F430029

General Info

Members Datasets Scaffolds Average Seq Length
384 211 383 191

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0070336|Ga0501070_0070336_2233_2883
Length 216
Sequence MRRASNRIEAHSLSETSTMPQFPQNHTISPRTWILAGMIACAVAVRLVINFVPGLLPYNFTPVEAIALFGGAYFTNRRMAFAVPLLAMLCADLVIATTLPRAWIGDWLGTLPAVYGCIALTVFGGFALSKRISAFRVTGYAFASAVMFFLVTNFATWLMAHAGAGEACTQSLTSCYVAGIPFFRGTLVGTLLWSAILFGGFELMKRRWNVLTAATA

Samples

Sample ID Description Type Environment
1 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.07
Nodule 0
Rhizoplane 2.08
Rhizosphere 88.28
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1025063 3300003771 Bacteria 1926
2 Ga0055536_1002489 3300003781 Bacteria 10336
3 Ga0055534_1015069 3300003784 Bacteria 1427
4 Ga0055530_10001698 3300003791 Bacteria 15597
5 Ga0055531_10021853 3300003794 Bacteria 2463
6 Ga0055531_10042688 3300003794 Bacteria 1293
7 Ga0065715_10242759 3300005293 Bacteria 1193
8 Ga0070676_10036455 3300005328 Bacteria 2833
9 Ga0070666_10069556 3300005335 Bacteria 2393
10 Ga0070666_10089581 3300005335 Bacteria 2112
11 Ga0070666_10714580 3300005335 Bacteria 735
12 Ga0070682_100416671 3300005337 Bacteria 1020
13 Ga0068868_100231303 3300005338 Bacteria 1551
14 Ga0068868_100272896 3300005338 Bacteria 1429
15 Ga0068868_100749586 3300005338 Bacteria 877
16 Ga0070689_100038431 3300005340 Bacteria 3662
17 Ga0070661_101004865 3300005344 Bacteria 692
18 Ga0070668_100039889 3300005347 Bacteria 3591
19 Ga0070668_100471635 3300005347 Bacteria 1082
20 Ga0070669_100056245 3300005353 Bacteria 2885
21 Ga0070675_100033518 3300005354 Bacteria 4164
22 Ga0070675_100196211 3300005354 Bacteria 1751
23 Ga0070675_100628903 3300005354 Bacteria 975
24 Ga0070671_100207023 3300005355 Bacteria 1664
25 Ga0070671_100803268 3300005355 Bacteria 819
26 Ga0070674_100358390 3300005356 Bacteria 1180
27 Ga0070673_100239563 3300005364 Bacteria 1577
28 Ga0070673_100301794 3300005364 Bacteria 1410
29 Ga0070667_100035918 3300005367 Bacteria 4153
30 Ga0070667_100107663 3300005367 Bacteria 2414
31 Ga0070709_10162942 3300005434 Bacteria 1552
32 Ga0070713_101125411 3300005436 Unclassified 759
33 Ga0070663_100186726 3300005455 Bacteria 1611
34 Ga0070678_100005647 3300005456 Bacteria 7262
35 Ga0070678_100056756 3300005456 Bacteria 2865
36 Ga0070678_100216998 3300005456 Bacteria 1588
37 Ga0070662_100228843 3300005457 Bacteria 1487
38 Ga0070662_100300905 3300005457 Bacteria 1303
39 Ga0070662_100410599 3300005457 Bacteria 1119
40 Ga0070681_10000012 3300005458 Bacteria 137191
41 Ga0068867_100307246 3300005459 Bacteria 1309
42 Ga0068867_100688340 3300005459 Bacteria 901
43 Ga0068867_100720519 3300005459 Bacteria 882
44 Ga0070685_10000478 3300005466 Bacteria 23329
45 Ga0070679_100308809 3300005530 Bacteria 1532
46 Ga0068853_100027060 3300005539 Bacteria 4819
47 Ga0068853_100186835 3300005539 Bacteria 1881
48 Ga0068853_101050040 3300005539 Bacteria 785
49 Ga0070672_100009214 3300005543 Bacteria 6796
50 Ga0070672_100232796 3300005543 Unclassified 1548
51 Ga0070696_101172834 3300005546 Bacteria 648
52 Ga0070693_100160566 3300005547 Bacteria 1431
53 Ga0070665_100000275 3300005548 Bacteria 84583
54 Ga0070665_100104707 3300005548 Bacteria 2831
55 Ga0070665_100658907 3300005548 Bacteria 1060
56 Ga0068855_100525845 3300005563 Bacteria 1283
57 Ga0068855_100665635 3300005563 Bacteria 1117
58 Ga0070664_100817445 3300005564 Unclassified 872
59 Ga0068857_100181745 3300005577 Bacteria 1914
60 Ga0068857_100455008 3300005577 Bacteria 1197
61 Ga0068856_100023204 3300005614 Bacteria 6035
62 Ga0068856_100736649 3300005614 Unclassified 1006
63 Ga0068852_100041004 3300005616 Bacteria 3910
64 Ga0068852_100088920 3300005616 Bacteria 2760
65 Ga0068852_100211553 3300005616 Bacteria 1840
66 Ga0068852_100682998 3300005616 Bacteria 1036
67 Ga0068859_100679309 3300005617 Bacteria 1121
68 Ga0068859_101053177 3300005617 Bacteria 894
69 Ga0068864_100036628 3300005618 Bacteria 4182
70 Ga0068864_100182643 3300005618 Bacteria 1918
71 Ga0068851_10241335 3300005834 Bacteria 1022
72 Ga0068870_10024050 3300005840 Bacteria 3012
73 Ga0068863_100096998 3300005841 Bacteria 2799
74 Ga0068863_100126148 3300005841 Bacteria 2442
75 Ga0068863_100464557 3300005841 Bacteria 1243
76 Ga0068858_100370189 3300005842 Bacteria 1374
77 Ga0068858_100725349 3300005842 Bacteria 968
78 Ga0068860_100155348 3300005843 Bacteria 2205
79 Ga0068860_100194896 3300005843 Bacteria 1962
80 Ga0068860_100694942 3300005843 Bacteria 1027
81 Ga0068862_100970465 3300005844 Bacteria 839
82 Ga0097621_100015452 3300006237 Bacteria 5743
83 Ga0097621_100059551 3300006237 Bacteria 3127
84 Ga0097621_100081730 3300006237 Bacteria 2690
85 Ga0097621_100222107 3300006237 Bacteria 1646
86 Ga0097621_100399159 3300006237 Bacteria 1231
87 Ga0097621_100673571 3300006237 Bacteria 951
88 Ga0068871_100043582 3300006358 Bacteria 3604
89 Ga0068871_100124735 3300006358 Bacteria 2178
90 Ga0075434_101583669 3300006871 Bacteria 664
91 Ga0068865_100338899 3300006881 Bacteria 1215
92 Ga0068865_100357333 3300006881 Bacteria 1185
93 Ga0068865_100638737 3300006881 Bacteria 903
94 Ga0068865_100720535 3300006881 Bacteria 854
95 Ga0097620_100679297 3300006931 Bacteria 1121
96 Ga0097620_101052899 3300006931 Bacteria 894
97 Ga0105240_10001483 3300009093 Bacteria 39925
98 Ga0105240_10405760 3300009093 Bacteria 1534
99 Ga0105240_10573644 3300009093 Bacteria 1245
100 Ga0105243_10745157 3300009148 Bacteria 960
101 Ga0105241_10308610 3300009174 Bacteria 1360
102 Ga0105241_10332562 3300009174 Bacteria 1313
