F429855

General Info

Members Datasets Scaffolds Average Seq Length
384 213 384 313

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100063787|Ga0070716_1000637871
Length 369
Sequence MHDGAEHPLHHFHECPITGILYFSIMRADANSRLLSDFLDYLRIEKGLARLSIVAYTTDIGQFAEFLEKRKRLLMTARRNDVREFLQQLFSNQVDGRSVGRKLSAFRHLYRYLLLDKRIEHDPTLNIESPRQWKVLPKSLARDEVEATLAAPGHASKAGRQDSAARALRDHAMLELLYAGALRVSELVTATLEDLKLEAGYMLVRGKGDKERIVPLGKLAQDALTEYLAQGRPKLLKPDRREGKKGRDPSTPLSSASLQTTTLRMTNAMSAPISRTSPFLFIAKGGGKLTRQRIWQMVGKASAASGRHASPHMLRHSCATHMVENGADLRTVQTILGHADISTTQVYTHLALDRLRTVYQKHHPRAKAR

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 1.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.29
Rhizosphere 92.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_5687094 2162886011 Unclassified 2132
2 MBSR1b_contig_13389520 2162886012 Unclassified 1137
3 MBSR1b_contig_14177418 2162886012 Unclassified 1137
4 JGI24752J21851_1001032 3300001976 Unclassified 3792
5 JGI24751J29686_10001612 3300002459 Unclassified 4661
6 Ga0058863_10026372 3300004799 Bacteria 1616
7 Ga0065704_10161858 3300005289 Unclassified 1349
8 Ga0070683_100015241 3300005329 Bacteria 6749
9 Ga0070690_100023852 3300005330 Bacteria 3757
10 Ga0070670_100100085 3300005331 Unclassified 2495
11 Ga0070670_100193792 3300005331 Bacteria 1765
12 Ga0070677_10003481 3300005333 Bacteria 5078
13 Ga0068869_100068741 3300005334 Bacteria 2617
14 Ga0070680_100135301 3300005336 Bacteria 2064
15 Ga0070682_100079409 3300005337 Bacteria 2118
16 Ga0068868_100006833 3300005338 Bacteria 8101
17 Ga0070660_100004171 3300005339 Bacteria 9979
18 Ga0070689_100014520 3300005340 Bacteria 5723
19 Ga0070687_100016888 3300005343 Bacteria 3342
20 Ga0070661_100011651 3300005344 Bacteria 6131
21 Ga0070675_100422952 3300005354 Unclassified 1191
22 Ga0070673_100133651 3300005364 Unclassified 2085
23 Ga0070688_100010277 3300005365 Bacteria 5155
24 Ga0070659_100017710 3300005366 Bacteria 5365
25 Ga0070659_100058267 3300005366 Bacteria 3048
26 Ga0070709_10029055 3300005434 Unclassified 3303
27 Ga0070709_10038682 3300005434 Bacteria 2923
28 Ga0070709_10122029 3300005434 Bacteria 1768
29 Ga0070709_10151199 3300005434 Bacteria 1605
30 Ga0070709_10212908 3300005434 Bacteria 1374
31 Ga0070714_100000536 3300005435 Bacteria 27458
32 Ga0070714_100009590 3300005435 Bacteria 7619
33 Ga0070714_100017892 3300005435 Bacteria 5747
34 Ga0070714_100119650 3300005435 Bacteria 2341
35 Ga0070714_100124727 3300005435 Bacteria 2294
36 Ga0070713_100000507 3300005436 Bacteria 24940
37 Ga0070713_100006023 3300005436 Bacteria 8354
38 Ga0070713_100007762 3300005436 Bacteria 7557
39 Ga0070713_100010480 3300005436 Bacteria 6695
40 Ga0070713_100059761 3300005436 Bacteria 3185
41 Ga0070713_100146672 3300005436 Bacteria 2095
42 Ga0070711_100000999 3300005439 Bacteria 15006
43 Ga0070711_100029337 3300005439 Bacteria 3629
44 Ga0070711_100036823 3300005439 Bacteria 3280
45 Ga0070708_100010613 3300005445 Bacteria 7467
46 Ga0070708_100042200 3300005445 Bacteria 4003
47 Ga0070708_100109162 3300005445 Bacteria 2541
48 Ga0070663_100140654 3300005455 Unclassified 1842
49 Ga0070678_100163810 3300005456 Bacteria 1804
50 Ga0070662_100351495 3300005457 Bacteria 1208
51 Ga0070681_10222873 3300005458 Bacteria 1801
52 Ga0070681_10294246 3300005458 Bacteria 1533
53 Ga0070681_10309568 3300005458 Bacteria 1489
54 Ga0070685_10001932 3300005466 Bacteria 10758
55 Ga0070706_100001675 3300005467 Bacteria 23081
56 Ga0070707_100017212 3300005468 Bacteria 6793
57 Ga0070707_100166761 3300005468 Bacteria 2146
58 Ga0070707_100452081 3300005468 Unclassified 1245
59 Ga0070699_100050426 3300005518 Bacteria 3604
60 Ga0070679_100137839 3300005530 Unclassified 2421
61 Ga0070684_100001613 3300005535 Bacteria 16300
62 Ga0070684_100072548 3300005535 Bacteria 3031
63 Ga0070697_100000161 3300005536 Bacteria 54619
64 Ga0070697_100000271 3300005536 Bacteria 42185
65 Ga0070697_100005944 3300005536 Bacteria 9428
66 Ga0070697_100158736 3300005536 Bacteria 1910
67 Ga0070697_100193363 3300005536 Bacteria 1727
68 Ga0068853_100136580 3300005539 Bacteria 2199
69 Ga0070686_100001000 3300005544 Bacteria 16311
70 Ga0070695_100279834 3300005545 Unclassified 1225
71 Ga0070696_100072980 3300005546 Bacteria 2417
72 Ga0070693_100090338 3300005547 Unclassified 1845
73 Ga0068855_100155196 3300005563 Bacteria 2601
74 Ga0068855_100227689 3300005563 Bacteria 2089
75 Ga0070664_100021664 3300005564 Bacteria 5299
76 Ga0068857_100017278 3300005577 Bacteria 6321
77 Ga0068854_100083030 3300005578 Bacteria 2368
78 Ga0068856_100006476 3300005614 Bacteria 11483
79 Ga0068856_100026786 3300005614 Bacteria 5622
80 Ga0068856_100049766 3300005614 Bacteria 4131
81 Ga0068856_100064636 3300005614 Bacteria 3615
82 Ga0068856_100229505 3300005614 Unclassified 1872
83 Ga0068852_100008479 3300005616 Bacteria 7576
84 Ga0068852_100171879 3300005616 Bacteria 2032
85 Ga0068859_100073667 3300005617 Bacteria 3453
86 Ga0068859_100083785 3300005617 Bacteria 3232
87 Ga0068866_10003994 3300005718 Bacteria 6055
88 Ga0068861_100002902 3300005719 Bacteria 11299
89 Ga0068851_10011555 3300005834 Bacteria 4143
90 Ga0068851_10111617 3300005834 Bacteria 1460
91 Ga0068870_10001948 3300005840 Bacteria 8528
92 Ga0068863_100021237 3300005841 Bacteria 6198
93 Ga0068863_100051190 3300005841 Unclassified 3915
94 Ga0068863_100079150 3300005841 Unclassified 3113
95 Ga0068858_100000401 3300005842 Bacteria 45107
96 Ga0068858_100101579 3300005842 Bacteria 2682
97 Ga0068860_100157054 3300005843 Unclassified 2192
98 Ga0068860_100191446 3300005843 Bacteria 1979
99 Ga0068862_100014362 3300005844 Bacteria 6568
100 Ga0068862_100173688 3300005844 Unclassified 1930
101 Ga0070717_10006268 3300006028 Bacteria 8734
102 Ga0070717_10015119 3300006028 Bacteria 5953
103 Ga0070717_10050506 3300006028 Bacteria 3418
104 Ga0070717_10059295 3300006028 Unclassified 3166
105 Ga0070717_10296575 3300006028 Unclassified 1436
106 Ga0070717_10425698 3300006028 Bacteria 1194
107 Ga0070717_10438920 3300006028 Bacteria 1175
108 Ga0070716_100002775 3300006173 Bacteria 8137
109 Ga0070716_100063787 3300006173 Bacteria 2140
110 Ga0070716_100098369 3300006173 Bacteria 1788
