F429808

General Info

Members Datasets Scaffolds Average Seq Length
384 171 768 256

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100359492|Ga0070661_1003594921
Length 295
Sequence METPDGARRVPPFSSGSNDGGWNGWVVRSSRLQPFILTNLLFIGDIFASPGRTLVARHLKDIVASEKIDLSIANVENAAGGFGVTPQLADELFGFGLDVLTTGNHVWDKREIYEYFSGHPRILRPANYPEGLPGSGVVVVQARNGVDCAVLNLQGRVYMPQTDCPFRKADKILAELPEQVKVRFLDFHAEVTSEKMAMGWYLDGRVSGVVGTHTHIPTADTRILPNGTAYQTDCGMTGPYNSVIGVDKQIILERFLTQMPVRMEAARLGGELHAVIINVDEATGRATGAKRYSIS

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
138 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 0.52
Rhizosphere 96.09
Stem 0
Stem Tuber 0
Unclassified 12.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_100359492 3300005344 Bacteria 1144
2 Ga0070658_10132751 3300005327 Bacteria 2076
3 Ga0070683_100019789 3300005329 Bacteria 5983
4 Ga0070683_100061968 3300005329 Bacteria 3477
5 Ga0070683_100072518 3300005329 Bacteria 3214
6 Ga0070683_100120573 3300005329 Bacteria 2477
7 Ga0070683_100369297 3300005329 Bacteria 1366
8 Ga0070683_100402998 3300005329 Unclassified 1304
9 Ga0070683_100493367 3300005329 Bacteria 1170
10 Ga0070683_100726160 3300005329 Bacteria 952
11 Ga0068869_100051253 3300005334 Bacteria 2994
12 Ga0068869_100172727 3300005334 Bacteria 1689
13 Ga0070666_10032819 3300005335 Bacteria 3432
14 Ga0070680_100020594 3300005336 Bacteria 5236
15 Ga0070682_100000088 3300005337 Bacteria 83442
16 Ga0068868_100018008 3300005338 Bacteria 5272
17 Ga0068868_100156020 3300005338 Bacteria 1883
18 Ga0068868_100474426 3300005338 Bacteria 1092
19 Ga0070660_100062563 3300005339 Bacteria 2892
20 Ga0070660_100119941 3300005339 Bacteria 2098
21 Ga0070660_100215321 3300005339 Bacteria 1560
22 Ga0070689_100140256 3300005340 Bacteria 1944
23 Ga0070689_100208439 3300005340 Bacteria 1599
24 Ga0070691_10011185 3300005341 Bacteria 4096
25 Ga0070661_100209240 3300005344 Bacteria 1492
26 Ga0070668_100159013 3300005347 Bacteria 1832
27 Ga0070675_100056899 3300005354 Bacteria 3224
28 Ga0070673_100079672 3300005364 Bacteria 2652
29 Ga0070688_100326743 3300005365 Bacteria 1116
30 Ga0070688_100370934 3300005365 Bacteria 1053
31 Ga0070709_10053382 3300005434 Bacteria 2545
32 Ga0070714_100440345 3300005435 Bacteria 1237
33 Ga0070713_100342867 3300005436 Unclassified 1385
34 Ga0070711_100082625 3300005439 Bacteria 2293
35 Ga0070711_100254307 3300005439 Bacteria 1379
36 Ga0070708_100124520 3300005445 Bacteria 2381
37 Ga0070678_100320046 3300005456 Bacteria 1324
38 Ga0070678_100361026 3300005456 Unclassified 1252
39 Ga0070678_100545479 3300005456 Bacteria 1029
40 Ga0070681_10000605 3300005458 Bacteria 29575
41 Ga0070681_10029922 3300005458 Bacteria 5465
42 Ga0068867_100049449 3300005459 Unclassified 3096
43 Ga0070699_100007377 3300005518 Bacteria 9575
44 Ga0070679_100000883 3300005530 Bacteria 26062
45 Ga0070679_100593399 3300005530 Bacteria 1051
46 Ga0070679_100935772 3300005530 Bacteria 810
47 Ga0070684_100002114 3300005535 Bacteria 14642
48 Ga0070684_100082508 3300005535 Bacteria 2846
49 Ga0070684_100229552 3300005535 Bacteria 1695
50 Ga0068853_100055801 3300005539 Bacteria 3405
51 Ga0068853_100090612 3300005539 Bacteria 2688
52 Ga0068853_100342433 3300005539 Bacteria 1389
53 Ga0070672_100066555 3300005543 Bacteria 2853
54 Ga0070672_100139466 3300005543 Bacteria 1999
55 Ga0070695_100062984 3300005545 Bacteria 2409
56 Ga0070665_100039002 3300005548 Bacteria 4776
57 Ga0070665_100071540 3300005548 Bacteria 3475
58 Ga0070665_100286406 3300005548 Bacteria 1649
59 Ga0070665_100885892 3300005548 Bacteria 905
60 Ga0068855_100001633 3300005563 Bacteria 28123
61 Ga0068855_100006082 3300005563 Bacteria 14716
62 Ga0068855_100007832 3300005563 Bacteria 12909