103 Ga0105242_10070722 3300009176 Bacteria 2894
104 Ga0105242_10098820 3300009176 Bacteria 2469
105 Ga0105248_10353966 3300009177 Bacteria 1653
106 Ga0105248_11730671 3300009177 Bacteria 709
107 Ga0105237_10050351 3300009545 Bacteria 4185
108 Ga0105237_10455483 3300009545 Bacteria 1285
109 Ga0105237_10729431 3300009545 Bacteria 997
110 Ga0105238_10008818 3300009551 Bacteria 10089
111 Ga0105238_10034057 3300009551 Bacteria 5184
112 Ga0105238_10067465 3300009551 Bacteria 3579
113 Ga0105238_10285109 3300009551 Bacteria 1633
114 Ga0105238_10702165 3300009551 Bacteria 1023
115 Ga0105249_10047791 3300009553 Bacteria 3900
116 Ga0105249_10315437 3300009553 Bacteria 1573
117 Ga0105249_10709840 3300009553 Bacteria 1066
118 Ga0105239_10063797 3300010375 Bacteria 4044
119 Ga0105239_10128117 3300010375 Bacteria 2822
120 Ga0105239_10760664 3300010375 Bacteria 1109
121 Ga0157326_1034892 3300012513 Bacteria 682
122 Ga0157370_10026760 3300013104 Bacteria 5691
123 Ga0157369_10000030 3300013105 Bacteria 203569
124 Ga0157374_10074656 3300013296 Bacteria 3203
125 Ga0157374_10767383 3300013296 Bacteria 979
126 Ga0157378_10000084 3300013297 Bacteria 87722
127 Ga0157378_10101355 3300013297 Bacteria 2629
128 Ga0157378_10371248 3300013297 Bacteria 1403
129 Ga0157378_10476724 3300013297 Bacteria 1243
130 Ga0163162_10000739 3300013306 Bacteria 30363
131 Ga0163162_10079590 3300013306 Bacteria 3343
132 Ga0157372_10064185 3300013307 Bacteria 4120
133 Ga0157372_10259249 3300013307 Bacteria 2019
134 Ga0157375_10033239 3300013308 Bacteria 4899
135 Ga0157375_10523952 3300013308 Bacteria 1348
136 Ga0163163_10001170 3300014325 Bacteria 22285
137 Ga0182008_10175873 3300014497 Bacteria 1082
138 Ga0157379_10132832 3300014968 Bacteria 2241
139 Ga0157379_10254876 3300014968 Bacteria 1594
140 Ga0157376_10000530 3300014969 Bacteria 24516
141 Ga0157376_10003435 3300014969 Bacteria 10903
142 Ga0157376_10052443 3300014969 Bacteria 3391
143 Ga0157376_10084853 3300014969 Bacteria 2728
144 Ga0157376_10122172 3300014969 Unclassified 2310
145 Ga0157376_10583909 3300014969 Bacteria 1110
146 Ga0182007_10044440 3300015262 Bacteria 1474
147 Ga0163161_11175630 3300017792 Bacteria 662
148 Ga0209233_1004206 3300025261 Bacteria 4937
149 Ga0209130_1006765 3300025284 Bacteria 3664
150 Ga0209675_1006360 3300025291 Bacteria 4752
151 Ga0209675_1008065 3300025291 Bacteria 3933
152 Ga0209676_1000875 3300025292 Bacteria 38585
153 Ga0209676_1004110 3300025292 Bacteria 8295
154 Ga0209676_1004817 3300025292 Bacteria 7326
155 Ga0209676_1008716 3300025292 Bacteria 4477
156 Ga0209676_1008719 3300025292 Bacteria 4475
157 Ga0209676_1023227 3300025292 Bacteria 2033
158 Ga0209025_1030247 3300025294 Bacteria 2596
159 Ga0209025_1063391 3300025294 Bacteria 1364
160 Ga0209564_1004360 3300025295 Bacteria 8704
161 Ga0209564_1005762 3300025295 Bacteria 6916
162 Ga0209758_1018600 3300025297 Bacteria 3394
163 Ga0209050_1001382 3300025298 Bacteria 26440
164 Ga0209050_1016072 3300025298 Bacteria 3090
165 Ga0209256_1002134 3300025299 Bacteria 17096
166 Ga0207426_1081122 3300025302 Bacteria 880
167 Ga0209051_1019372 3300025303 Bacteria 2972
168 Ga0209257_1000343 3300025304 Bacteria 96876
169 Ga0209257_1001069 3300025304 Bacteria 36154
170 Ga0209257_1002349 3300025304 Bacteria 19030
171 Ga0209257_1013596 3300025304 Bacteria 3598
172 Ga0207692_10650893 3300025898 Bacteria 681
173 Ga0207680_10021968 3300025903 Bacteria 3463
174 Ga0207680_10027214 3300025903 Bacteria 3181
175 Ga0207680_10312392 3300025903 Bacteria 1097
176 Ga0207647_10000156 3300025904 Bacteria 54063
177 Ga0207685_10046035 3300025905 Bacteria 1658
178 Ga0207699_10136759 3300025906 Bacteria 1606
179 Ga0207645_10050533 3300025907 Bacteria 2655
180 Ga0207643_10070706 3300025908 Bacteria 2008
181 Ga0207654_10000431 3300025911 Bacteria 24054
182 Ga0207654_10432298 3300025911 Bacteria 920
183 Ga0207707_10000544 3300025912 Bacteria 38374
184 Ga0207695_10000032 3300025913 Bacteria 521283
185 Ga0207695_10003293 3300025913 Bacteria 22933
186 Ga0207671_10008539 3300025914 Bacteria 8669
187 Ga0207649_10258574 3300025920 Bacteria 1257
188 Ga0207652_10216453 3300025921 Bacteria 1726
189 Ga0207681_10255274 3300025923 Bacteria 1370
190 Ga0207694_10001076 3300025924 Bacteria 23744
191 Ga0207694_10005817 3300025924 Bacteria 9450
192 Ga0207694_10028960 3300025924 Bacteria 4223
193 Ga0207694_10080957 3300025924 Bacteria 2550
194 Ga0207694_10406555 3300025924 Bacteria 1132
195 Ga0207650_10111619 3300025925 Bacteria 2117
196 Ga0207650_10760231 3300025925 Bacteria 820
197 Ga0207659_10082603 3300025926 Bacteria 2379
198 Ga0207659_10093628 3300025926 Bacteria 2249
199 Ga0207659_10428264 3300025926 Bacteria 1111
200 Ga0207687_10367655 3300025927 Bacteria 1175
201 Ga0207644_10178249 3300025931 Bacteria 1664
202 Ga0207644_10366405 3300025931 Bacteria 1173
203 Ga0207706_10060510 3300025933 Bacteria 3335
204 Ga0207706_10425682 3300025933 Bacteria 1150
205 Ga0207706_10841603 3300025933 Bacteria 777
206 Ga0207686_10051544 3300025934 Bacteria 2564
207 Ga0207686_10161724 3300025934 Bacteria 1570
208 Ga0207709_10397920 3300025935 Bacteria 1052
209 Ga0207670_10087212 3300025936 Bacteria 2198
210 Ga0207669_10360672 3300025937 Bacteria 1126
211 Ga0207704_10366040 3300025938 Bacteria 1127
212 Ga0207704_10479467 3300025938 Bacteria 998
213 Ga0207691_10042746 3300025940 Bacteria 4176
214 Ga0207691_10254997 3300025940 Bacteria 1513
215 Ga0207711_10206489 3300025941 Bacteria 1794
216 Ga0207711_10289798 3300025941 Bacteria 1509
