F429773

General Info

Members Datasets Scaffolds Average Seq Length
384 140 384 165

Family's Representative Sequence

Representative Sequence 3300001915|JGI24741J21665_1049709|JGI24741J21665_10497091
Length 171
Sequence MQVQVHPIHQTWLTAALPFVIIAVVLTLRLRSMSRERPLKLSTLWVVPVVYLLLVGWMLFALPPTAAGWALVAAGAVIGAVLGWHRGKMIRIERNTETGELRQKASPLAMLLLVALIVLKLGARAIFGETAAAQPGSSAMLLTDAFIGFALGLLSATRLELYLRAKRLLAS

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
105 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.43
Rhizosphere 95.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1049709 3300001915 Unclassified 617
2 JGI24740J21852_10012975 3300001979 Bacteria 3126
3 JGI24740J21852_10020525 3300001979 Bacteria 2302
4 JGI24739J22299_10003816 3300001989 Bacteria 5751
5 JGI24739J22299_10016411 3300001989 Bacteria 2680
6 JGI24737J22298_10000290 3300001990 Bacteria 16658
7 JGI24737J22298_10002168 3300001990 Bacteria 6998
8 JGI24737J22298_10019419 3300001990 Bacteria 2173
9 JGI24735J21928_10001752 3300002067 Bacteria 7650
10 JGI24735J21928_10061780 3300002067 Bacteria 1076
11 JGI24738J21930_10000677 3300002075 Bacteria 9844
12 Ga0070658_10000183 3300005327 Bacteria 54970
13 Ga0070683_100001584 3300005329 Bacteria 17600
14 Ga0070683_100006972 3300005329 Bacteria 9504
15 Ga0070683_100012444 3300005329 Bacteria 7395
16 Ga0070683_100142351 3300005329 Bacteria 2272
17 Ga0070683_100522240 3300005329 Bacteria 1135
18 Ga0070670_100011909 3300005331 Bacteria 7436
19 Ga0070670_100042083 3300005331 Bacteria 3926
20 Ga0068869_100264629 3300005334 Bacteria 1377
21 Ga0070666_10011303 3300005335 Bacteria 5602
22 Ga0070680_100002188 3300005336 Bacteria 14408
23 Ga0070680_100022410 3300005336 Bacteria 5031
24 Ga0070680_100396967 3300005336 Bacteria 1175
25 Ga0070680_101013970 3300005336 Bacteria 717
26 Ga0070682_100003586 3300005337 Bacteria 8594
27 Ga0070682_100085170 3300005337 Bacteria 2056
28 Ga0068868_100267306 3300005338 Bacteria 1444
29 Ga0070660_100000061 3300005339 Bacteria 63766
30 Ga0070660_100000355 3300005339 Bacteria 30584
31 Ga0070660_100211585 3300005339 Bacteria 1574
32 Ga0070661_100000485 3300005344 Bacteria 30409
33 Ga0070661_100031892 3300005344 Bacteria 3812
34 Ga0070661_100045413 3300005344 Bacteria 3212
35 Ga0070661_100425212 3300005344 Bacteria 1053
36 Ga0070661_100558634 3300005344 Bacteria 922
37 Ga0070692_10022598 3300005345 Bacteria 3073
38 Ga0070692_10245537 3300005345 Unclassified 1069
39 Ga0070692_10552003 3300005345 Unclassified 755
40 Ga0070671_100023728 3300005355 Bacteria 5020
41 Ga0070673_100239857 3300005364 Bacteria 1576
42 Ga0070659_100000643 3300005366 Bacteria 25509
43 Ga0070659_100052634 3300005366 Bacteria 3203
44 Ga0070659_100066425 3300005366 Bacteria 2858
45 Ga0070667_100053813 3300005367 Bacteria 3397
46 Ga0070667_100531306 3300005367 Bacteria 1080
47 Ga0070663_100097670 3300005455 Bacteria 2187