111 Ga0070716_100124844 3300006173 Bacteria 1617
112 Ga0070716_100252999 3300006173 Bacteria 1201
113 Ga0070712_100000086 3300006175 Bacteria 48100
114 Ga0070712_100002409 3300006175 Bacteria 11521
115 Ga0070712_100010342 3300006175 Bacteria 5883
116 Ga0070712_100107441 3300006175 Bacteria 2076
117 Ga0097621_100034984 3300006237 Bacteria 4011
118 Ga0097621_100314824 3300006237 Bacteria 1385
119 Ga0068871_100009960 3300006358 Bacteria 6905
120 Ga0068871_100067281 3300006358 Bacteria 2938
121 Ga0075433_10000127 3300006852 Bacteria 38862
122 Ga0075434_100000730 3300006871 Bacteria 25796
123 Ga0075434_100002031 3300006871 Bacteria 17565
124 Ga0068865_100005192 3300006881 Bacteria 7874
125 Ga0075436_100003344 3300006914 Bacteria 10982
126 Ga0075436_100019229 3300006914 Bacteria 4680
127 Ga0097620_100073666 3300006931 Bacteria 3453
128 Ga0097620_100083788 3300006931 Bacteria 3232
129 Ga0075435_100000975 3300007076 Bacteria 18098
130 Ga0075435_100100502 3300007076 Bacteria 2396
131 Ga0075435_100289987 3300007076 Bacteria 1398
132 Ga0105240_10025428 3300009093 Bacteria 7779
133 Ga0105240_10104543 3300009093 Bacteria 3439
134 Ga0105240_10107491 3300009093 Bacteria 3382
135 Ga0105245_10005038 3300009098 Bacteria 11617
136 Ga0105245_10005795 3300009098 Bacteria 10838
137 Ga0105245_10082597 3300009098 Bacteria 2939
138 Ga0105241_10055262 3300009174 Bacteria 3041
139 Ga0105242_10005627 3300009176 Bacteria 9673
140 Ga0105237_10026721 3300009545 Bacteria 5899
141 Ga0105237_10163538 3300009545 Bacteria 2224
142 Ga0105238_10071161 3300009551 Bacteria 3475
143 Ga0105238_10297050 3300009551 Unclassified 1598
144 Ga0105238_10396718 3300009551 Bacteria 1372
145 Ga0105249_10007525 3300009553 Bacteria 9501
146 Ga0105249_10040303 3300009553 Unclassified 4242
147 Ga0105249_10091621 3300009553 Bacteria 2844
148 Ga0105239_10017696 3300010375 Bacteria 7885
149 Ga0105239_10039578 3300010375 Bacteria 5165
150 Ga0105246_10000650 3300011119 Bacteria 19436
151 Ga0157373_10007258 3300013100 Bacteria 8262
152 Ga0157371_10020386 3300013102 Bacteria 4879
153 Ga0157370_10338387 3300013104 Bacteria 1387
154 Ga0157369_10013996 3300013105 Bacteria 9065
155 Ga0157369_10211331 3300013105 Bacteria 2033
156 Ga0157374_10005368 3300013296 Bacteria 10768
157 Ga0157374_10089010 3300013296 Bacteria 2941
158 Ga0157374_10101652 3300013296 Bacteria 2756
159 Ga0163162_10002057 3300013306 Bacteria 18904
160 Ga0163162_10003058 3300013306 Bacteria 15988
161 Ga0163162_10006972 3300013306 Bacteria 10958
162 Ga0163162_10622187 3300013306 Bacteria 1205
163 Ga0157372_10009483 3300013307 Bacteria 10352
164 Ga0157372_10014077 3300013307 Bacteria 8543
165 Ga0157372_10097762 3300013307 Bacteria 3349
166 Ga0157372_10239121 3300013307 Bacteria 2107
167 Ga0163163_10008282 3300014325 Bacteria 9228
168 Ga0163163_10055412 3300014325 Bacteria 3918
169 Ga0163163_10265125 3300014325 Unclassified 1769
170 Ga0157377_10001283 3300014745 Bacteria 10767
171 Ga0157379_10145661 3300014968 Bacteria 2136
172 Ga0157379_10188109 3300014968 Bacteria 1866
173 Ga0157376_10060601 3300014969 Bacteria 3179
174 Ga0157376_10064671 3300014969 Bacteria 3086
175 Ga0157376_10149161 3300014969 Bacteria 2107
176 Ga0157376_10238931 3300014969 Bacteria 1692
177 Ga0163161_10028000 3300017792 Bacteria 3999
178 Ga0154015_1417882 3300020610 Bacteria 1503
179 Ga0207692_10012103 3300025898 Bacteria 3695
180 Ga0207692_10039673 3300025898 Bacteria 2318
181 Ga0207642_10001790 3300025899 Bacteria 6651
182 Ga0207688_10002496 3300025901 Bacteria 9904
183 Ga0207680_10008029 3300025903 Bacteria 5169
184 Ga0207647_10002192 3300025904 Bacteria 14895
185 Ga0207647_10014382 3300025904 Bacteria 5455
186 Ga0207699_10022342 3300025906 Bacteria 3426
187 Ga0207699_10051780 3300025906 Unclassified 2427
188 Ga0207645_10000020 3300025907 Bacteria 106990
189 Ga0207643_10002964 3300025908 Bacteria 9159
190 Ga0207684_10078858 3300025910 Bacteria 2801
191 Ga0207654_10098448 3300025911 Unclassified 1797
192 Ga0207707_10065517 3300025912 Bacteria 3164
193 Ga0207695_10237233 3300025913 Unclassified 1726
194 Ga0207695_10579425 3300025913 Bacteria 1003
195 Ga0207671_10246992 3300025914 Bacteria 1403
196 Ga0207671_10291595 3300025914 Bacteria 1288
197 Ga0207693_10000122 3300025915 Bacteria 69393
198 Ga0207693_10002344 3300025915 Bacteria 16450
199 Ga0207693_10003719 3300025915 Bacteria 13005
200 Ga0207693_10066714 3300025915 Bacteria 2817
201 Ga0207693_10176584 3300025915 Bacteria 1681
202 Ga0207663_10004461 3300025916 Bacteria 6963
203 Ga0207663_10014881 3300025916 Bacteria 4275
204 Ga0207663_10076545 3300025916 Bacteria 2175
205 Ga0207663_10108511 3300025916 Bacteria 1879
206 Ga0207663_10205638 3300025916 Bacteria 1423
207 Ga0207657_10008043 3300025919 Bacteria 10754
208 Ga0207657_10230884 3300025919 Unclassified 1480
209 Ga0207652_10243914 3300025921 Bacteria 1620
210 Ga0207646_10245104 3300025922 Bacteria 1619
211 Ga0207646_10281199 3300025922 Bacteria 1504
212 Ga0207650_10000076 3300025925 Bacteria 132412
213 Ga0207650_10143287 3300025925 Unclassified 1880
214 Ga0207687_10381705 3300025927 Unclassified 1155
215 Ga0207700_10000174 3300025928 Bacteria 38563
216 Ga0207700_10002988 3300025928 Bacteria 9751
217 Ga0207700_10015991 3300025928 Bacteria 4971
218 Ga0207700_10036051 3300025928 Bacteria 3568
219 Ga0207700_10132786 3300025928 Unclassified 2035
220 Ga0207664_10000487 3300025929 Bacteria 28268
221 Ga0207664_10039327 3300025929 Bacteria 3673
222 Ga0207664_10052698 3300025929 Bacteria 3218
223 Ga0207664_10160993 3300025929 Bacteria 1914
224 Ga0207644_10026594 3300025931 Bacteria 3988
225 Ga0207706_10001013 3300025933 Bacteria 28657
226 Ga0207670_10017178 3300025936 Bacteria 4369
227 Ga0207704_10097198 3300025938 Bacteria 1952
228 Ga0207665_10003448 3300025939 Bacteria 10575
229 Ga0207665_10069183 3300025939 Bacteria 2407
230 Ga0207665_10110929 3300025939 Bacteria 1927
231 Ga0207691_10000817 3300025940 Bacteria 31022
232 Ga0207689_10000638 3300025942 Bacteria 33473
233 Ga0207661_10000450 3300025944 Bacteria 26422
234 Ga0207679_10000118 3300025945 Bacteria 64044
235 Ga0207667_10055330 3300025949 Bacteria 4171