217 Ga0207689_10201700 3300025942 Bacteria 1642
218 Ga0207679_10178442 3300025945 Bacteria 1755
219 Ga0207651_10221504 3300025960 Bacteria 1530
220 Ga0207651_10229528 3300025960 Bacteria 1506
221 Ga0207651_10454459 3300025960 Bacteria 1099
222 Ga0207712_10049413 3300025961 Bacteria 2930
223 Ga0207712_10188253 3300025961 Bacteria 1627
224 Ga0207668_10049807 3300025972 Bacteria 2882
225 Ga0207668_10344689 3300025972 Bacteria 1244
226 Ga0207658_10028419 3300025986 Bacteria 3938
227 Ga0207658_10595905 3300025986 Bacteria 992
228 Ga0207677_10034811 3300026023 Bacteria 3265
229 Ga0207677_10137081 3300026023 Bacteria 1868
230 Ga0207639_10030212 3300026041 Bacteria 3972
231 Ga0207639_10040077 3300026041 Bacteria 3494
232 Ga0207639_10150210 3300026041 Bacteria 1950
233 Ga0207639_10395447 3300026041 Bacteria 1244
234 Ga0207678_10065860 3300026067 Bacteria 3111
235 Ga0207678_10492129 3300026067 Bacteria 1068
236 Ga0207702_10005359 3300026078 Bacteria 11236
237 Ga0207641_10045888 3300026088 Bacteria 3682
238 Ga0207641_10662910 3300026088 Bacteria 1025
239 Ga0207641_11469213 3300026088 Bacteria 683
240 Ga0207648_10003396 3300026089 Bacteria 16707
241 Ga0207648_10084113 3300026089 Bacteria 2775
242 Ga0207676_10013247 3300026095 Bacteria 5923
243 Ga0207674_10262195 3300026116 Bacteria 1675
244 Ga0207674_10979684 3300026116 Bacteria 814
245 Ga0207683_10016152 3300026121 Bacteria 6354
246 Ga0207683_10043117 3300026121 Bacteria 3941
247 Ga0207683_10114287 3300026121 Bacteria 2419
248 Ga0207698_10016706 3300026142 Bacteria 4957
249 Ga0207698_10319948 3300026142 Bacteria 1452
250 Ga0207698_10788193 3300026142 Bacteria 952
251 Ga0209970_1002178 3300027614 Bacteria 3361
252 Ga0268266_10000013 3300028379 Bacteria 649715
253 Ga0268266_10246697 3300028379 Bacteria 1650
254 Ga0268266_10499676 3300028379 Bacteria 1161
255 Ga0268264_10013515 3300028381 Bacteria 6723
256 Ga0268264_10378232 3300028381 Bacteria 1355
257 Ga0314311_1207769 3300030733 Bacteria 3131
258 Ga0307516_10015888 3300031730 Bacteria 7899
259 Ga0307413_10026485 3300031824 Bacteria 3196
260 Ga0307413_10170665 3300031824 Bacteria 1539
261 Ga0307413_10273357 3300031824 Bacteria 1266
262 Ga0307416_100048508 3300032002 Bacteria 3370
263 Ga0307414_10005555 3300032004 Bacteria 6955
264 Ga0307414_10063592 3300032004 Bacteria 2623
265 Ga0307414_10141935 3300032004 Bacteria 1882
266 Ga0307414_10279638 3300032004 Bacteria 1402
267 Ga0373944_0007881 3300035089 Bacteria 2867
268 Ga0373957_0113811 3300035120 Bacteria 1091
269 Ga0373955_0257357 3300035172 Bacteria 1047
270 Ga0373924_0091261 3300035410 Bacteria 1303
271 Ga0373927_0340506 3300035695 Bacteria 988
272 Ga0373933_0075544 3300035724 Bacteria 2057
273 Ga0373937_0028597 3300036401 Bacteria 5045
274 Ga0373925_0041022 3300037068 Bacteria 3429
275 Ga0373925_0055646 3300037068 Bacteria 2962
276 Ga0439432_018692 3300042006 Bacteria 2314
277 Ga0451577_0438153 3300042876 Bacteria 1186
278 Ga0466967_0251975 3300045976 Bacteria 1687
279 Ga0495580_0037848 3300046472 Bacteria 3459
280 Ga0495582_0024551 3300046473 Bacteria 3299
281 Ga0495639_0019661 3300046475 Bacteria 2947
282 Ga0495662_0255229 3300046476 Bacteria 863
283 Ga0495630_0070954 3300046517 Bacteria 2621
284 Ga0495663_0056252 3300046525 Bacteria 1228
285 Ga0495652_0323583 3300046529 Bacteria 1113
286 Ga0495665_0140632 3300046531 Bacteria 1262
287 Ga0495645_0225934 3300046543 Bacteria 1256
288 Ga0495656_0033224 3300046615 Bacteria 2104
289 Ga0495656_0445703 3300046615 Bacteria 681
290 Ga0495668_0216627 3300046616 Bacteria 1048
291 Ga0495668_0370043 3300046616 Bacteria 787
292 Ga0495635_0057000 3300046663 Bacteria 2689
293 Ga0495599_0209128 3300046678 Bacteria 1197
294 Ga0495646_0418595 3300046680 Unclassified 695
295 Ga0495647_0023984 3300046681 Bacteria 2217
296 Ga0495647_0315623 3300046681 Bacteria 707
297 Ga0495658_0002591 3300046683 Bacteria 9098
298 Ga0495670_0030257 3300046691 Bacteria 2690
299 Ga0495670_0527504 3300046691 Bacteria 642
300 Ga0495600_0214015 3300046809 Bacteria 1234
301 Ga0495636_0019011 3300047318 Bacteria 2758
302 Ga0495636_0161979 3300047318 Bacteria 1008
303 Ga0495674_0185059 3300047319 Bacteria 1733
304 Ga0495677_0114063 3300047445 Bacteria 1028
305 Ga0495684_0035389 3300047471 Bacteria 3830
306 Ga0495602_0165309 3300048088 Bacteria 1723
307 Ga0495615_0137197 3300048090 Bacteria 719
308 Ga0496104_0000041 3300048907 Bacteria 161394
309 Ga0496105_0000022 3300048908 Bacteria 161208
310 Ga0496107_0160075 3300048910 Bacteria 1668
311 Ga0496108_0162989 3300048911 Bacteria 1927
312 Ga0496109_0085138 3300048912 Bacteria 2917
313 Ga0496112_0127560 3300048915 Bacteria 2515
314 Ga0496113_0123573 3300048916 Bacteria 2025
315 Ga0496115_0000487 3300048918 Bacteria 31378
316 Ga0496118_0009999 3300048921 Bacteria 9467
317 Ga0496118_0013485 3300048921 Bacteria 7724
318 Ga0496125_0377452 3300048928 Bacteria 837
319 Ga0496126_0000553 3300048929 Bacteria 72027
320 Ga0496126_0087755 3300048929 Bacteria 2741
321 Ga0501032_0019634 3300049569 Bacteria 4724
322 Ga0501032_0020138 3300049569 Bacteria 4651
323 Ga0501033_0001518 3300049570 Bacteria 20530
324 Ga0501034_0001511 3300049571 Bacteria 30549
325 Ga0501034_0016050 3300049571 Bacteria 7685
326 Ga0501034_0080591 3300049571 Bacteria 3258
327 Ga0501036_0039039 3300049572 Bacteria 4020
328 Ga0501036_0117204 3300049572 Bacteria 2249
329 Ga0501037_0033194 3300049573 Bacteria 3813
330 Ga0501038_0024673 3300049574 Bacteria 5361
331 Ga0501038_0321720 3300049574 Bacteria 1210