63 Ga0068855_100083553 3300005563 Bacteria 3698
64 Ga0068855_100101433 3300005563 Bacteria 3313
65 Ga0068855_100144003 3300005563 Bacteria 2714
66 Ga0068855_100183117 3300005563 Bacteria 2367
67 Ga0068855_100262985 3300005563 Bacteria 1921
68 Ga0068855_100297025 3300005563 Bacteria 1789
69 Ga0070664_100103368 3300005564 Bacteria 2480
70 Ga0068857_100000792 3300005577 Bacteria 23672
71 Ga0068857_100003387 3300005577 Bacteria 13272
72 Ga0068857_100033612 3300005577 Bacteria 4536
73 Ga0068857_100207436 3300005577 Bacteria 1787
74 Ga0068854_100060696 3300005578 Bacteria 2736
75 Ga0068856_100031783 3300005614 Bacteria 5165
76 Ga0068856_100075518 3300005614 Bacteria 3338
77 Ga0068856_100189445 3300005614 Bacteria 2071
78 Ga0068856_100260488 3300005614 Bacteria 1749
79 Ga0068856_100348076 3300005614 Bacteria 1500
80 Ga0068856_100450520 3300005614 Bacteria 1308
81 Ga0068852_100224003 3300005616 Bacteria 1790
82 Ga0068852_100241703 3300005616 Bacteria 1726
83 Ga0068864_100342176 3300005618 Bacteria 1410
84 Ga0068861_100239408 3300005719 Bacteria 1543
85 Ga0068863_100117190 3300005841 Bacteria 2538
86 Ga0068863_100120562 3300005841 Bacteria 2501
87 Ga0068858_100291733 3300005842 Bacteria 1555
88 Ga0068860_100131457 3300005843 Bacteria 2402
89 Ga0068860_100640055 3300005843 Unclassified 1071
90 Ga0068860_100717646 3300005843 Bacteria 1010
91 Ga0068860_100831425 3300005843 Bacteria 938
92 Ga0070717_10062760 3300006028 Bacteria 3082
93 Ga0070716_100193004 3300006173 Bacteria 1347
94 Ga0097621_100030891 3300006237 Bacteria 4244
95 Ga0097621_100077422 3300006237 Bacteria 2760
96 Ga0097621_100116734 3300006237 Bacteria 2260
97 Ga0097621_100510874 3300006237 Bacteria 1089
98 Ga0097621_100725597 3300006237 Unclassified 916
99 Ga0068871_100048573 3300006358 Bacteria 3426
100 Ga0068871_100150662 3300006358 Bacteria 1983
101 Ga0068871_100190013 3300006358 Bacteria 1769
102 Ga0068871_100190270 3300006358 Bacteria 1767
103 Ga0068871_100259161 3300006358 Unclassified 1516
104 Ga0068871_100403757 3300006358 Unclassified 1217
105 Ga0075431_100023108 3300006847 Bacteria 6357
106 Ga0075431_100208610 3300006847 Unclassified 1996
107 Ga0075434_100193194 3300006871 Bacteria 2056
108 Ga0068865_100244097 3300006881 Bacteria 1414
109 Ga0105240_10000264 3300009093 Bacteria 103844
110 Ga0105240_10006166 3300009093 Bacteria 17670
111 Ga0105240_10017854 3300009093 Bacteria 9546
112 Ga0105240_10042395 3300009093 Bacteria 5799
113 Ga0105240_10400866 3300009093 Bacteria 1545
114 Ga0105240_10825534 3300009093 Bacteria 1002
115 Ga0105245_10008991 3300009098 Bacteria 8714
116 Ga0105245_10042372 3300009098 Bacteria 4062
117 Ga0105245_10100510 3300009098 Bacteria 2675
118 Ga0114129_10185139 3300009147 Bacteria 2831
119 Ga0114129_10555657 3300009147 Bacteria 1492
120 Ga0105243_10052143 3300009148 Bacteria 3239
121 Ga0105243_10100361 3300009148 Bacteria 2401
122 Ga0105243_10123625 3300009148 Bacteria 2186
123 Ga0105241_10038937 3300009174 Bacteria 3585
124 Ga0105241_10066758 3300009174 Bacteria 2783
125 Ga0105241_10241762 3300009174 Bacteria 1526
126 Ga0105241_10390446 3300009174 Unclassified 1218
127 Ga0105242_10020118 3300009176 Bacteria 5231
128 Ga0105242_10033563 3300009176 Bacteria 4110
129 Ga0105242_10035696 3300009176 Bacteria 3987
130 Ga0105242_10265400 3300009176 Bacteria 1553
131 Ga0105248_10031143 3300009177 Bacteria 5961
132 Ga0105248_10056002 3300009177 Bacteria 4423
133 Ga0105248_10067557 3300009177 Unclassified 4014
134 Ga0105248_10097386 3300009177 Bacteria 3314
135 Ga0105248_10107825 3300009177 Bacteria 3141
136 Ga0105248_10226706 3300009177 Bacteria 2103
137 Ga0105248_10542193 3300009177 Unclassified 1312
138 Ga0105248_10609898 3300009177 Bacteria 1231