236 Ga0207667_10568383 3300025949 Bacteria 1146
237 Ga0207712_10071203 3300025961 Bacteria 2500
238 Ga0207668_10096818 3300025972 Unclassified 2182
239 Ga0207640_10291291 3300025981 Bacteria 1287
240 Ga0207658_10313512 3300025986 Bacteria 1356
241 Ga0207677_10130214 3300026023 Bacteria 1909
242 Ga0207703_10005593 3300026035 Bacteria 10089
243 Ga0207678_10002080 3300026067 Bacteria 18150
244 Ga0207702_10002158 3300026078 Bacteria 18891
245 Ga0207641_10000352 3300026088 Bacteria 54903
246 Ga0207641_10007343 3300026088 Bacteria 9174
247 Ga0207641_10094748 3300026088 Bacteria 2619
248 Ga0207648_10000897 3300026089 Bacteria 33611
249 Ga0207676_10000301 3300026095 Bacteria 42521
250 Ga0207674_10000158 3300026116 Bacteria 80357
251 Ga0207683_10009646 3300026121 Bacteria 8227
252 Ga0268266_10004345 3300028379 Bacteria 13617
253 Ga0268265_10154064 3300028380 Unclassified 1942
254 Ga0268265_10215719 3300028380 Bacteria 1675
255 Ga0265326_10030142 3300028558 Bacteria 1545
256 Ga0265338_10000927 3300028800 Bacteria 49486
257 Ga0265338_10070569 3300028800 Unclassified 2994
258 Ga0265338_10072859 3300028800 Bacteria 2930
259 Ga0265762_1006544 3300030760 Bacteria 2083
260 Ga0265770_1012344 3300030878 Bacteria 1265
261 Ga0265760_10038794 3300031090 Bacteria 1417
262 Ga0265330_10055411 3300031235 Bacteria 1731
263 Ga0265325_10017048 3300031241 Bacteria 4043
264 Ga0265340_10087600 3300031247 Bacteria 1459
265 Ga0265339_10006114 3300031249 Bacteria 7943
266 Ga0265339_10013178 3300031249 Bacteria 5017
267 Ga0265339_10037126 3300031249 Bacteria 2724
268 Ga0265339_10071549 3300031249 Bacteria 1847
269 Ga0265316_10003272 3300031344 Bacteria 16450
270 Ga0265316_10015531 3300031344 Bacteria 6654
271 Ga0265314_10002953 3300031711 Bacteria 16844
272 Ga0265314_10024782 3300031711 Bacteria 4540
273 Ga0265314_10038573 3300031711 Unclassified 3449
274 Ga0265314_10199516 3300031711 Bacteria 1184
275 Ga0373926_0013152 3300035083 Bacteria 2804
276 Ga0373944_0023666 3300035089 Bacteria 1794
277 Ga0373923_0032141 3300035111 Bacteria 2118
278 Ga0373923_0038115 3300035111 Bacteria 1968
279 Ga0373936_0102682 3300035113 Bacteria 1207
280 Ga0373945_0002152 3300035116 Bacteria 6147
281 Ga0373945_0030354 3300035116 Bacteria 1905
282 Ga0373954_0052676 3300035118 Bacteria 1912
283 Ga0373956_0070378 3300035119 Bacteria 1596
284 Ga0373943_0001566 3300035170 Bacteria 10352
285 Ga0373943_0004532 3300035170 Bacteria 6282
286 Ga0373943_0014785 3300035170 Bacteria 3540
287 Ga0373946_0004055 3300035171 Bacteria 5219
288 Ga0373955_0021838 3300035172 Bacteria 3238
289 Ga0373955_0116751 3300035172 Bacteria 1547
290 Ga0373924_0000441 3300035410 Bacteria 12714
291 Ga0373935_0005992 3300035692 Bacteria 7217
292 Ga0373935_0024921 3300035692 Bacteria 3685
293 Ga0373935_0058557 3300035692 Bacteria 2461
294 Ga0373927_0002934 3300035695 Bacteria 12388
295 Ga0373927_0055142 3300035695 Bacteria 2570
296 Ga0373927_0063709 3300035695 Bacteria 2385
297 Ga0373933_0018052 3300035724 Bacteria 3963
298 Ga0373947_0000114 3300035725 Bacteria 40137
299 Ga0373947_0034923 3300035725 Bacteria 2975
300 Ga0373947_0036008 3300035725 Bacteria 2932
301 Ga0373937_0000038 3300036401 Bacteria 110582
302 Ga0373937_0009816 3300036401 Bacteria 8347
303 Ga0373925_0001229 3300037068 Bacteria 22656
304 Ga0373925_0006277 3300037068 Bacteria 8759
305 Ga0373925_0014141 3300037068 Bacteria 5777
306 Ga0373925_0051924 3300037068 Bacteria 3062
307 Ga0395905_0005225 3300037471 Bacteria 13288
308 Ga0395905_0011584 3300037471 Bacteria 8519
309 Ga0395905_0081577 3300037471 Bacteria 3031
310 Ga0395905_0126205 3300037471 Bacteria 2406
311 Ga0436361_0090557 3300039447 Bacteria 1699
312 Ga0436362_0147994 3300039453 Unclassified 1478
313 Ga0466963_0002987 3300044694 Bacteria 9561
314 Ga0466963_0016069 3300044694 Bacteria 4648
315 Ga0466963_0048362 3300044694 Unclassified 2810
316 Ga0453684_0002322 3300044712 Bacteria 46658
317 Ga0451576_0012580 3300045051 Bacteria 9501
318 Ga0466967_0654297 3300045976 Bacteria 1039
319 Ga0495603_0081673 3300046455 Bacteria 1894
320 Ga0495580_0001572 3300046472 Bacteria 20079
321 Ga0495580_0066049 3300046472 Bacteria 2533
322 Ga0495580_0151913 3300046472 Bacteria 1604
323 Ga0495582_0022198 3300046473 Bacteria 3473
324 Ga0495639_0133575 3300046475 Bacteria 1189
325 Ga0495664_0045566 3300046477 Bacteria 2601
326 Ga0495630_0004022 3300046517 Bacteria 10293
327 Ga0495630_0056811 3300046517 Bacteria 2932
328 Ga0495630_0075060 3300046517 Unclassified 2548
329 Ga0495630_0084761 3300046517 Bacteria 2392
330 Ga0495665_0011753 3300046531 Bacteria 4744
331 Ga0495640_0096395 3300046533 Bacteria 1946
332 Ga0495586_0041049 3300046535 Bacteria 2492
333 Ga0495645_0147851 3300046543 Bacteria 1635
334 Ga0495635_0028438 3300046663 Bacteria 3886
335 Ga0495588_0250526 3300046674 Unclassified 934
336 Ga0495657_0115141 3300046675 Bacteria 1699
337 Ga0495623_0013722 3300046679 Bacteria 5253
338 Ga0495658_0053199 3300046683 Bacteria 2299
339 Ga0495613_0131491 3300046689 Bacteria 1792
340 Ga0495581_0145660 3300047315 Bacteria 1382
341 Ga0495674_0035550 3300047319 Bacteria 4493
342 Ga0495674_0102676 3300047319 Bacteria 2432
343 Ga0495683_0196345 3300047323 Bacteria 913
344 Ga0495675_0011199 3300047444 Bacteria 5625
345 Ga0495593_0058773 3300047673 Bacteria 2016
346 Ga0496100_0030569 3300048903 Bacteria 3342
347 Ga0496100_0060027 3300048903 Bacteria 2502
348 Ga0496101_0025053 3300048904 Bacteria 4135
349 Ga0496102_0193303 3300048905 Unclassified 1918
350 Ga0496103_0009148 3300048906 Bacteria 5867
351 Ga0496103_0158432 3300048906 Unclassified 1452
352 Ga0496104_0028433 3300048907 Bacteria 5182
353 Ga0496104_0041436 3300048907 Bacteria 4318
354 Ga0496104_0315625 3300048907 Bacteria 1476
355 Ga0496105_0002310 3300048908 Bacteria 13826
356 Ga0496105_0407993 3300048908 Bacteria 1077
357 Ga0496108_0000105 3300048911 Bacteria 87322
358 Ga0496109_0000008 3300048912 Bacteria 245809
359 Ga0496110_0001375 3300048913 Bacteria 17526
360 Ga0496110_0229851 3300048913 Bacteria 1687
361 Ga0496111_0012399 3300048914 Bacteria 5770
362 Ga0496111_0059062 3300048914 Unclassified 2778
363 Ga0496112_0000914 3300048915 Bacteria 21314