332 Ga0501039_0107740 3300049575 Bacteria 2177
333 Ga0501043_0036019 3300049579 Bacteria 3892
334 Ga0501043_0049724 3300049579 Bacteria 3296
335 Ga0501043_0117547 3300049579 Bacteria 2086
336 Ga0501046_0108112 3300049580 Bacteria 2127
337 Ga0501046_0963055 3300049580 Bacteria 593
338 Ga0501047_0000238 3300049581 Bacteria 65182
339 Ga0501047_0035041 3300049581 Bacteria 4847
340 Ga0501047_0431499 3300049581 Bacteria 1148
341 Ga0501067_0000055 3300049583 Bacteria 66700
342 Ga0501068_0010110 3300049584 Bacteria 5293
343 Ga0501069_0009958 3300049585 Bacteria 5025
344 Ga0501069_0260749 3300049585 Bacteria 1012
345 Ga0501069_0296970 3300049585 Bacteria 947
346 Ga0501069_0494739 3300049585 Bacteria 729
347 Ga0501070_0000656 3300049586 Bacteria 31887
348 Ga0501070_0002150 3300049586 Bacteria 17318
349 Ga0501070_0036709 3300049586 Bacteria 4092
350 Ga0501070_0047181 3300049586 Bacteria 3581
351 Ga0501070_0070336 3300049586 Bacteria 2898
352 Ga0501070_0263962 3300049586 Bacteria 1407
353 Ga0501070_0506512 3300049586 Bacteria 969
354 Ga0501073_0001777 3300049589 Bacteria 16029
355 Ga0501073_0027306 3300049589 Bacteria 4084
356 Ga0501073_0051546 3300049589 Bacteria 2883
357 Ga0501074_0009579 3300049590 Bacteria 7031
358 Ga0501074_0112672 3300049590 Bacteria 1946
359 Ga0501074_0167141 3300049590 Bacteria 1570
360 Ga0501259_030140 3300049688 Bacteria 1019
361 Ga0501079_0074952 3300049741 Bacteria 2616
362 Ga0501079_0107342 3300049741 Bacteria 2167
363 Ga0501080_0099154 3300049742 Bacteria 2703
364 Ga0501080_0146271 3300049742 Bacteria 2184
365 Ga0501080_0173209 3300049742 Bacteria 1989
366 Ga0501080_0325207 3300049742 Bacteria 1391
367 Ga0501080_0341121 3300049742 Bacteria 1354
368 Ga0501083_0004238 3300049744 Bacteria 10094
369 Ga0501083_0373873 3300049744 Bacteria 927
370 Ga0501083_0680537 3300049744 Bacteria 669
371 Ga0501035_0007657 3300049822 Bacteria 10090
372 Ga0501035_0105575 3300049822 Bacteria 2470
373 Ga0501044_0001225 3300049823 Bacteria 30477
374 Ga0501044_0018739 3300049823 Bacteria 7413
375 Ga0501044_0468459 3300049823 Bacteria 1164
376 Ga0501045_0278281 3300049824 Bacteria 1246
377 nmdc:mga0n895_1260263_c1 3300050512 Bacteria 711
378 Ga0500614_076959 3300053123 Bacteria 926
379 Ga0501084_0017804 3300054114 Bacteria 5913
380 Ga0501084_0103407 3300054114 Bacteria 2392
381 Ga0501084_0153143 3300054114 Bacteria 1944
382 Ga0501082_0031126 3300060353 Bacteria 4599
383 Ga0501082_0111504 3300060353 Bacteria 2368

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0108112 Ga0501046_0108112_24_563 152
2 3300049580 Ga0501046_0963055 Ga0501046_0963055_20_559 152
3 3300049585 Ga0501069_0260749 Ga0501069_0260749_454_993 152
4 3300049744 Ga0501083_0680537 Ga0501083_0680537_24_563 152
5 3300049823 Ga0501044_0468459 Ga0501044_0468459_591_1130 152
6 3300042876 Ga0451577_0438153 Ga0451577_0438153_320_850 153
7 3300025898 Ga0207692_10650893 Ga0207692_106508931 156
8 3300037068 Ga0373925_0055646 Ga0373925_0055646_1183_1722 156
9 3300005335 Ga0070666_10089581 Ga0070666_100895813 157
10 3300005338 Ga0068868_100231303 Ga0068868_1002313032 157
11 3300005456 Ga0070678_100216998 Ga0070678_1002169981 157
12 3300005457 Ga0070662_100300905 Ga0070662_1003009052 157
13 3300005563 Ga0068855_100665635 Ga0068855_1006656351 157
14 3300006881 Ga0068865_100720535 Ga0068865_1007205351 157
15 3300010375 Ga0105239_10760664 Ga0105239_107606641 157
16 3300025903 Ga0207680_10021968 Ga0207680_100219682 157
17 3300025931 Ga0207644_10366405 Ga0207644_103664052 157
18 3300025933 Ga0207706_10841603 Ga0207706_108416032 157
19 3300026023 Ga0207677_10137081 Ga0207677_101370812 157
20 3300026041 Ga0207639_10395447 Ga0207639_103954472 157
21 3300026088 Ga0207641_11469213 Ga0207641_114692131 157
22 3300026116 Ga0207674_10979684 Ga0207674_109796842 157
23 3300028379 Ga0268266_10499676 Ga0268266_104996762 157
24 3300049575 Ga0501039_0107740 Ga0501039_0107740_226_804 157
25 3300049579 Ga0501043_0117547 Ga0501043_0117547_346_924 157
26 3300049742 Ga0501080_0341121 Ga0501080_0341121_586_1164 157
27 3300005434 Ga0070709_10162942 Ga0070709_101629423 158
28 3300005614 Ga0068856_100023204 Ga0068856_1000232045 158
29 3300005616 Ga0068852_100682998 Ga0068852_1006829982 158
30 3300005841 Ga0068863_100096998 Ga0068863_1000969982 158
31 3300006237 Ga0097621_100081730 Ga0097621_1000817303 158
32 3300006237 Ga0097621_100222107 Ga0097621_1002221073 158
33 3300006881 Ga0068865_100338899 Ga0068865_1003388992 158
34 3300009093 Ga0105240_10405760 Ga0105240_104057602 158
35 3300009545 Ga0105237_10050351 Ga0105237_100503513 158
36 3300009551 Ga0105238_10008818 Ga0105238_100088183 158
37 3300009551 Ga0105238_10067465 Ga0105238_100674653 158
38 3300009553 Ga0105249_10047791 Ga0105249_100477915 158
39 3300010375 Ga0105239_10063797 Ga0105239_100637976 158
40 3300013105 Ga0157369_10000030 Ga0157369_1000003036 158
41 3300013297 Ga0157378_10371248 Ga0157378_103712481 158
42 3300013308 Ga0157375_10523952 Ga0157375_105239523 158
43 3300014969 Ga0157376_10052443 Ga0157376_100524432 158
44 3300025906 Ga0207699_10136759 Ga0207699_101367592 158
45 3300025913 Ga0207695_10003293 Ga0207695_1000329323 158
46 3300025914 Ga0207671_10008539 Ga0207671_100085393 158
47 3300025924 Ga0207694_10028960 Ga0207694_100289604 158
48 3300025924 Ga0207694_10080957 Ga0207694_100809573 158
49 3300025938 Ga0207704_10479467 Ga0207704_104794671 158
50 3300025961 Ga0207712_10049413 Ga0207712_100494133 158
51 3300026078 Ga0207702_10005359 Ga0207702_100053593 158