139 Ga0105237_10012111 3300009545 Bacteria 9104
140 Ga0105237_10017568 3300009545 Bacteria 7413
141 Ga0105237_10018083 3300009545 Bacteria 7300
142 Ga0105237_10033483 3300009545 Bacteria 5205
143 Ga0105237_10038280 3300009545 Bacteria 4843
144 Ga0105237_10378956 3300009545 Bacteria 1419
145 Ga0105237_10472540 3300009545 Bacteria 1260
146 Ga0105238_10033793 3300009551 Bacteria 5204
147 Ga0105238_10041287 3300009551 Bacteria 4673
148 Ga0105238_10047269 3300009551 Bacteria 4341
149 Ga0105238_10094758 3300009551 Bacteria 2973
150 Ga0105238_10205679 3300009551 Bacteria 1944
151 Ga0105238_10253063 3300009551 Bacteria 1740
152 Ga0105238_10302361 3300009551 Bacteria 1583
153 Ga0105238_10580502 3300009551 Bacteria 1127
154 Ga0105238_10626208 3300009551 Unclassified 1085
155 Ga0105249_10660139 3300009553 Unclassified 1104
156 Ga0105239_10010343 3300010375 Bacteria 10447
157 Ga0105239_10011863 3300010375 Bacteria 9723
158 Ga0105239_10015915 3300010375 Bacteria 8326
159 Ga0105239_10020733 3300010375 Bacteria 7251
160 Ga0105239_10023725 3300010375 Bacteria 6754
161 Ga0105239_10163341 3300010375 Bacteria 2489
162 Ga0105239_10218207 3300010375 Bacteria 2138
163 Ga0105246_10050994 3300011119 Bacteria 2840
164 Ga0105246_10070711 3300011119 Bacteria 2455
165 Ga0105246_10071576 3300011119 Bacteria 2442
166 Ga0157370_10002904 3300013104 Bacteria 20437
167 Ga0157370_10005626 3300013104 Bacteria 14021
168 Ga0157370_10073376 3300013104 Bacteria 3229
169 Ga0157370_10085731 3300013104 Bacteria 2959
170 Ga0157369_10012050 3300013105 Bacteria 9817
171 Ga0157369_10013263 3300013105 Bacteria 9324
172 Ga0157369_10018410 3300013105 Bacteria 7831
173 Ga0157369_10063242 3300013105 Bacteria 3988
174 Ga0157369_10183267 3300013105 Bacteria 2202
175 Ga0157369_10843528 3300013105 Unclassified 941
176 Ga0157374_10012288 3300013296 Bacteria 7448
177 Ga0157374_10059239 3300013296 Bacteria 3580
178 Ga0157374_10389029 3300013296 Bacteria 1390
179 Ga0157378_10068265 3300013297 Bacteria 3188
180 Ga0157378_10181828 3300013297 Bacteria 1979
181 Ga0157378_10438954 3300013297 Unclassified 1293
182 Ga0157378_10743027 3300013297 Unclassified 1003
183 Ga0163162_10318557 3300013306 Unclassified 1688
184 Ga0163162_10435753 3300013306 Bacteria 1443
185 Ga0163162_10597182 3300013306 Bacteria 1230
186 Ga0163162_10660841 3300013306 Unclassified 1168
187 Ga0163162_10746563 3300013306 Bacteria 1098
188 Ga0157372_10007318 3300013307 Bacteria 11750
189 Ga0157372_10064369 3300013307 Bacteria 4114
190 Ga0157372_10066914 3300013307 Bacteria 4037
191 Ga0157372_10481954 3300013307 Bacteria 1446
192 Ga0157375_10107742 3300013308 Bacteria 2880
193 Ga0157375_10976476 3300013308 Unclassified 988
194 Ga0163163_10003230 3300014325 Bacteria 13822
195 Ga0163163_10019299 3300014325 Bacteria 6401
196 Ga0163163_10091489 3300014325 Bacteria 3057
197 Ga0163163_10115667 3300014325 Bacteria 2713
198 Ga0163163_10435180 3300014325 Bacteria 1371
199 Ga0157380_10864123 3300014326 Bacteria 927
200 Ga0157376_10001591 3300014969 Bacteria 15019
201 Ga0157376_10873604 3300014969 Unclassified 916
202 Ga0207642_10170540 3300025899 Bacteria 1177
203 Ga0207699_10069067 3300025906 Bacteria 2153
204 Ga0207699_10373567 3300025906 Bacteria 1011
205 Ga0207643_10137722 3300025908 Bacteria 1456
206 Ga0207705_10012073 3300025909 Bacteria 6240
207 Ga0207705_10015050 3300025909 Bacteria 5559
208 Ga0207705_10144316 3300025909 Bacteria 1780
209 Ga0207654_10018466 3300025911 Bacteria 3660
210 Ga0207654_10096015 3300025911 Bacteria 1817
211 Ga0207707_10000372 3300025912 Bacteria 47046
212 Ga0207707_10022131 3300025912 Bacteria 5557
213 Ga0207707_10041460 3300025912 Bacteria 4020
214 Ga0207695_10000563 3300025913 Bacteria 76084