364 Ga0496112_0001684 3300048915 Bacteria 17222
365 Ga0496112_0033889 3300048915 Bacteria 4967
366 Ga0496112_0131086 3300048915 Bacteria 2478
367 Ga0496113_0000282 3300048916 Bacteria 24040
368 Ga0496113_0006796 3300048916 Bacteria 7290
369 Ga0496113_0226645 3300048916 Bacteria 1490
370 Ga0496114_0054047 3300048917 Bacteria 3348
371 Ga0496114_0153998 3300048917 Bacteria 1995
372 Ga0496115_0017621 3300048918 Bacteria 5466
373 Ga0496115_0024856 3300048918 Bacteria 4659
374 nmdc:mga0n895_3997_c1 3300050512 Bacteria 11988
375 nmdc:mga0n895_926_c1 3300050512 Bacteria 21152
376 nmdc:mga0rr50_117168_c1 3300050513 Bacteria 2115
377 nmdc:mga0rr50_289021_c1 3300050513 Bacteria 1369
378 nmdc:mga0rr50_375262_c1 3300050513 Bacteria 1199
379 nmdc:mga0rr50_95558_c1 3300050513 Bacteria 2323
380 nmdc:mga08x19_15930_c1 3300050514 Bacteria 4580
381 nmdc:mga08x19_53384_c1 3300050514 Bacteria 2601
382 nmdc:mga0a205_149_c2 3300050515 Bacteria 33259
383 nmdc:mga0a205_31167_c1 3300050515 Bacteria 5107
384 Ga0495601_0066587 3300053077 Bacteria 2293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046674 Ga0495588_0250526 Ga0495588_0250526_90_854 234
2 3300047323 Ga0495683_0196345 Ga0495683_0196345_95_859 234
3 3300014968 Ga0157379_10145661 Ga0157379_101456612 249
4 3300005434 Ga0070709_10029055 Ga0070709_100290553 278
5 3300025906 Ga0207699_10051780 Ga0207699_100517802 278
6 3300044694 Ga0466963_0048362 Ga0466963_0048362_1567_2466 282
7 3300005366 Ga0070659_100058267 Ga0070659_1000582672 283
8 3300025919 Ga0207657_10230884 Ga0207657_102308842 283
9 3300045051 Ga0451576_0012580 Ga0451576_0012580_6071_6961 283
10 3300028800 Ga0265338_10000927 Ga0265338_1000092729 284
11 3300031249 Ga0265339_10013178 Ga0265339_100131783 284
12 3300005337 Ga0070682_100079409 Ga0070682_1000794092 285
13 3300005563 Ga0068855_100227689 Ga0068855_1002276892 285
14 3300005578 Ga0068854_100083030 Ga0068854_1000830302 285
15 3300009545 Ga0105237_10163538 Ga0105237_101635382 285
16 3300020610 Ga0154015_1417882 Ga0154015_14178822 285
17 3300014325 Ga0163163_10055412 Ga0163163_100554122 286
18 3300048915 Ga0496112_0131086 Ga0496112_0131086_1008_1928 286
19 3300005434 Ga0070709_10038682 Ga0070709_100386823 287
20 3300005435 Ga0070714_100017892 Ga0070714_1000178922 287
21 3300005436 Ga0070713_100000507 Ga0070713_1000005079 287
22 3300005439 Ga0070711_100000999 Ga0070711_1000009993 287
23 3300006028 Ga0070717_10015119 Ga0070717_100151195 287
24 3300006173 Ga0070716_100002775 Ga0070716_1000027753 287
25 3300006175 Ga0070712_100000086 Ga0070712_10000008630 287
26 3300025898 Ga0207692_10012103 Ga0207692_100121033 287
27 3300025906 Ga0207699_10022342 Ga0207699_100223422 287
28 3300025915 Ga0207693_10000122 Ga0207693_1000012214 287
29 3300025916 Ga0207663_10014881 Ga0207663_100148814 287
30 3300025928 Ga0207700_10000174 Ga0207700_100001749 287
31 3300025939 Ga0207665_10003448 Ga0207665_100034485 287
32 3300048917 Ga0496114_0153998 Ga0496114_0153998_751_1758 287
33 3300048918 Ga0496115_0024856 Ga0496115_0024856_1198_2205 287
34 3300014969 Ga0157376_10238931 Ga0157376_102389312 289
35 3300025922 Ga0207646_10281199 Ga0207646_102811992 289
36 3300037068 Ga0373925_0001229 Ga0373925_0001229_21484_22410 289
37 3300048908 Ga0496105_0407993 Ga0496105_0407993_20_1003 289
38 3300050512 nmdc:mga0n895_926_c1 nmdc:mga0n895_926_c1_3910_4806 289
39 3300050513 nmdc:mga0rr50_375262_c1 nmdc:mga0rr50_375262_c1_138_1034 289
40 3300050514 nmdc:mga08x19_53384_c1 nmdc:mga08x19_53384_c1_23_919 289
41 3300050515 nmdc:mga0a205_149_c2 nmdc:mga0a205_149_c2_22783_23679 289
42 3300004799 Ga0058863_10026372 Ga0058863_100263722 290
43 3300006173 Ga0070716_100252999 Ga0070716_1002529991 290
44 3300006914 Ga0075436_100019229 Ga0075436_1000192292 290
45 3300013307 Ga0157372_10239121 Ga0157372_102391212 290
46 3300025916 Ga0207663_10076545 Ga0207663_100765452 290
47 3300025928 Ga0207700_10036051 Ga0207700_100360513 290
48 3300005435 Ga0070714_100009590 Ga0070714_1000095905 291
49 3300005436 Ga0070713_100007762 Ga0070713_1000077624 291
50 3300005467 Ga0070706_100001675 Ga0070706_10000167515 291
51 3300005468 Ga0070707_100452081 Ga0070707_1004520812 291
52 3300005518 Ga0070699_100050426 Ga0070699_1000504263 291
53 3300005530 Ga0070679_100137839 Ga0070679_1001378393 291
54 3300005536 Ga0070697_100000271 Ga0070697_10000027130 291
55 3300006028 Ga0070717_10006268 Ga0070717_100062686 291
56 3300025910 Ga0207684_10078858 Ga0207684_100788581 291
57 3300025928 Ga0207700_10015991 Ga0207700_100159914 291
58 3300025929 Ga0207664_10039327 Ga0207664_100393274 291
59 3300037471 Ga0395905_0005225 Ga0395905_0005225_9151_10062 291
60 3300037471 Ga0395905_0081577 Ga0395905_0081577_940_1857 291
61 3300037471 Ga0395905_0126205 Ga0395905_0126205_840_1754 291
62 3300039453 Ga0436362_0147994 Ga0436362_0147994_65_1012 291
63 3300048916 Ga0496113_0226645 Ga0496113_0226645_443_1354 292
64 3300009551 Ga0105238_10071161 Ga0105238_100711613 293
65 3300037471 Ga0395905_0011584 Ga0395905_0011584_5412_6335 293
66 3300048915 Ga0496112_0033889 Ga0496112_0033889_1128_2042 293
67 3300005536 Ga0070697_100158736 Ga0070697_1001587362 294
68 3300047444 Ga0495675_0011199 Ga0495675_0011199_798_1745 294
69 3300005445 Ga0070708_100042200 Ga0070708_1000422003 295
70 3300006173 Ga0070716_100063787 Ga0070716_1000637871 295
71 3300006175 Ga0070712_100107441 Ga0070712_1001074412 295
72 3300013307 Ga0157372_10014077 Ga0157372_100140775 295
73 3300025939 Ga0207665_10110929 Ga0207665_101109292 295
74 3300044712 Ga0453684_0002322 Ga0453684_0002322_7467_8411 295
75 3300046517 Ga0495630_0075060 Ga0495630_0075060_1235_2269 295
76 3300047319 Ga0495674_0102676 Ga0495674_0102676_416_1450 295
77 3300005436 Ga0070713_100010480 Ga0070713_1000104803 296
78 3300005445 Ga0070708_100010613 Ga0070708_1000106134 296
79 3300005445 Ga0070708_100109162 Ga0070708_1001091623 296
80 3300005468 Ga0070707_100017212 Ga0070707_1000172125 296
81 3300005468 Ga0070707_100166761 Ga0070707_1001667612 296
82 3300005536 Ga0070697_100005944 Ga0070697_1000059444 296
83 3300005536 Ga0070697_100193363 Ga0070697_1001933632 296