52 3300026088 Ga0207641_10045888 Ga0207641_100458883 158
53 3300026142 Ga0207698_10788193 Ga0207698_107881932 158
54 3300005335 Ga0070666_10069556 Ga0070666_100695563 159
55 3300005337 Ga0070682_100416671 Ga0070682_1004166712 159
56 3300005340 Ga0070689_100038431 Ga0070689_1000384313 159
57 3300005344 Ga0070661_101004865 Ga0070661_1010048651 159
58 3300005347 Ga0070668_100471635 Ga0070668_1004716352 159
59 3300005354 Ga0070675_100196211 Ga0070675_1001962113 159
60 3300005354 Ga0070675_100628903 Ga0070675_1006289031 159
61 3300005355 Ga0070671_100207023 Ga0070671_1002070232 159
62 3300005364 Ga0070673_100301794 Ga0070673_1003017941 159
63 3300005436 Ga0070713_101125411 Ga0070713_1011254111 159
64 3300005456 Ga0070678_100005647 Ga0070678_1000056475 159
65 3300005457 Ga0070662_100228843 Ga0070662_1002288432 159
66 3300005459 Ga0068867_100307246 Ga0068867_1003072462 159
67 3300005530 Ga0070679_100308809 Ga0070679_1003088092 159
68 3300005539 Ga0068853_100186835 Ga0068853_1001868352 159
69 3300005543 Ga0070672_100232796 Ga0070672_1002327962 159
70 3300005548 Ga0070665_100658907 Ga0070665_1006589072 159
71 3300005563 Ga0068855_100525845 Ga0068855_1005258451 159
72 3300005577 Ga0068857_100181745 Ga0068857_1001817451 159
73 3300005616 Ga0068852_100211553 Ga0068852_1002115533 159
74 3300005618 Ga0068864_100182643 Ga0068864_1001826432 159
75 3300005841 Ga0068863_100126148 Ga0068863_1001261481 159
76 3300005841 Ga0068863_100464557 Ga0068863_1004645572 159
77 3300005842 Ga0068858_100725349 Ga0068858_1007253492 159
78 3300005843 Ga0068860_100155348 Ga0068860_1001553484 159
79 3300005843 Ga0068860_100694942 Ga0068860_1006949421 159
80 3300005844 Ga0068862_100970465 Ga0068862_1009704651 159
81 3300006237 Ga0097621_100015452 Ga0097621_1000154523 159
82 3300006237 Ga0097621_100059551 Ga0097621_1000595514 159
83 3300006358 Ga0068871_100043582 Ga0068871_1000435824 159
84 3300006358 Ga0068871_100124735 Ga0068871_1001247351 159
85 3300006871 Ga0075434_101583669 Ga0075434_1015836691 159
86 3300006881 Ga0068865_100638737 Ga0068865_1006387372 159
87 3300009093 Ga0105240_10573644 Ga0105240_105736442 159
88 3300009148 Ga0105243_10745157 Ga0105243_107451572 159
89 3300009174 Ga0105241_10332562 Ga0105241_103325622 159
90 3300009176 Ga0105242_10070722 Ga0105242_100707223 159
91 3300009176 Ga0105242_10098820 Ga0105242_100988204 159
92 3300009177 Ga0105248_10353966 Ga0105248_103539662 159
93 3300009177 Ga0105248_11730671 Ga0105248_117306712 159
94 3300009551 Ga0105238_10702165 Ga0105238_107021652 159
95 3300013296 Ga0157374_10074656 Ga0157374_100746562 159
96 3300013297 Ga0157378_10000084 Ga0157378_1000008417 159
97 3300013297 Ga0157378_10476724 Ga0157378_104767241 159
98 3300013306 Ga0163162_10000739 Ga0163162_1000073920 159
99 3300013306 Ga0163162_10079590 Ga0163162_100795905 159
100 3300013307 Ga0157372_10259249 Ga0157372_102592491 159
101 3300013308 Ga0157375_10033239 Ga0157375_100332393 159
102 3300014969 Ga0157376_10000530 Ga0157376_100005302 159
103 3300014969 Ga0157376_10003435 Ga0157376_100034356 159
104 3300014969 Ga0157376_10084853 Ga0157376_100848533 159
105 3300014969 Ga0157376_10122172 Ga0157376_101221721 159
106 3300014969 Ga0157376_10583909 Ga0157376_105839092 159
107 3300025903 Ga0207680_10027214 Ga0207680_100272143 159
108 3300025905 Ga0207685_10046035 Ga0207685_100460351 159
109 3300025911 Ga0207654_10432298 Ga0207654_104322981 159
110 3300025920 Ga0207649_10258574 Ga0207649_102585742 159
111 3300025921 Ga0207652_10216453 Ga0207652_102164532 159
112 3300025924 Ga0207694_10406555 Ga0207694_104065551 159
113 3300025926 Ga0207659_10093628 Ga0207659_100936282 159
114 3300025926 Ga0207659_10428264 Ga0207659_104282641 159
115 3300025927 Ga0207687_10367655 Ga0207687_103676551 159
116 3300025931 Ga0207644_10178249 Ga0207644_101782492 159
117 3300025933 Ga0207706_10060510 Ga0207706_100605102 159
118 3300025934 Ga0207686_10051544 Ga0207686_100515443 159
119 3300025935 Ga0207709_10397920 Ga0207709_103979202 159
120 3300025936 Ga0207670_10087212 Ga0207670_100872122 159
121 3300025937 Ga0207669_10360672 Ga0207669_103606722 159
122 3300025940 Ga0207691_10254997 Ga0207691_102549972 159
123 3300025941 Ga0207711_10206489 Ga0207711_102064892 159
124 3300025942 Ga0207689_10201700 Ga0207689_102017001 159
125 3300025960 Ga0207651_10229528 Ga0207651_102295281 159
126 3300025972 Ga0207668_10344689 Ga0207668_103446892 159
127 3300026041 Ga0207639_10030212 Ga0207639_100302122 159
128 3300026041 Ga0207639_10150210 Ga0207639_101502103 159
129 3300026088 Ga0207641_10662910 Ga0207641_106629102 159
130 3300026089 Ga0207648_10003396 Ga0207648_100033966 159
131 3300026116 Ga0207674_10262195 Ga0207674_102621953 159
132 3300026121 Ga0207683_10043117 Ga0207683_100431173 159
133 3300026121 Ga0207683_10114287 Ga0207683_101142873 159
134 3300028381 Ga0268264_10013515 Ga0268264_100135158 159
135 3300028381 Ga0268264_10378232 Ga0268264_103782322 159
136 3300035089 Ga0373944_0007881 Ga0373944_0007881_634_1191 159
137 3300035120 Ga0373957_0113811 Ga0373957_0113811_101_658 159
138 3300035172 Ga0373955_0257357 Ga0373955_0257357_448_1005 159
139 3300035410 Ga0373924_0091261 Ga0373924_0091261_593_1150 159
140 3300035695 Ga0373927_0340506 Ga0373927_0340506_253_810 159
141 3300035724 Ga0373933_0075544 Ga0373933_0075544_233_790 159
142 3300036401 Ga0373937_0028597 Ga0373937_0028597_2113_2670 159
143 3300037068 Ga0373925_0041022 Ga0373925_0041022_117_674 159
144 3300045976 Ga0466967_0251975 Ga0466967_0251975_162_719 159