215 Ga0207695_10002828 3300025913 Bacteria 25226
216 Ga0207695_10004561 3300025913 Bacteria 18833
217 Ga0207695_10016143 3300025913 Bacteria 8759
218 Ga0207695_10029367 3300025913 Bacteria 6078
219 Ga0207695_10182697 3300025913 Bacteria 2018
220 Ga0207695_10321905 3300025913 Bacteria 1436
221 Ga0207671_10013722 3300025914 Bacteria 6434
222 Ga0207671_10152977 3300025914 Bacteria 1783
223 Ga0207671_10185434 3300025914 Bacteria 1621
224 Ga0207671_10236583 3300025914 Bacteria 1434
225 Ga0207671_10251157 3300025914 Bacteria 1390
226 Ga0207663_10049856 3300025916 Bacteria 2599
227 Ga0207660_10008030 3300025917 Bacteria 6824
228 Ga0207660_10032661 3300025917 Bacteria 3594
229 Ga0207660_10201964 3300025917 Bacteria 1553
230 Ga0207657_10003704 3300025919 Bacteria 16243
231 Ga0207657_10059237 3300025919 Bacteria 3292
232 Ga0207657_10195585 3300025919 Bacteria 1629
233 Ga0207657_10197100 3300025919 Bacteria 1622
234 Ga0207649_10082989 3300025920 Bacteria 2079
235 Ga0207652_10011191 3300025921 Bacteria 7229
236 Ga0207652_10318102 3300025921 Bacteria 1405
237 Ga0207694_10003198 3300025924 Bacteria 13067
238 Ga0207694_10012732 3300025924 Bacteria 6336
239 Ga0207694_10024686 3300025924 Bacteria 4566
240 Ga0207694_10039682 3300025924 Bacteria 3623
241 Ga0207694_10254143 3300025924 Bacteria 1439
242 Ga0207694_10381321 3300025924 Bacteria 1170
243 Ga0207694_10432144 3300025924 Bacteria 1098
244 Ga0207687_10006608 3300025927 Bacteria 7651
245 Ga0207687_10015122 3300025927 Bacteria 5057
246 Ga0207687_10016962 3300025927 Bacteria 4787
247 Ga0207687_10532858 3300025927 Bacteria 983
248 Ga0207700_10171482 3300025928 Bacteria 1810
249 Ga0207700_10346370 3300025928 Unclassified 1293
250 Ga0207664_10485495 3300025929 Bacteria 1105
251 Ga0207644_10425399 3300025931 Bacteria 1088
252 Ga0207686_10092145 3300025934 Bacteria 2003
253 Ga0207686_10165936 3300025934 Bacteria 1552
254 Ga0207686_10313192 3300025934 Bacteria 1170
255 Ga0207686_10451126 3300025934 Bacteria 989
256 Ga0207709_10167727 3300025935 Unclassified 1538
257 Ga0207709_10387819 3300025935 Bacteria 1065
258 Ga0207669_10027687 3300025937 Bacteria 3108
259 Ga0207704_10030016 3300025938 Unclassified 3042
260 Ga0207704_10143144 3300025938 Bacteria 1676
261 Ga0207665_10047052 3300025939 Bacteria 2891
262 Ga0207691_10154223 3300025940 Bacteria 2018
263 Ga0207691_10227974 3300025940 Bacteria 1614
264 Ga0207711_10000770 3300025941 Bacteria 31501
265 Ga0207711_10018410 3300025941 Bacteria 5805
266 Ga0207711_10039871 3300025941 Unclassified 3995
267 Ga0207711_10205197 3300025941 Bacteria 1799
268 Ga0207711_10411634 3300025941 Unclassified 1257
269 Ga0207711_10473792 3300025941 Bacteria 1166
270 Ga0207661_10072082 3300025944 Bacteria 2825
271 Ga0207661_10096449 3300025944 Bacteria 2474
272 Ga0207661_10206468 3300025944 Bacteria 1729
273 Ga0207661_10499432 3300025944 Unclassified 1111
274 Ga0207661_10729974 3300025944 Bacteria 911
275 Ga0207679_10541885 3300025945 Bacteria 1043
276 Ga0207667_10001186 3300025949 Bacteria 32742
277 Ga0207667_10001746 3300025949 Bacteria 27378
278 Ga0207667_10068619 3300025949 Bacteria 3691
279 Ga0207667_10100561 3300025949 Bacteria 2982
280 Ga0207667_10523108 3300025949 Bacteria 1202
281 Ga0207712_10451961 3300025961 Bacteria 1090
282 Ga0207668_10228431 3300025972 Bacteria 1499
283 Ga0207640_10110074 3300025981 Bacteria 1950
284 Ga0207658_10065070 3300025986 Bacteria 2737
285 Ga0207677_10014868 3300026023 Bacteria 4559
286 Ga0207703_10047713 3300026035 Bacteria 3454
287 Ga0207703_10191949 3300026035 Bacteria 1809
288 Ga0207639_10035839 3300026041 Bacteria 3673
289 Ga0207702_10003891 3300026078 Bacteria 13446
290 Ga0207702_10032189 3300026078 Bacteria 4375
291 Ga0207702_10177962 3300026078 Bacteria 1956