84 3300005546 Ga0070696_100072980 Ga0070696_1000729802 296
85 3300005614 Ga0068856_100049766 Ga0068856_1000497664 296
86 3300006028 Ga0070717_10059295 Ga0070717_100592952 296
87 3300006237 Ga0097621_100034984 Ga0097621_1000349843 296
88 3300006358 Ga0068871_100009960 Ga0068871_1000099604 296
89 3300007076 Ga0075435_100100502 Ga0075435_1001005022 296
90 3300009093 Ga0105240_10107491 Ga0105240_101074913 296
91 3300009174 Ga0105241_10055262 Ga0105241_100552623 296
92 3300013296 Ga0157374_10089010 Ga0157374_100890103 296
93 3300013307 Ga0157372_10097762 Ga0157372_100977623 296
94 3300014969 Ga0157376_10064671 Ga0157376_100646712 296
95 3300025913 Ga0207695_10579425 Ga0207695_105794251 296
96 3300025916 Ga0207663_10108511 Ga0207663_101085112 296
97 3300025922 Ga0207646_10245104 Ga0207646_102451042 296
98 3300025928 Ga0207700_10002988 Ga0207700_100029886 296
99 3300025986 Ga0207658_10313512 Ga0207658_103135122 296
100 3300028800 Ga0265338_10072859 Ga0265338_100728592 296
101 3300030760 Ga0265762_1006544 Ga0265762_10065442 296
102 3300031249 Ga0265339_10006114 Ga0265339_100061144 296
103 3300031711 Ga0265314_10024782 Ga0265314_100247822 296
104 3300031711 Ga0265314_10199516 Ga0265314_101995162 296
105 3300048903 Ga0496100_0030569 Ga0496100_0030569_130_1047 296
106 3300048904 Ga0496101_0025053 Ga0496101_0025053_1695_2612 296
107 3300048907 Ga0496104_0028433 Ga0496104_0028433_1599_2516 296
108 3300048917 Ga0496114_0054047 Ga0496114_0054047_2195_3112 296
109 3300048918 Ga0496115_0017621 Ga0496115_0017621_4061_4978 296
110 3300050513 nmdc:mga0rr50_95558_c1 nmdc:mga0rr50_95558_c1_313_1353 296
111 3300005336 Ga0070680_100135301 Ga0070680_1001353011 297
112 3300005434 Ga0070709_10151199 Ga0070709_101511991 297
113 3300005434 Ga0070709_10212908 Ga0070709_102129081 297
114 3300005435 Ga0070714_100000536 Ga0070714_1000005367 297
115 3300005435 Ga0070714_100119650 Ga0070714_1001196502 297
116 3300005435 Ga0070714_100124727 Ga0070714_1001247273 297
117 3300005436 Ga0070713_100059761 Ga0070713_1000597613 297
118 3300005436 Ga0070713_100146672 Ga0070713_1001466722 297
119 3300005439 Ga0070711_100036823 Ga0070711_1000368233 297
120 3300005458 Ga0070681_10294246 Ga0070681_102942462 297
121 3300005535 Ga0070684_100072548 Ga0070684_1000725483 297
122 3300005545 Ga0070695_100279834 Ga0070695_1002798341 297
123 3300005614 Ga0068856_100006476 Ga0068856_1000064768 297
124 3300005614 Ga0068856_100064636 Ga0068856_1000646365 297
125 3300005614 Ga0068856_100229505 Ga0068856_1002295052 297
126 3300005834 Ga0068851_10111617 Ga0068851_101116171 297
127 3300005842 Ga0068858_100101579 Ga0068858_1001015793 297
128 3300006028 Ga0070717_10050506 Ga0070717_100505062 297
129 3300006028 Ga0070717_10296575 Ga0070717_102965752 297
130 3300006028 Ga0070717_10425698 Ga0070717_104256982 297
131 3300006028 Ga0070717_10438920 Ga0070717_104389202 297
132 3300006173 Ga0070716_100098369 Ga0070716_1000983692 297
133 3300006173 Ga0070716_100124844 Ga0070716_1001248442 297
134 3300006175 Ga0070712_100002409 Ga0070712_1000024098 297
135 3300006237 Ga0097621_100314824 Ga0097621_1003148242 297
136 3300009093 Ga0105240_10025428 Ga0105240_100254285 297
137 3300009098 Ga0105245_10005795 Ga0105245_100057958 297
138 3300009098 Ga0105245_10082597 Ga0105245_100825973 297
139 3300009551 Ga0105238_10297050 Ga0105238_102970502 297
140 3300009551 Ga0105238_10396718 Ga0105238_103967182 297
141 3300013105 Ga0157369_10211331 Ga0157369_102113313 297
142 3300013296 Ga0157374_10101652 Ga0157374_101016523 297
143 3300013306 Ga0163162_10003058 Ga0163162_1000305811 297
144 3300013306 Ga0163162_10622187 Ga0163162_106221871 297
145 3300014968 Ga0157379_10188109 Ga0157379_101881092 297
146 3300014969 Ga0157376_10149161 Ga0157376_101491612 297
147 3300025898 Ga0207692_10039673 Ga0207692_100396731 297
148 3300025912 Ga0207707_10065517 Ga0207707_100655174 297
149 3300025913 Ga0207695_10237233 Ga0207695_102372332 297
150 3300025914 Ga0207671_10291595 Ga0207671_102915951 297
151 3300025915 Ga0207693_10003719 Ga0207693_100037198 297
152 3300025915 Ga0207693_10066714 Ga0207693_100667142 297
153 3300025915 Ga0207693_10176584 Ga0207693_101765841 297
154 3300025916 Ga0207663_10004461 Ga0207663_100044617 297
155 3300025916 Ga0207663_10205638 Ga0207663_102056382 297
156 3300025921 Ga0207652_10243914 Ga0207652_102439141 297
157 3300025928 Ga0207700_10132786 Ga0207700_101327862 297
158 3300025929 Ga0207664_10000487 Ga0207664_1000048718 297
159 3300025929 Ga0207664_10052698 Ga0207664_100526982 297
160 3300025929 Ga0207664_10160993 Ga0207664_101609932 297
161 3300025939 Ga0207665_10069183 Ga0207665_100691832 297
162 3300026023 Ga0207677_10130214 Ga0207677_101302143 297
163 3300026078 Ga0207702_10002158 Ga0207702_100021582 297
164 3300026088 Ga0207641_10094748 Ga0207641_100947483 297
165 3300028800 Ga0265338_10070569 Ga0265338_100705692 297
166 3300030878 Ga0265770_1012344 Ga0265770_10123441 297
167 3300031090 Ga0265760_10038794 Ga0265760_100387941 297
168 3300031241 Ga0265325_10017048 Ga0265325_100170482 297
169 3300031247 Ga0265340_10087600 Ga0265340_100876002 297
170 3300031249 Ga0265339_10037126 Ga0265339_100371262 297
171 3300031249 Ga0265339_10071549 Ga0265339_100715492 297
172 3300031344 Ga0265316_10015531 Ga0265316_100155312 297
173 3300031711 Ga0265314_10038573 Ga0265314_100385731 297
174 3300035083 Ga0373926_0013152 Ga0373926_0013152_473_1519 297
175 3300035089 Ga0373944_0023666 Ga0373944_0023666_81_1073 297
176 3300035111 Ga0373923_0032141 Ga0373923_0032141_795_1787 297
177 3300035111 Ga0373923_0038115 Ga0373923_0038115_130_1086 297
178 3300035113 Ga0373936_0102682 Ga0373936_0102682_131_1087 297
179 3300035116 Ga0373945_0002152 Ga0373945_0002152_3404_4396 297
180 3300035116 Ga0373945_0030354 Ga0373945_0030354_161_1207 297
181 3300035118 Ga0373954_0052676 Ga0373954_0052676_188_1180 297
182 3300035119 Ga0373956_0070378 Ga0373956_0070378_135_1181 297
183 3300035170 Ga0373943_0001566 Ga0373943_0001566_1444_2436 297
184 3300035170 Ga0373943_0004532 Ga0373943_0004532_447_1403 297
185 3300035170 Ga0373943_0014785 Ga0373943_0014785_1589_2569 297
186 3300035171 Ga0373946_0004055 Ga0373946_0004055_1955_2947 297