48 Ga0070663_100117035 3300005455 Unclassified 2009
49 Ga0070663_100144413 3300005455 Bacteria 1819
50 Ga0070663_100504757 3300005455 Bacteria 1005
51 Ga0070663_101176002 3300005455 Unclassified 673
52 Ga0070662_100000793 3300005457 Bacteria 19387
53 Ga0070662_100064070 3300005457 Bacteria 2690
54 Ga0070662_101020460 3300005457 Unclassified 708
55 Ga0070679_100138052 3300005530 Bacteria 2419
56 Ga0070684_100064378 3300005535 Bacteria 3216
57 Ga0070684_100113622 3300005535 Bacteria 2430
58 Ga0070684_100157155 3300005535 Bacteria 2062
59 Ga0070684_100541640 3300005535 Bacteria 1080
60 Ga0068853_100000848 3300005539 Bacteria 21352
61 Ga0068853_100015024 3300005539 Bacteria 6361
62 Ga0068853_100032362 3300005539 Bacteria 4429
63 Ga0068853_100073208 3300005539 Bacteria 2986
64 Ga0068853_100663133 3300005539 Bacteria 993
65 Ga0070696_100214713 3300005546 Bacteria 1441
66 Ga0070693_100000320 3300005547 Bacteria 22053
67 Ga0070693_100104683 3300005547 Bacteria 1730
68 Ga0070693_100164460 3300005547 Bacteria 1416
69 Ga0070693_100602417 3300005547 Bacteria 793
70 Ga0070665_100016938 3300005548 Bacteria 7307
71 Ga0068855_100000318 3300005563 Bacteria 60020
72 Ga0068855_100001622 3300005563 Bacteria 28214
73 Ga0068855_100028110 3300005563 Bacteria 6726
74 Ga0068855_100295157 3300005563 Bacteria 1796
75 Ga0068855_100380339 3300005563 Bacteria 1550
76 Ga0070664_100000066 3300005564 Bacteria 65204
77 Ga0070664_100007866 3300005564 Bacteria 8611
78 Ga0070664_100026936 3300005564 Bacteria 4774
79 Ga0070664_100045780 3300005564 Bacteria 3695
80 Ga0070664_100077575 3300005564 Bacteria 2856
81 Ga0068857_100003820 3300005577 Bacteria 12676
82 Ga0068857_100010546 3300005577 Bacteria 8034
83 Ga0068857_100052081 3300005577 Bacteria 3632
84 Ga0068857_100320901 3300005577 Bacteria 1430
85 Ga0068854_100016766 3300005578 Bacteria 4889
86 Ga0068854_100027419 3300005578 Bacteria 3926
87 Ga0068854_101671811 3300005578 Bacteria 581
88 Ga0068856_100000213 3300005614 Bacteria 62582
89 Ga0068856_100140928 3300005614 Bacteria 2418
90 Ga0068856_100260535 3300005614 Bacteria 1749
91 Ga0068856_100433039 3300005614 Bacteria 1335
92 Ga0068856_100528801 3300005614 Bacteria 1200
93 Ga0068856_100565173 3300005614 Bacteria 1159
94 Ga0068852_100001507 3300005616 Bacteria 15764
95 Ga0068852_100004169 3300005616 Bacteria 10185
96 Ga0068852_100019681 3300005616 Bacteria 5349
97 Ga0068852_100268452 3300005616 Bacteria 1641
98 Ga0068852_102203542 3300005616 Bacteria 572
99 Ga0068859_100018056 3300005617 Bacteria 7087
100 Ga0068864_100003712 3300005618 Bacteria 12602
101 Ga0068864_100344443 3300005618 Bacteria 1405
102 Ga0068851_10020242 3300005834 Bacteria 3219
103 Ga0068851_10036340 3300005834 Bacteria 2466
104 Ga0068851_10102556 3300005834 Bacteria 1520
105 Ga0068863_100005172 3300005841 Bacteria 12867
106 Ga0068863_100010570 3300005841 Bacteria 8960