292 Ga0207702_10323260 3300026078 Bacteria 1470
293 Ga0207702_10363642 3300026078 Unclassified 1387
294 Ga0207702_10731782 3300026078 Unclassified 976
295 Ga0207641_10107474 3300026088 Bacteria 2468
296 Ga0207648_10012106 3300026089 Bacteria 8089
297 Ga0207648_10169597 3300026089 Bacteria 1929
298 Ga0207676_10017281 3300026095 Bacteria 5229
299 Ga0207676_10609477 3300026095 Bacteria 1050
300 Ga0207674_10000503 3300026116 Bacteria 51625
301 Ga0207674_10002889 3300026116 Bacteria 21347
302 Ga0207674_10045596 3300026116 Bacteria 4508
303 Ga0207674_10072700 3300026116 Bacteria 3454
304 Ga0207674_10309048 3300026116 Bacteria 1530
305 Ga0207675_100220617 3300026118 Bacteria 1827
306 Ga0207683_10103911 3300026121 Bacteria 2538
307 Ga0207683_10131735 3300026121 Unclassified 2249
308 Ga0207683_10445608 3300026121 Bacteria 1193
309 Ga0207698_10398699 3300026142 Bacteria 1314
310 Ga0207698_10622773 3300026142 Bacteria 1066
311 Ga0268266_10050714 3300028379 Bacteria 3560
312 Ga0268264_10167820 3300028381 Bacteria 1983
313 Ga0268264_10911106 3300028381 Bacteria 883
314 Ga0265338_10418911 3300028800 Bacteria 952
315 Ga0265338_10454229 3300028800 Bacteria 907
316 Ga0265340_10043694 3300031247 Bacteria 2195
317 Ga0265339_10099470 3300031249 Bacteria 1516
318 Ga0265313_10044364 3300031595 Bacteria 2170
319 Ga0265313_10053257 3300031595 Bacteria 1927
320 Ga0265314_10053399 3300031711 Bacteria 2802
321 Ga0265342_10108890 3300031712 Bacteria 1570
322 Ga0373926_0054644 3300035083 Bacteria 1447
323 Ga0373934_0002250 3300035086 Bacteria 7092
324 Ga0373923_0032176 3300035111 Unclassified 2118
325 Ga0373945_0013122 3300035116 Bacteria 2761
326 Ga0373953_0161117 3300035117 Bacteria 964
327 Ga0373957_0078659 3300035120 Unclassified 1299
328 Ga0373943_0058217 3300035170 Unclassified 1923
329 Ga0373946_0036064 3300035171 Bacteria 2003
330 Ga0373924_0010809 3300035410 Bacteria 3378
331 Ga0373935_0000098 3300035692 Bacteria 38502
332 Ga0373927_0002146 3300035695 Bacteria 14500
333 Ga0373927_0003736 3300035695 Bacteria 10811
334 Ga0373927_0238327 3300035695 Unclassified 1195
335 Ga0373933_0061117 3300035724 Unclassified 2272
336 Ga0373933_0066738 3300035724 Unclassified 2181
337 Ga0373937_0374886 3300036401 Bacteria 1349
338 Ga0373925_0026119 3300037068 Bacteria 4271
339 Ga0373925_0116818 3300037068 Bacteria 2067
340 Ga0373925_0172542 3300037068 Bacteria 1708
341 Ga0436364_0400790 3300037853 Bacteria 2092
342 Ga0436364_0909654 3300037853 Unclassified 1646
343 Ga0436364_1356439 3300037853 Bacteria 1144
344 Ga0400490_51996 3300038726 Bacteria 58086
345 Ga0400489_83503 3300039093 Bacteria 4997
346 Ga0436365_1485036 3300039437 Bacteria 3344
347 Ga0436365_1505842 3300039437 Unclassified 1969
348 Ga0436362_0788970 3300039453 Unclassified 1345
349 Ga0466961_0192546 3300044693 Unclassified 1264
350 Ga0453684_0114279 3300044712 Bacteria 3273
351 Ga0451576_0189665 3300045051 Unclassified 2147
352 Ga0451576_0484126 3300045051 Bacteria 1300
353 Ga0495592_0059096 3300046454 Bacteria 2825
354 Ga0495651_0101431 3300046462 Unclassified 2142
355 Ga0495580_0072789 3300046472 Bacteria 2400
356 Ga0495580_0142017 3300046472 Unclassified 1664
357 Ga0495582_0137427 3300046473 Bacteria 1383
358 Ga0495594_0036847 3300046499 Bacteria 2669
359 Ga0495594_0127222 3300046499 Bacteria 1442
360 Ga0495586_0185708 3300046535 Unclassified 1177
361 Ga0495587_0003613 3300046536 Bacteria 10292
362 Ga0495635_0085302 3300046663 Unclassified 2161
363 Ga0495647_0120153 3300046681 Bacteria 1105
364 Ga0495658_0047219 3300046683 Bacteria 2424
365 Ga0495613_0272507 3300046689 Bacteria 1177
366 Ga0495636_0065900 3300047318 Bacteria 1539
367 Ga0495674_0575543 3300047319 Unclassified 894