187 3300035172 Ga0373955_0021838 Ga0373955_0021838_818_1789 297
188 3300035172 Ga0373955_0116751 Ga0373955_0116751_70_1062 297
189 3300035410 Ga0373924_0000441 Ga0373924_0000441_1461_2417 297
190 3300035692 Ga0373935_0005992 Ga0373935_0005992_4221_5201 297
191 3300035692 Ga0373935_0024921 Ga0373935_0024921_670_1662 297
192 3300035692 Ga0373935_0058557 Ga0373935_0058557_1252_2298 297
193 3300035695 Ga0373927_0002934 Ga0373927_0002934_5816_6808 297
194 3300035695 Ga0373927_0055142 Ga0373927_0055142_252_1208 297
195 3300035695 Ga0373927_0063709 Ga0373927_0063709_326_1372 297
196 3300035724 Ga0373933_0018052 Ga0373933_0018052_516_1508 297
197 3300035725 Ga0373947_0000114 Ga0373947_0000114_24938_25930 297
198 3300035725 Ga0373947_0034923 Ga0373947_0034923_1601_2647 297
199 3300035725 Ga0373947_0036008 Ga0373947_0036008_228_1184 297
200 3300036401 Ga0373937_0000038 Ga0373937_0000038_89808_90764 297
201 3300037068 Ga0373925_0006277 Ga0373925_0006277_3772_4764 297
202 3300037068 Ga0373925_0014141 Ga0373925_0014141_39_1010 297
203 3300037068 Ga0373925_0051924 Ga0373925_0051924_1166_2146 297
204 3300044694 Ga0466963_0002987 Ga0466963_0002987_5709_6704 297
205 3300045976 Ga0466967_0654297 Ga0466967_0654297_64_1017 297
206 3300046455 Ga0495603_0081673 Ga0495603_0081673_489_1535 297
207 3300046472 Ga0495580_0001572 Ga0495580_0001572_4610_5656 297
208 3300046472 Ga0495580_0066049 Ga0495580_0066049_1486_2442 297
209 3300046472 Ga0495580_0151913 Ga0495580_0151913_563_1483 297
210 3300046473 Ga0495582_0022198 Ga0495582_0022198_1237_2193 297
211 3300046475 Ga0495639_0133575 Ga0495639_0133575_184_1155 297
212 3300046477 Ga0495664_0045566 Ga0495664_0045566_223_1215 297
213 3300046517 Ga0495630_0004022 Ga0495630_0004022_2702_3658 297
214 3300046517 Ga0495630_0056811 Ga0495630_0056811_338_1330 297
215 3300046517 Ga0495630_0084761 Ga0495630_0084761_611_1591 297
216 3300046531 Ga0495665_0011753 Ga0495665_0011753_2649_3695 297
217 3300046533 Ga0495640_0096395 Ga0495640_0096395_725_1705 297
218 3300046535 Ga0495586_0041049 Ga0495586_0041049_685_1641 297
219 3300046543 Ga0495645_0147851 Ga0495645_0147851_218_1210 297
220 3300046663 Ga0495635_0028438 Ga0495635_0028438_940_1896 297
221 3300046675 Ga0495657_0115141 Ga0495657_0115141_551_1507 297
222 3300046679 Ga0495623_0013722 Ga0495623_0013722_605_1561 297
223 3300046683 Ga0495658_0053199 Ga0495658_0053199_729_1685 297
224 3300046689 Ga0495613_0131491 Ga0495613_0131491_285_1331 297
225 3300047315 Ga0495581_0145660 Ga0495581_0145660_380_1336 297
226 3300047319 Ga0495674_0035550 Ga0495674_0035550_3261_4241 297
227 3300047673 Ga0495593_0058773 Ga0495593_0058773_214_1170 297
228 3300048906 Ga0496103_0009148 Ga0496103_0009148_1335_2306 297
229 3300048907 Ga0496104_0041436 Ga0496104_0041436_2358_3314 297
230 3300048907 Ga0496104_0315625 Ga0496104_0315625_340_1260 297
231 3300048908 Ga0496105_0002310 Ga0496105_0002310_6780_7736 297
232 3300048913 Ga0496110_0229851 Ga0496110_0229851_62_1018 297
233 3300048914 Ga0496111_0012399 Ga0496111_0012399_4385_5374 297
234 3300048915 Ga0496112_0001684 Ga0496112_0001684_16160_17116 297
235 3300048916 Ga0496113_0006796 Ga0496113_0006796_3402_4358 297
236 3300053077 Ga0495601_0066587 Ga0495601_0066587_14_994 297
237 3300005289 Ga0065704_10161858 Ga0065704_101618581 298
238 3300005331 Ga0070670_100100085 Ga0070670_1001000852 298
239 3300005338 Ga0068868_100006833 Ga0068868_1000068332 298
240 3300005434 Ga0070709_10122029 Ga0070709_101220291 298
241 3300005436 Ga0070713_100006023 Ga0070713_1000060235 298
242 3300005439 Ga0070711_100029337 Ga0070711_1000293371 298
243 3300005458 Ga0070681_10309568 Ga0070681_103095681 298
244 3300005536 Ga0070697_100000161 Ga0070697_10000016147 298
245 3300005616 Ga0068852_100171879 Ga0068852_1001718791 298
246 3300005617 Ga0068859_100073667 Ga0068859_1000736672 298
247 3300005841 Ga0068863_100021237 Ga0068863_1000212373 298
248 3300005841 Ga0068863_100051190 Ga0068863_1000511903 298
249 3300005842 Ga0068858_100000401 Ga0068858_10000040122 298
250 3300005843 Ga0068860_100191446 Ga0068860_1001914462 298
251 3300005844 Ga0068862_100173688 Ga0068862_1001736882 298
252 3300006175 Ga0070712_100010342 Ga0070712_1000103425 298
253 3300006358 Ga0068871_100067281 Ga0068871_1000672813 298
254 3300006852 Ga0075433_10000127 Ga0075433_1000012712 298
255 3300006871 Ga0075434_100000730 Ga0075434_10000073018 298
256 3300006871 Ga0075434_100002031 Ga0075434_10000203115 298
257 3300006914 Ga0075436_100003344 Ga0075436_1000033447 298
258 3300006931 Ga0097620_100073666 Ga0097620_1000736664 298
259 3300007076 Ga0075435_100000975 Ga0075435_1000009755 298
260 3300007076 Ga0075435_100289987 Ga0075435_1002899871 298
261 3300009093 Ga0105240_10104543 Ga0105240_101045432 298
262 3300009545 Ga0105237_10026721 Ga0105237_100267214 298
263 3300009553 Ga0105249_10040303 Ga0105249_100403032 298
264 3300009553 Ga0105249_10091621 Ga0105249_100916214 298
265 3300010375 Ga0105239_10039578 Ga0105239_100395786 298
266 3300013104 Ga0157370_10338387 Ga0157370_103383872 298
267 3300013296 Ga0157374_10005368 Ga0157374_100053683 298
268 3300013306 Ga0163162_10002057 Ga0163162_100020575 298
269 3300013306 Ga0163162_10006972 Ga0163162_100069724 298
270 3300014325 Ga0163163_10265125 Ga0163163_102651252 298
271 3300014969 Ga0157376_10060601 Ga0157376_100606013 298
272 3300025904 Ga0207647_10002192 Ga0207647_1000219212 298
273 3300025914 Ga0207671_10246992 Ga0207671_102469921 298
274 3300025915 Ga0207693_10002344 Ga0207693_100023441 298
275 3300025925 Ga0207650_10143287 Ga0207650_101432871 298
276 3300025938 Ga0207704_10097198 Ga0207704_100971982 298
277 3300025949 Ga0207667_10568383 Ga0207667_105683831 298
278 3300026035 Ga0207703_10005593 Ga0207703_100055934 298
279 3300026088 Ga0207641_10007343 Ga0207641_100073435 298
280 3300028380 Ga0268265_10154064 Ga0268265_101540642 298
281 3300028558 Ga0265326_10030142 Ga0265326_100301422 298
282 3300031235 Ga0265330_10055411 Ga0265330_100554111 298
283 3300031344 Ga0265316_10003272 Ga0265316_100032726 298
284 3300031711 Ga0265314_10002953 Ga0265314_1000295311 298
285 3300036401 Ga0373937_0009816 Ga0373937_0009816_4985_6007 298