145 3300046472 Ga0495580_0037848 Ga0495580_0037848_1703_2260 159
146 3300046473 Ga0495582_0024551 Ga0495582_0024551_2411_2968 159
147 3300046475 Ga0495639_0019661 Ga0495639_0019661_1050_1607 159
148 3300046476 Ga0495662_0255229 Ga0495662_0255229_238_795 159
149 3300046517 Ga0495630_0070954 Ga0495630_0070954_792_1349 159
150 3300046529 Ga0495652_0323583 Ga0495652_0323583_476_1033 159
151 3300046531 Ga0495665_0140632 Ga0495665_0140632_403_1023 159
152 3300046543 Ga0495645_0225934 Ga0495645_0225934_427_984 159
153 3300046663 Ga0495635_0057000 Ga0495635_0057000_442_999 159
154 3300046678 Ga0495599_0209128 Ga0495599_0209128_403_960 159
155 3300046680 Ga0495646_0418595 Ga0495646_0418595_80_637 159
156 3300046681 Ga0495647_0023984 Ga0495647_0023984_1257_1814 159
157 3300046681 Ga0495647_0315623 Ga0495647_0315623_131_688 159
158 3300046683 Ga0495658_0002591 Ga0495658_0002591_3580_4137 159
159 3300046809 Ga0495600_0214015 Ga0495600_0214015_228_785 159
160 3300047319 Ga0495674_0185059 Ga0495674_0185059_641_1198 159
161 3300047471 Ga0495684_0035389 Ga0495684_0035389_1906_2463 159
162 3300048088 Ga0495602_0165309 Ga0495602_0165309_338_895 159
163 3300048907 Ga0496104_0000041 Ga0496104_0000041_156306_156872 159
164 3300048908 Ga0496105_0000022 Ga0496105_0000022_156166_156732 159
165 3300048918 Ga0496115_0000487 Ga0496115_0000487_109_735 159
166 3300048929 Ga0496126_0000553 Ga0496126_0000553_71276_71902 159
167 3300050512 nmdc:mga0n895_1260263_c1 nmdc:mga0n895_1260263_c1_32_589 159
168 3300053123 Ga0500614_076959 Ga0500614_076959_101_658 159
169 3300005539 Ga0068853_100027060 Ga0068853_1000270604 160
170 3300005616 Ga0068852_100041004 Ga0068852_1000410043 160
171 3300017792 Ga0163161_11175630 Ga0163161_111756301 160
172 3300026041 Ga0207639_10040077 Ga0207639_100400772 160
173 3300026142 Ga0207698_10016706 Ga0207698_100167064 160
174 3300031730 Ga0307516_10015888 Ga0307516_100158884 160
175 3300049585 Ga0501069_0296970 Ga0501069_0296970_311_880 160
176 3300049586 Ga0501070_0002150 Ga0501070_0002150_10360_10929 160
177 3300049742 Ga0501080_0325207 Ga0501080_0325207_444_1013 160
178 3300031824 Ga0307413_10026485 Ga0307413_100264851 161
179 3300031824 Ga0307413_10170665 Ga0307413_101706652 161
180 3300005539 Ga0068853_101050040 Ga0068853_1010500401 166
181 3300012513 Ga0157326_1034892 Ga0157326_10348921 166
182 3300025925 Ga0207650_10760231 Ga0207650_107602312 167
183 3300005335 Ga0070666_10714580 Ga0070666_107145801 168
184 3300005546 Ga0070696_101172834 Ga0070696_1011728341 168
185 3300009553 Ga0105249_10315437 Ga0105249_103154372 168
186 3300025941 Ga0207711_10289798 Ga0207711_102897982 168
187 3300025960 Ga0207651_10221504 Ga0207651_102215042 168
188 3300046615 Ga0495656_0445703 Ga0495656_0445703_33_599 168
189 3300048910 Ga0496107_0160075 Ga0496107_0160075_686_1252 168
190 3300048911 Ga0496108_0162989 Ga0496108_0162989_832_1398 168
191 3300048912 Ga0496109_0085138 Ga0496109_0085138_1522_2088 168
192 3300048915 Ga0496112_0127560 Ga0496112_0127560_1416_1982 168
193 3300048916 Ga0496113_0123573 Ga0496113_0123573_627_1193 168
194 3300048928 Ga0496125_0377452 Ga0496125_0377452_235_801 168
195 3300049570 Ga0501033_0001518 Ga0501033_0001518_10122_10691 168
196 3300049688 Ga0501259_030140 Ga0501259_030140_74_634 168
197 3300005293 Ga0065715_10242759 Ga0065715_102427592 169
198 3300025911 Ga0207654_10000431 Ga0207654_100004318 169
199 3300005338 Ga0068868_100749586 Ga0068868_1007495862 170
200 3300005367 Ga0070667_100035918 Ga0070667_1000359184 170
201 3300005466 Ga0070685_10000478 Ga0070685_1000047820 170
202 3300005547 Ga0070693_100160566 Ga0070693_1001605661 170
203 3300005564 Ga0070664_100817445 Ga0070664_1008174452 170
204 3300005577 Ga0068857_100455008 Ga0068857_1004550082 170
205 3300005614 Ga0068856_100736649 Ga0068856_1007366492 170
206 3300005616 Ga0068852_100088920 Ga0068852_1000889202 170
207 3300005834 Ga0068851_10241335 Ga0068851_102413352 170
208 3300006237 Ga0097621_100673571 Ga0097621_1006735712 170
209 3300009093 Ga0105240_10001483 Ga0105240_1000148320 170
210 3300009545 Ga0105237_10729431 Ga0105237_107294312 170
211 3300009551 Ga0105238_10034057 Ga0105238_100340571 170
212 3300013297 Ga0157378_10101355 Ga0157378_101013552 170
213 3300014497 Ga0182008_10175873 Ga0182008_101758732 170
214 3300025261 Ga0209233_1004206 Ga0209233_10042063 170
215 3300025913 Ga0207695_10000032 Ga0207695_1000003287 170
216 3300025924 Ga0207694_10005817 Ga0207694_100058173 170
217 3300025945 Ga0207679_10178442 Ga0207679_101784422 170
218 3300025986 Ga0207658_10028419 Ga0207658_100284194 170
219 3300026067 Ga0207678_10065860 Ga0207678_100658603 170
220 3300026142 Ga0207698_10319948 Ga0207698_103199481 170
221 3300032004 Ga0307414_10005555 Ga0307414_100055558 170
222 3300032004 Ga0307414_10279638 Ga0307414_102796382 170
223 3300046525 Ga0495663_0056252 Ga0495663_0056252_53_625 170
224 3300046691 Ga0495670_0527504 Ga0495670_0527504_19_591 170
225 3300048090 Ga0495615_0137197 Ga0495615_0137197_10_582 170
226 3300048921 Ga0496118_0013485 Ga0496118_0013485_1411_2004 170
227 3300048929 Ga0496126_0087755 Ga0496126_0087755_668_1261 170
228 3300005328 Ga0070676_10036455 Ga0070676_100364552 171
229 3300005338 Ga0068868_100272896 Ga0068868_1002728962 171
230 3300005347 Ga0070668_100039889 Ga0070668_1000398893 171
231 3300005353 Ga0070669_100056245 Ga0070669_1000562452 171
232 3300005354 Ga0070675_100033518 Ga0070675_1000335183 171
233 3300005355 Ga0070671_100803268 Ga0070671_1008032681 171
