889441 312
355 3300025936 Ga0207670_10098810 Ga0207670_100988102 312
356 3300025938 Ga0207704_10050354 Ga0207704_100503542 312
357 3300025940 Ga0207691_10157392 Ga0207691_101573922 312
358 3300025941 Ga0207711_10114110 Ga0207711_101141103 312
359 3300025942 Ga0207689_10015529 Ga0207689_100155293 312
360 3300025986 Ga0207658_10069978 Ga0207658_100699782 312
361 3300026035 Ga0207703_10011474 Ga0207703_100114742 312
362 3300026041 Ga0207639_10181439 Ga0207639_101814392 312
363 3300026089 Ga0207648_10001002 Ga0207648_1000100228 312
364 3300026095 Ga0207676_10036349 Ga0207676_100363493 312
365 3300026116 Ga0207674_10023672 Ga0207674_100236722 312
366 3300026118 Ga0207675_100001191 Ga0207675_1000011917 312
367 3300028380 Ga0268265_10049406 Ga0268265_100494063 312
368 3300028381 Ga0268264_10000854 Ga0268264_100008542 312
369 3300039453 Ga0436362_1093284 Ga0436362_1093284_218_1189 312
370 3300048911 Ga0496108_0021136 Ga0496108_0021136_2269_3237 312
371 3300050515 nmdc:mga0a205_411535_c1 nmdc:mga0a205_411535_c1_73_1041 312
372 3300005327 Ga0070658_10000129 Ga0070658_1000012947 313
373 3300005337 Ga0070682_100133882 Ga0070682_1001338821 313
374 3300005339 Ga0070660_100227293 Ga0070660_1002272932 313
375 3300005366 Ga0070659_100087243 Ga0070659_1000872432 313
376 3300006173 Ga0070716_100141204 Ga0070716_1001412041 313
377 3300013104 Ga0157370_10030168 Ga0157370_100301683 313
378 3300025904 Ga0207647_10050917 Ga0207647_100509172 313
379 3300025909 Ga0207705_10000001 Ga0207705_10000001929 313
380 3300025932 Ga0207690_10151669 Ga0207690_101516692 313
381 3300025939 Ga0207665_10239258 Ga0207665_102392582 313
382 3300026067 Ga0207678_10044240 Ga0207678_100442404 313
383 3300031995 Ga0307409_100104891 Ga0307409_1001048912 313
384 3300032005 Ga0307411_10089407 Ga0307411_100894071 313
385 3300049768 Ga0501271_004885 Ga0501271_004885_250_1227 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

185

304

0.96

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

26

182

0.95

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

26

116

0.83

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

13

150

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dll-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9286 8 295
4dll-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9224 8 295
4dll-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.922 7 292
1vpd-assembly1.cif.gz_A x-ray crystal structure of tartronate semialdehyde reductase [salmonella typhimurium lt2] 0.9202 8 299
3doj-assembly1.cif.gz_A structure of glyoxylate reductase 1 from arabidopsis (atglyr1) 0.9188 8 290
ID Description Score Start End Superfamily
3pefB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9604 175 290 1.10.1040.10
3pduA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.954 175 289 1.10.1040.10
af_Q8T079_480_601_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9497 175 288 1.10.1040.10
4dllA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9467 166 292 1.10.1040.10
af_P77161_159_292_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9466 166 296 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A535BFU4-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9895 15 121 GO:0050661
AF-A0A6L8I436-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9856 5 93 GO:0050661
AF-A0A536VG48-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9807 17 186 GO:0050661
AF-A0A535BFU4-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9715 15 121 GO:0050661
AF-A0A536VG48-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9695 17 186 GO:0050661

Feature Viewer

pLDDT pTM Quality
93.37 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map