286 3300039447 Ga0436361_0090557 Ga0436361_0090557_731_1669 298
287 3300044694 Ga0466963_0016069 Ga0466963_0016069_3053_4093 298
288 3300050512 nmdc:mga0n895_3997_c1 nmdc:mga0n895_3997_c1_8387_9310 298
289 3300050513 nmdc:mga0rr50_117168_c1 nmdc:mga0rr50_117168_c1_1175_2098 298
290 3300050513 nmdc:mga0rr50_289021_c1 nmdc:mga0rr50_289021_c1_168_1100 298
291 3300050514 nmdc:mga08x19_15930_c1 nmdc:mga08x19_15930_c1_286_1218 298
292 3300050515 nmdc:mga0a205_31167_c1 nmdc:mga0a205_31167_c1_1120_2043 298
293 2162886011 MRS1b_contig_5687094 MRS1b_0228.00000640 299
294 2162886012 MBSR1b_contig_13389520 MBSR1b_0092.00006390 299
295 2162886012 MBSR1b_contig_14177418 MBSR1b_0172.00006040 299
296 3300001976 JGI24752J21851_1001032 JGI24752J21851_10010321 299
297 3300002459 JGI24751J29686_10001612 JGI24751J29686_100016124 299
298 3300005329 Ga0070683_100015241 Ga0070683_1000152415 299
299 3300005330 Ga0070690_100023852 Ga0070690_1000238524 299
300 3300005331 Ga0070670_100193792 Ga0070670_1001937921 299
301 3300005333 Ga0070677_10003481 Ga0070677_100034812 299
302 3300005334 Ga0068869_100068741 Ga0068869_1000687413 299
303 3300005339 Ga0070660_100004171 Ga0070660_1000041713 299
304 3300005340 Ga0070689_100014520 Ga0070689_1000145205 299
305 3300005343 Ga0070687_100016888 Ga0070687_1000168883 299
306 3300005344 Ga0070661_100011651 Ga0070661_1000116515 299
307 3300005354 Ga0070675_100422952 Ga0070675_1004229522 299
308 3300005364 Ga0070673_100133651 Ga0070673_1001336512 299
309 3300005365 Ga0070688_100010277 Ga0070688_1000102774 299
310 3300005366 Ga0070659_100017710 Ga0070659_1000177102 299
311 3300005455 Ga0070663_100140654 Ga0070663_1001406542 299
312 3300005456 Ga0070678_100163810 Ga0070678_1001638102 299
313 3300005457 Ga0070662_100351495 Ga0070662_1003514952 299
314 3300005458 Ga0070681_10222873 Ga0070681_102228732 299
315 3300005466 Ga0070685_10001932 Ga0070685_100019329 299
316 3300005535 Ga0070684_100001613 Ga0070684_1000016134 299
317 3300005539 Ga0068853_100136580 Ga0068853_1001365802 299
318 3300005544 Ga0070686_100001000 Ga0070686_10000100013 299
319 3300005547 Ga0070693_100090338 Ga0070693_1000903382 299
320 3300005563 Ga0068855_100155196 Ga0068855_1001551961 299
321 3300005564 Ga0070664_100021664 Ga0070664_1000216644 299
322 3300005577 Ga0068857_100017278 Ga0068857_1000172782 299
323 3300005614 Ga0068856_100026786 Ga0068856_1000267862 299
324 3300005616 Ga0068852_100008479 Ga0068852_1000084794 299
325 3300005617 Ga0068859_100083785 Ga0068859_1000837852 299
326 3300005718 Ga0068866_10003994 Ga0068866_100039942 299
327 3300005719 Ga0068861_100002902 Ga0068861_10000290212 299
328 3300005834 Ga0068851_10011555 Ga0068851_100115554 299
329 3300005840 Ga0068870_10001948 Ga0068870_100019484 299
330 3300005841 Ga0068863_100079150 Ga0068863_1000791501 299
331 3300005843 Ga0068860_100157054 Ga0068860_1001570543 299
332 3300005844 Ga0068862_100014362 Ga0068862_1000143624 299
333 3300006881 Ga0068865_100005192 Ga0068865_1000051923 299
334 3300006931 Ga0097620_100083788 Ga0097620_1000837882 299
335 3300009098 Ga0105245_10005038 Ga0105245_100050382 299
336 3300009176 Ga0105242_10005627 Ga0105242_100056279 299
337 3300009553 Ga0105249_10007525 Ga0105249_100075252 299
338 3300010375 Ga0105239_10017696 Ga0105239_100176964 299
339 3300011119 Ga0105246_10000650 Ga0105246_100006503 299
340 3300013100 Ga0157373_10007258 Ga0157373_100072584 299
341 3300013102 Ga0157371_10020386 Ga0157371_100203862 299
342 3300013105 Ga0157369_10013996 Ga0157369_100139966 299
343 3300013307 Ga0157372_10009483 Ga0157372_1000948310 299
344 3300014325 Ga0163163_10008282 Ga0163163_100082824 299
345 3300014745 Ga0157377_10001283 Ga0157377_100012834 299
346 3300017792 Ga0163161_10028000 Ga0163161_100280002 299
347 3300025899 Ga0207642_10001790 Ga0207642_100017903 299
348 3300025901 Ga0207688_10002496 Ga0207688_100024968 299
349 3300025903 Ga0207680_10008029 Ga0207680_100080294 299
350 3300025904 Ga0207647_10014382 Ga0207647_100143822 299
351 3300025907 Ga0207645_10000020 Ga0207645_1000002047 299
352 3300025908 Ga0207643_10002964 Ga0207643_100029644 299
353 3300025911 Ga0207654_10098448 Ga0207654_100984482 299
354 3300025919 Ga0207657_10008043 Ga0207657_100080434 299
355 3300025925 Ga0207650_10000076 Ga0207650_1000007676 299
356 3300025927 Ga0207687_10381705 Ga0207687_103817052 299
357 3300025931 Ga0207644_10026594 Ga0207644_100265944 299
358 3300025933 Ga0207706_10001013 Ga0207706_1000101321 299
359 3300025936 Ga0207670_10017178 Ga0207670_100171783 299
360 3300025940 Ga0207691_10000817 Ga0207691_1000081717 299
361 3300025942 Ga0207689_10000638 Ga0207689_1000063817 299
362 3300025944 Ga0207661_10000450 Ga0207661_1000045015 299
363 3300025945 Ga0207679_10000118 Ga0207679_100001183 299
364 3300025949 Ga0207667_10055330 Ga0207667_100553303 299
365 3300025961 Ga0207712_10071203 Ga0207712_100712032 299
366 3300025972 Ga0207668_10096818 Ga0207668_100968183 299
367 3300025981 Ga0207640_10291291 Ga0207640_102912912 299
368 3300026067 Ga0207678_10002080 Ga0207678_100020805 299
369 3300026088 Ga0207641_10000352 Ga0207641_1000035229 299
370 3300026089 Ga0207648_10000897 Ga0207648_1000089727 299
371 3300026095 Ga0207676_10000301 Ga0207676_1000030129 299
372 3300026116 Ga0207674_10000158 Ga0207674_1000015864 299
373 3300026121 Ga0207683_10009646 Ga0207683_100096462 299
374 3300028379 Ga0268266_10004345 Ga0268266_100043454 299
375 3300028380 Ga0268265_10215719 Ga0268265_102157192 299
376 3300048903 Ga0496100_0060027 Ga0496100_0060027_1219_2142 299
377 3300048905 Ga0496102_0193303 Ga0496102_0193303_324_1247 299
378 3300048906 Ga0496103_0158432 Ga0496103_0158432_481_1404 299
379 3300048911 Ga0496108_0000105 Ga0496108_0000105_85927_86850 299
380 3300048912 Ga0496109_0000008 Ga0496109_0000008_186635_187558 299
381 3300048913 Ga0496110_0001375 Ga0496110_0001375_10812_11735 299
382 3300048914 Ga0496111_0059062 Ga0496111_0059062_278_1201 299
383 3300048915 Ga0496112_0000914 Ga0496112_0000914_16187_17110 299
384 3300048916 Ga0496113_0000282 Ga0496113_0000282_1638_2561 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