234 3300005356 Ga0070674_100358390 Ga0070674_1003583902 171
235 3300005364 Ga0070673_100239563 Ga0070673_1002395632 171
236 3300005367 Ga0070667_100107663 Ga0070667_1001076632 171
237 3300005455 Ga0070663_100186726 Ga0070663_1001867262 171
238 3300005456 Ga0070678_100056756 Ga0070678_1000567563 171
239 3300005457 Ga0070662_100410599 Ga0070662_1004105992 171
240 3300005458 Ga0070681_10000012 Ga0070681_1000001255 171
241 3300005459 Ga0068867_100688340 Ga0068867_1006883401 171
242 3300005459 Ga0068867_100720519 Ga0068867_1007205192 171
243 3300005543 Ga0070672_100009214 Ga0070672_1000092146 171
244 3300005548 Ga0070665_100000275 Ga0070665_10000027522 171
245 3300005548 Ga0070665_100104707 Ga0070665_1001047073 171
246 3300005617 Ga0068859_100679309 Ga0068859_1006793092 171
247 3300005617 Ga0068859_101053177 Ga0068859_1010531771 171
248 3300005618 Ga0068864_100036628 Ga0068864_1000366284 171
249 3300005840 Ga0068870_10024050 Ga0068870_100240503 171
250 3300005842 Ga0068858_100370189 Ga0068858_1003701892 171
251 3300005843 Ga0068860_100194896 Ga0068860_1001948961 171
252 3300006237 Ga0097621_100399159 Ga0097621_1003991592 171
253 3300006881 Ga0068865_100357333 Ga0068865_1003573332 171
254 3300006931 Ga0097620_100679297 Ga0097620_1006792972 171
255 3300006931 Ga0097620_101052899 Ga0097620_1010528992 171
256 3300009174 Ga0105241_10308610 Ga0105241_103086102 171
257 3300009545 Ga0105237_10455483 Ga0105237_104554832 171
258 3300009551 Ga0105238_10285109 Ga0105238_102851091 171
259 3300009553 Ga0105249_10709840 Ga0105249_107098402 171
260 3300010375 Ga0105239_10128117 Ga0105239_101281174 171
261 3300013104 Ga0157370_10026760 Ga0157370_100267605 171
262 3300013296 Ga0157374_10767383 Ga0157374_107673832 171
263 3300013307 Ga0157372_10064185 Ga0157372_100641852 171
264 3300014325 Ga0163163_10001170 Ga0163163_100011707 171
265 3300014968 Ga0157379_10132832 Ga0157379_101328324 171
266 3300014968 Ga0157379_10254876 Ga0157379_102548762 171
267 3300015262 Ga0182007_10044440 Ga0182007_100444402 171
268 3300025903 Ga0207680_10312392 Ga0207680_103123922 171
269 3300025904 Ga0207647_10000156 Ga0207647_100001566 171
270 3300025907 Ga0207645_10050533 Ga0207645_100505333 171
271 3300025908 Ga0207643_10070706 Ga0207643_100707061 171
272 3300025912 Ga0207707_10000544 Ga0207707_1000054414 171
273 3300025923 Ga0207681_10255274 Ga0207681_102552742 171
274 3300025924 Ga0207694_10001076 Ga0207694_1000107619 171
275 3300025925 Ga0207650_10111619 Ga0207650_101116192 171
276 3300025926 Ga0207659_10082603 Ga0207659_100826033 171
277 3300025933 Ga0207706_10425682 Ga0207706_104256822 171
278 3300025934 Ga0207686_10161724 Ga0207686_101617242 171
279 3300025938 Ga0207704_10366040 Ga0207704_103660402 171
280 3300025940 Ga0207691_10042746 Ga0207691_100427463 171
281 3300025960 Ga0207651_10454459 Ga0207651_104544592 171
282 3300025961 Ga0207712_10188253 Ga0207712_101882532 171
283 3300025972 Ga0207668_10049807 Ga0207668_100498073 171
284 3300025986 Ga0207658_10595905 Ga0207658_105959052 171
285 3300026023 Ga0207677_10034811 Ga0207677_100348114 171
286 3300026067 Ga0207678_10492129 Ga0207678_104921291 171
287 3300026089 Ga0207648_10084113 Ga0207648_100841134 171
288 3300026095 Ga0207676_10013247 Ga0207676_100132476 171
289 3300026121 Ga0207683_10016152 Ga0207683_100161523 171
290 3300027614 Ga0209970_1002178 Ga0209970_10021784 171
291 3300028379 Ga0268266_10000013 Ga0268266_10000013275 171
292 3300028379 Ga0268266_10246697 Ga0268266_102466971 171
293 3300030733 Ga0314311_1207769 Ga0314311_12077693 171
294 3300032004 Ga0307414_10063592 Ga0307414_100635923 171
295 3300042006 Ga0439432_018692 Ga0439432_018692_1131_1712 171
296 3300046615 Ga0495656_0033224 Ga0495656_0033224_595_1170 171
297 3300046691 Ga0495670_0030257 Ga0495670_0030257_1752_2327 171
298 3300047318 Ga0495636_0019011 Ga0495636_0019011_1241_1816 171
299 3300048921 Ga0496118_0009999 Ga0496118_0009999_7484_8080 171
300 3300049569 Ga0501032_0019634 Ga0501032_0019634_3877_4473 171
301 3300049571 Ga0501034_0001511 Ga0501034_0001511_25188_25784 171
302 3300049571 Ga0501034_0016050 Ga0501034_0016050_4126_4722 171
303 3300049571 Ga0501034_0080591 Ga0501034_0080591_276_872 171
304 3300049572 Ga0501036_0039039 Ga0501036_0039039_1177_1773 171
305 3300049572 Ga0501036_0117204 Ga0501036_0117204_1577_2173 171
306 3300049573 Ga0501037_0033194 Ga0501037_0033194_1270_1866 171
307 3300049574 Ga0501038_0024673 Ga0501038_0024673_3769_4365 171
308 3300049574 Ga0501038_0321720 Ga0501038_0321720_462_1058 171
309 3300049579 Ga0501043_0036019 Ga0501043_0036019_91_687 171
310 3300049579 Ga0501043_0049724 Ga0501043_0049724_1096_1692 171
311 3300049581 Ga0501047_0000238 Ga0501047_0000238_58949_59545 171
312 3300049581 Ga0501047_0035041 Ga0501047_0035041_3526_4122 171
313 3300049581 Ga0501047_0431499 Ga0501047_0431499_524_1120 171
314 3300049583 Ga0501067_0000055 Ga0501067_0000055_5666_6262 171
315 3300049584 Ga0501068_0010110 Ga0501068_0010110_2824_3420 171
316 3300049585 Ga0501069_0009958 Ga0501069_0009958_2958_3554 171
317 3300049585 Ga0501069_0494739 Ga0501069_0494739_14_610 171
318 3300049586 Ga0501070_0000656 Ga0501070_0000656_21311_21907 171
319 3300049586 Ga0501070_0036709 Ga0501070_0036709_732_1328 171
320 3300049586 Ga0501070_0047181 Ga0501070_0047181_1125_1721 171
321 3300049586 Ga0501070_0070336 Ga0501070_0070336_2233_2883 171
322 3300049586 Ga0501070_0263962 Ga0501070_0263962_131_748 171
323 3300049586 Ga0501070_0506512 Ga0501070_0506512_44_640 171