368 Ga0495684_0061294 3300047471 Bacteria 2862
369 Ga0495602_0016267 3300048088 Bacteria 7484
370 Ga0495602_0265892 3300048088 Bacteria 1270
371 Ga0496104_0045242 3300048907 Bacteria 4139
372 Ga0496115_0065104 3300048918 Bacteria 2944
373 Ga0496116_0000123 3300048919 Bacteria 161733
374 Ga0496117_0029886 3300048920 Bacteria 4192
375 Ga0496118_0008469 3300048921 Bacteria 10625
376 Ga0496124_0133906 3300048927 Bacteria 1965
377 Ga0501047_0028694 3300049581 Bacteria 5367
378 nmdc:mga03683_41634_c1 3300050489 Bacteria 1454
379 nmdc:mga05p37_151749_c1 3300050507 Bacteria 2833
380 nmdc:mga09592_64859_c1 3300050508 Bacteria 3092
381 nmdc:mga06r32_1505_c1 3300050510 Bacteria 20950
382 nmdc:mga06r32_663739_c1 3300050510 Unclassified 1010
383 nmdc:mga0n895_195816_c1 3300050512 Bacteria 2052
384 Ga0500616_0101780 3300053153 Bacteria 1403
385 Ga0070661_100359492
386 Ga0070658_10132751
387 Ga0070683_100019789
388 Ga0070683_100061968
389 Ga0070683_100072518
390 Ga0070683_100120573
391 Ga0070683_100369297
392 Ga0070683_100402998
393 Ga0070683_100493367
394 Ga0070683_100726160
395 Ga0068869_100051253
396 Ga0068869_100172727
397 Ga0070666_10032819
398 Ga0070680_100020594
399 Ga0070682_100000088
400 Ga0068868_100018008
401 Ga0068868_100156020
402 Ga0068868_100474426
403 Ga0070660_100062563
404 Ga0070660_100119941
405 Ga0070660_100215321
406 Ga0070689_100140256
407 Ga0070689_100208439
408 Ga0070691_10011185
409 Ga0070661_100209240
410 Ga0070668_100159013
411 Ga0070675_100056899
412 Ga0070673_100079672
413 Ga0070688_100326743
414 Ga0070688_100370934
415 Ga0070709_10053382
416 Ga0070714_100440345
417 Ga0070713_100342867
418 Ga0070711_100082625
419 Ga0070711_100254307
420 Ga0070708_100124520
421 Ga0070678_100320046
422 Ga0070678_100361026
423 Ga0070678_100545479
424 Ga0070681_10000605
425 Ga0070681_10029922
426 Ga0068867_100049449
427 Ga0070699_100007377
428 Ga0070679_100000883
429 Ga0070679_100593399
430 Ga0070679_100935772
431 Ga0070684_100002114
432 Ga0070684_100082508
433 Ga0070684_100229552
434 Ga0068853_100055801
435 Ga0068853_100090612
436 Ga0068853_100342433
437 Ga0070672_100066555
438 Ga0070672_100139466
439 Ga0070695_100062984
440 Ga0070665_100039002
441 Ga0070665_100071540
442 Ga0070665_100286406
443 Ga0070665_100885892
444 Ga0068855_100001633
445 Ga0068855_100006082
446 Ga0068855_100007832
447 Ga0068855_100083553
448 Ga0068855_100101433
449 Ga0068855_100144003
450 Ga0068855_100183117
451 Ga0068855_100262985
452 Ga0068855_100297025
453 Ga0070664_100103368
454 Ga0068857_100000792
455 Ga0068857_100003387
456 Ga0068857_100033612
457 Ga0068857_100207436
458 Ga0068854_100060696
459 Ga0068856_100031783
460 Ga0068856_100075518
461 Ga0068856_100189445
462 Ga0068856_100260488
463 Ga0068856_100348076
464 Ga0068856_100450520
465 Ga0068852_100224003
466 Ga0068852_100241703
467 Ga0068864_100342176
468 Ga0068861_100239408
469 Ga0068863_100117190
470 Ga0068863_100120562
471 Ga0068858_100291733
472 Ga0068860_100131457
473 Ga0068860_100640055
474 Ga0068860_100717646
475 Ga0068860_100831425
476 Ga0070717_10062760
477 Ga0070716_100193004
478 Ga0097621_100030891
479 Ga0097621_100077422
480 Ga0097621_100116734
481 Ga0097621_100510874
482 Ga0097621_100725597
483 Ga0068871_100048573
484 Ga0068871_100150662
485 Ga0068871_100190013
486 Ga0068871_100190270
487 Ga0068871_100259161
488 Ga0068871_100403757
489 Ga0075431_100023108
490 Ga0075431_100208610
491 Ga0075434_100193194
492 Ga0068865_100244097
493 Ga0105240_10000264
494 Ga0105240_10006166
495 Ga0105240_10017854
496 Ga0105240_10042395
497 Ga0105240_10400866
498 Ga0105240_10825534
499 Ga0105245_10008991
500 Ga0105245_10042372
501 Ga0105245_10100510
502 Ga0114129_10185139
503 Ga0114129_10555657
504 Ga0105243_10052143