35

117

0.97

PF00589

Phage_integrase

Phage integrase family

138

354

0.89

PF13495

Phage_int_SAM_4

Phage integrase, N-terminal SAM-like domain

34

120

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kkp-assembly1.cif.gz_A solution nmr structure of the phage integrase sam-like domain from moth 1796 from moorella thermoacetica. northeast structural genomics consortium target mtr39k (residues 64-171). 0.9073 48 99
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.8714 6 98
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.7797 6 98
2kd1-assembly1.cif.gz_A solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f 0.7474 6 106
3nkh-assembly1.cif.gz_B crystal structure of integrase from mrsa strain staphylococcus aureus 0.7462 114 289
ID Description Score Start End Superfamily
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9618 8 99 1.10.150.130
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9555 8 100 1.10.150.130
af_P9WF35_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9465 8 101 1.10.150.130
1a0pA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9437 8 101 1.10.150.130
af_P9WF35_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9277 8 101 1.10.150.130
ID Description Score Start End GO Terms
AF-A0A3B8PAE6-F1-model_v4 deleted 0.989 2 100
AF-A0A3D5USP4-F1-model_v4 Recombinase XerD 0.9812 4 95 GO:0003677
GO:0015074
AF-A0A5J4PDR5-F1-model_v4 Tyrosine recombinase XerD 0.9762 5 98 GO:0003677
GO:0015074
AF-A0A090SYA2-F1-model_v4 Tyrosine recombinase XerD 0.9642 2 106 GO:0003677
GO:0015074
AF-A0A257UTP6-F1-model_v4 Core-binding (CB) domain-containing protein 0.9615 1 101 GO:0003677
GO:0015074

Feature Viewer

pLDDT pTM Quality
85.41 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map