324 3300049589 Ga0501073_0001777 Ga0501073_0001777_5666_6262 171
325 3300049589 Ga0501073_0027306 Ga0501073_0027306_1632_2228 171
326 3300049589 Ga0501073_0051546 Ga0501073_0051546_106_702 171
327 3300049590 Ga0501074_0009579 Ga0501074_0009579_2686_3282 171
328 3300049590 Ga0501074_0112672 Ga0501074_0112672_213_809 171
329 3300049590 Ga0501074_0167141 Ga0501074_0167141_587_1183 171
330 3300049741 Ga0501079_0074952 Ga0501079_0074952_704_1300 171
331 3300049741 Ga0501079_0107342 Ga0501079_0107342_1551_2147 171
332 3300049742 Ga0501080_0099154 Ga0501080_0099154_630_1226 171
333 3300049742 Ga0501080_0146271 Ga0501080_0146271_686_1282 171
334 3300049742 Ga0501080_0173209 Ga0501080_0173209_276_872 171
335 3300049744 Ga0501083_0004238 Ga0501083_0004238_3897_4493 171
336 3300049744 Ga0501083_0373873 Ga0501083_0373873_284_880 171
337 3300049822 Ga0501035_0007657 Ga0501035_0007657_6225_6842 171
338 3300049822 Ga0501035_0105575 Ga0501035_0105575_1686_2282 171
339 3300049823 Ga0501044_0001225 Ga0501044_0001225_4714_5310 171
340 3300049823 Ga0501044_0018739 Ga0501044_0018739_6529_7146 171
341 3300049824 Ga0501045_0278281 Ga0501045_0278281_482_1078 171
342 3300054114 Ga0501084_0017804 Ga0501084_0017804_1956_2552 171
343 3300054114 Ga0501084_0103407 Ga0501084_0103407_108_704 171
344 3300054114 Ga0501084_0153143 Ga0501084_0153143_792_1388 171
345 3300060353 Ga0501082_0031126 Ga0501082_0031126_1464_2060 171
346 3300060353 Ga0501082_0111504 Ga0501082_0111504_619_1215 171
347 3300032004 Ga0307414_10141935 Ga0307414_101419353 172
348 3300049569 Ga0501032_0020138 Ga0501032_0020138_93_671 172
349 3300031824 Ga0307413_10273357 Ga0307413_102733572 173
350 3300032002 Ga0307416_100048508 Ga0307416_1000485083 173
351 3300046616 Ga0495668_0370043 Ga0495668_0370043_24_608 173
352 3300025292 Ga0209676_1004817 Ga0209676_10048173 174
353 3300046616 Ga0495668_0216627 Ga0495668_0216627_442_1029 175
354 3300047318 Ga0495636_0161979 Ga0495636_0161979_43_630 175
355 3300047445 Ga0495677_0114063 Ga0495677_0114063_39_626 175
356 iso_pu_bacteria 8003014200 8003015081 181
357 3300003771 Ga0055526_1025063 Ga0055526_10250632 185
358 3300003781 Ga0055536_1002489 Ga0055536_100248910 185
359 3300003784 Ga0055534_1015069 Ga0055534_10150692 185
360 3300003791 Ga0055530_10001698 Ga0055530_1000169815 185
361 3300003794 Ga0055531_10021853 Ga0055531_100218533 185
362 3300003794 Ga0055531_10042688 Ga0055531_100426882 185
363 3300025284 Ga0209130_1006765 Ga0209130_10067651 185
364 3300025291 Ga0209675_1006360 Ga0209675_10063603 185
365 3300025291 Ga0209675_1008065 Ga0209675_10080653 185
366 3300025292 Ga0209676_1000875 Ga0209676_100087526 185
367 3300025292 Ga0209676_1004110 Ga0209676_10041102 185
368 3300025292 Ga0209676_1008716 Ga0209676_10087162 185
369 3300025292 Ga0209676_1008719 Ga0209676_10087192 185
370 3300025292 Ga0209676_1023227 Ga0209676_10232272 185
371 3300025294 Ga0209025_1030247 Ga0209025_10302471 185
372 3300025294 Ga0209025_1063391 Ga0209025_10633911 185
373 3300025295 Ga0209564_1004360 Ga0209564_10043605 185
374 3300025295 Ga0209564_1005762 Ga0209564_10057628 185
375 3300025297 Ga0209758_1018600 Ga0209758_10186004 185
376 3300025298 Ga0209050_1001382 Ga0209050_100138226 185
377 3300025298 Ga0209050_1016072 Ga0209050_10160723 185
378 3300025299 Ga0209256_1002134 Ga0209256_100213413 185
379 3300025302 Ga0207426_1081122 Ga0207426_10811221 185
380 3300025303 Ga0209051_1019372 Ga0209051_10193723 185
381 3300025304 Ga0209257_1000343 Ga0209257_100034363 185
382 3300025304 Ga0209257_1001069 Ga0209257_10010695 185
383 3300025304 Ga0209257_1002349 Ga0209257_100234913 185
384 3300025304 Ga0209257_1013596 Ga0209257_10135963 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20221

DUF6580

Family of unknown function (DUF6580)

26

212

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xad-assembly3.cif.gz_G crystal strucutre of pd-l1 and dbl2_02 designed protein binder 0.4294 21 115
1umo-assembly1.cif.gz_A the crystal structure of cytoglobin: the fourth globin type discovered in man 0.4242 16 115
6ffv-assembly1.cif.gz_A error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/6ffv 0.4041 21 178
4z7f-assembly1.cif.gz_B crystal structure of folt bound with folic acid 0.3927 17 170
3mvc-assembly1.cif.gz_A high resolution crystal structure of the heme domain of glb-6 from c. elegans 0.3767 25 121
ID Description Score Start End Superfamily
af_P0AFP0_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5538 22 116 1.10.10.1740
af_P21865_396_502_1.20.120.620 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Backbone structure of the membrane domain of e. Coli histidine kinase receptor kdpd, 0.5469 20 118 1.20.120.620
af_P0AFP0_4_80_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.531 22 116 1.10.10.1740
af_Q2G207_1_100_1.10.10.160 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.5193 22 118 1.10.10.160
af_Q4CLS8_209_312_1.25.40.90 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.517 21 109 1.25.40.90
ID Description Score Start End GO Terms
AF-A0A3C0BF42-F1-model_v4 Rod shape-determining protein MreD 0.8143 22 121 GO:0016020
AF-A0A7V5SSL9-F1-model_v4 Rod shape-determining protein MreD 0.8002 22 116 GO:0016020
AF-A0A7X6XE25-F1-model_v4 Lysoplasmalogenase 0.7988 20 124 GO:0016020
AF-A0A2N1X5M2-F1-model_v4 deleted 0.7779 9 118
AF-A0A520D5H5-F1-model_v4 Lysoplasmalogenase 0.7578 22 123 GO:0016020

Feature Viewer

pLDDT pTM Quality
68.37 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map