505 Ga0105243_10100361
506 Ga0105243_10123625
507 Ga0105241_10038937
508 Ga0105241_10066758
509 Ga0105241_10241762
510 Ga0105241_10390446
511 Ga0105242_10020118
512 Ga0105242_10033563
513 Ga0105242_10035696
514 Ga0105242_10265400
515 Ga0105248_10031143
516 Ga0105248_10056002
517 Ga0105248_10067557
518 Ga0105248_10097386
519 Ga0105248_10107825
520 Ga0105248_10226706
521 Ga0105248_10542193
522 Ga0105248_10609898
523 Ga0105237_10012111
524 Ga0105237_10017568
525 Ga0105237_10018083
526 Ga0105237_10033483
527 Ga0105237_10038280
528 Ga0105237_10378956
529 Ga0105237_10472540
530 Ga0105238_10033793
531 Ga0105238_10041287
532 Ga0105238_10047269
533 Ga0105238_10094758
534 Ga0105238_10205679
535 Ga0105238_10253063
536 Ga0105238_10302361
537 Ga0105238_10580502
538 Ga0105238_10626208
539 Ga0105249_10660139
540 Ga0105239_10010343
541 Ga0105239_10011863
542 Ga0105239_10015915
543 Ga0105239_10020733
544 Ga0105239_10023725
545 Ga0105239_10163341
546 Ga0105239_10218207
547 Ga0105246_10050994
548 Ga0105246_10070711
549 Ga0105246_10071576
550 Ga0157370_10002904
551 Ga0157370_10005626
552 Ga0157370_10073376
553 Ga0157370_10085731
554 Ga0157369_10012050
555 Ga0157369_10013263
556 Ga0157369_10018410
557 Ga0157369_10063242
558 Ga0157369_10183267
559 Ga0157369_10843528
560 Ga0157374_10012288
561 Ga0157374_10059239
562 Ga0157374_10389029
563 Ga0157378_10068265
564 Ga0157378_10181828
565 Ga0157378_10438954
566 Ga0157378_10743027
567 Ga0163162_10318557
568 Ga0163162_10435753
569 Ga0163162_10597182
570 Ga0163162_10660841
571 Ga0163162_10746563
572 Ga0157372_10007318
573 Ga0157372_10064369
574 Ga0157372_10066914
575 Ga0157372_10481954
576 Ga0157375_10107742
577 Ga0157375_10976476
578 Ga0163163_10003230
579 Ga0163163_10019299
580 Ga0163163_10091489
581 Ga0163163_10115667
582 Ga0163163_10435180
583 Ga0157380_10864123
584 Ga0157376_10001591
585 Ga0157376_10873604
586 Ga0207642_10170540
587 Ga0207699_10069067
588 Ga0207699_10373567
589 Ga0207643_10137722
590 Ga0207705_10012073
591 Ga0207705_10015050
592 Ga0207705_10144316
593 Ga0207654_10018466
594 Ga0207654_10096015
595 Ga0207707_10000372
596 Ga0207707_10022131
597 Ga0207707_10041460
598 Ga0207695_10000563
599 Ga0207695_10002828
600 Ga0207695_10004561
601 Ga0207695_10016143
602 Ga0207695_10029367
603 Ga0207695_10182697
604 Ga0207695_10321905
605 Ga0207671_10013722
606 Ga0207671_10152977
607 Ga0207671_10185434
608 Ga0207671_10236583
609 Ga0207671_10251157
610 Ga0207663_10049856
611 Ga0207660_10008030
612 Ga0207660_10032661
613 Ga0207660_10201964
614 Ga0207657_10003704
615 Ga0207657_10059237
616 Ga0207657_10195585
617 Ga0207657_10197100
618 Ga0207649_10082989
619 Ga0207652_10011191
620 Ga0207652_10318102
621 Ga0207694_10003198
622 Ga0207694_10012732
623 Ga0207694_10024686
624 Ga0207694_10039682
625 Ga0207694_10254143
626 Ga0207694_10381321
627 Ga0207694_10432144
628 Ga0207687_10006608
629 Ga0207687_10015122
630 Ga0207687_10016962
631 Ga0207687_10532858
632 Ga0207700_10171482
633 Ga0207700_10346370
634 Ga0207664_10485495
635 Ga0207644_10425399
636 Ga0207686_10092145
637 Ga0207686_10165936
638 Ga0207686_10313192
639 Ga0207686_10451126
640 Ga0207709_10167727
641 Ga0207709_10387819
642 Ga0207669_10027687
643 Ga0207704_10030016
644 Ga0207704_10143144
645 Ga0207665_10047052
646 Ga0207691_10154223
647 Ga0207691_10227974
648 Ga0207711_10000770
649 Ga0207711_10018410
650 Ga0207711_10039871
651 Ga0207711_10205197
652 Ga0207711_10411634
653 Ga0207711_10473792
654 Ga0207661_10072082
655 Ga0207661_10096449
656 Ga0207661_10206468
657 Ga0207661_10499432
658 Ga0207661_10729974
659 Ga0207679_10541885
660 Ga0207667_10001186
661 Ga0207667_10001746
662 Ga0207667_10068619
663 Ga0207667_10100561
664 Ga0207667_10523108
665 Ga0207712_10451961
666 Ga0207668_10228431
667 Ga0207640_10110074
668 Ga0207658_10065070
669 Ga0207677_10014868
670 Ga0207703_10047713
671 Ga0207703_10191949
672 Ga0207639_10035839
673 Ga0207702_10003891
674 Ga0207702_10032189
675 Ga0207702_10177962
676 Ga0207702_10323260
677 Ga0207702_10363642
678 Ga0207702_10731782
679 Ga0207641_10107474
680 Ga0207648_10012106
681 Ga0207648_10169597
682 Ga0207676_10017281
683 Ga0207676_10609477
684 Ga0207674_10000503
685 Ga0207674_10002889
686 Ga0207674_10045596
687 Ga0207674_10072700
688 Ga0207674_10309048
689 Ga0207675_100220617
690 Ga0207683_10103911
691 Ga0207683_10131735
692 Ga0207683_10445608
693 Ga0207698_10398699
694 Ga0207698_10622773
695 Ga0268266_10050714
696 Ga0268264_10167820
697 Ga0268264_10911106
698 Ga0265338_10418911
699 Ga0265338_10454229
700 Ga0265340_10043694
701 Ga0265339_10099470
702 Ga0265313_10044364
703 Ga0265313_10053257
704 Ga0265314_10053399
705 Ga0265342_10108890
706 Ga0373926_0054644
707 Ga0373934_0002250
708 Ga0373923_0032176
709 Ga0373945_0013122
710 Ga0373953_0161117
711 Ga0373957_0078659
712 Ga0373943_0058217
713 Ga0373946_0036064
714 Ga0373924_0010809
715 Ga0373935_0000098
716 Ga0373927_0002146
717 Ga0373927_0003736
718 Ga0373927_0238327
719 Ga0373933_0061117
720 Ga0373933_0066738
721 Ga0373937_0374886
722 Ga0373925_0026119
723 Ga0373925_0116818
724 Ga0373925_0172542
725 Ga0436364_0400790
726 Ga0436364_0909654
727 Ga0436364_1356439
728 Ga0400490_51996
729 Ga0400489_83503
730 Ga0436365_1485036
731 Ga0436365_1505842
732 Ga0436362_0788970
733 Ga0466961_0192546
734 Ga0453684_0114279
735 Ga0451576_0189665
736 Ga0451576_0484126
737 Ga0495592_0059096
738 Ga0495651_0101431
739 Ga0495580_0072789
740 Ga0495580_0142017
741 Ga0495582_0137427
742 Ga0495594_0036847
743 Ga0495594_0127222
744 Ga0495586_0185708
745 Ga0495587_0003613
746 Ga0495635_0085302
747 Ga0495647_0120153
748 Ga0495658_0047219
749 Ga0495613_0272507
750 Ga0495636_0065900
751 Ga0495674_0575543
752 Ga0495684_0061294
753 Ga0495602_0016267
754 Ga0495602_0265892
755 Ga0496104_0045242
756 Ga0496115_0065104
757 Ga0496116_0000123
758 Ga0496117_0029886
759 Ga0496118_0008469
760 Ga0496124_0133906
761 Ga0501047_0028694
762 nmdc:mga03683_41634_c1
763 nmdc:mga05p37_151749_c1
764 nmdc:mga09592_64859_c1
765 nmdc:mga06r32_1505_c1
766 nmdc:mga06r32_663739_c1
767 nmdc:mga0n895_195816_c1
768 Ga0500616_0101780

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13277

YmdB

YmdB-like protein

41

292

0.98

PF00149

Metallophos

Calcineurin-like phosphoesterase

38

217

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9821 1 259
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9709 1 259
2cv9-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9672 1 258
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.9649 1 260
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.9612 1 260
ID Description Score Start End Superfamily
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9821 1 259 3.60.21.10
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9709 1 259 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9697 1 258 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9585 1 258 3.60.21.10
1t71A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9317 1 258 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A432FAC8-F1-model_v4 Metallophosphatase 0.997 144 194 GO:0004113
AF-A0A2V8TV36-F1-model_v4 TIGR00282 family metallophosphoesterase 0.9949 1 257 GO:0004113
GO:0046872
AF-A0A7C3CGF5-F1-model_v4 YmdB family metallophosphoesterase 0.9932 82 257 GO:0004113
AF-A0A524QXJ7-F1-model_v4 TIGR00282 family metallophosphoesterase 0.9909 1 260 GO:0004113
GO:0046872
AF-A0A4T2A8N0-F1-model_v4 deleted 0.9908 1 258

Map