107 Ga0068858_100116331 3300005842 Bacteria 2499
108 Ga0068860_100323580 3300005843 Bacteria 1514
109 Ga0068860_100507070 3300005843 Bacteria 1205
110 Ga0068860_101702947 3300005843 Unclassified 652
111 Ga0070717_10169365 3300006028 Bacteria 1899
112 Ga0068871_100089046 3300006358 Bacteria 2569
113 Ga0097620_100018056 3300006931 Bacteria 7087
114 Ga0105251_10148293 3300009011 Unclassified 1060
115 Ga0105240_10191852 3300009093 Bacteria 2402
116 Ga0105240_10408465 3300009093 Bacteria 1528
117 Ga0105243_10035268 3300009148 Bacteria 3877
118 Ga0105241_10057130 3300009174 Bacteria 2993
119 Ga0105241_10186946 3300009174 Bacteria 1722
120 Ga0105241_10588356 3300009174 Unclassified 1004
121 Ga0105242_10215233 3300009176 Bacteria 1714
122 Ga0105248_10001298 3300009177 Bacteria 27820
123 Ga0105248_10041238 3300009177 Bacteria 5174
124 Ga0105237_10015355 3300009545 Bacteria 7974
125 Ga0105237_10706259 3300009545 Bacteria 1015
126 Ga0105238_10017853 3300009551 Bacteria 7213
127 Ga0105238_10084833 3300009551 Bacteria 3157
128 Ga0157373_10012237 3300013100 Bacteria 6308
129 Ga0157373_10058401 3300013100 Bacteria 2735
130 Ga0157373_10117715 3300013100 Bacteria 1867
131 Ga0157373_10581005 3300013100 Bacteria 814
132 Ga0157371_10000616 3300013102 Bacteria 42353
133 Ga0157371_10003299 3300013102 Bacteria 14770
134 Ga0157371_10058821 3300013102 Bacteria 2726
135 Ga0157371_10122192 3300013102 Bacteria 1852
136 Ga0157371_10262917 3300013102 Bacteria 1244
137 Ga0157371_10570643 3300013102 Unclassified 840
138 Ga0157370_10102121 3300013104 Bacteria 2685
139 Ga0157370_10165632 3300013104 Bacteria 2055
140 Ga0157370_10184396 3300013104 Bacteria 1938
141 Ga0157370_10249874 3300013104 Bacteria 1640
142 Ga0157369_10136161 3300013105 Bacteria 2600
143 Ga0157369_10220043 3300013105 Bacteria 1988
144 Ga0157369_10450801 3300013105 Bacteria 1332
145 Ga0157369_10861682 3300013105 Bacteria 930
146 Ga0157374_10076673 3300013296 Bacteria 3161
147 Ga0157374_10298344 3300013296 Bacteria 1594
148 Ga0157374_10434529 3300013296 Bacteria 1313
149 Ga0157372_10099009 3300013307 Bacteria 3326
150 Ga0157372_10173744 3300013307 Bacteria 2493
151 Ga0157372_10270767 3300013307 Bacteria 1973
152 Ga0157372_10408395 3300013307 Bacteria 1582
153 Ga0157375_11023624 3300013308 Bacteria 965
154 Ga0163163_10000178 3300014325 Bacteria 65511
155 Ga0163163_10359608 3300014325 Bacteria 1512
156 Ga0182008_10016398 3300014497 Bacteria 3848
157 Ga0157379_10014369 3300014968 Bacteria 6947
158 Ga0206353_10998620 3300020082 Bacteria 3819
159 Ga0207656_10033899 3300025321 Bacteria 2129
160 Ga0207656_10130383 3300025321 Bacteria 1177
161 Ga0207713_1113951 3300025735 Unclassified 915
162 Ga0207688_10045051 3300025901 Bacteria 2460
163 Ga0207680_10000519 3300025903 Bacteria 18402
164 Ga0207647_10000721 3300025904 Bacteria 25921
165 Ga0207647_10010247 3300025904 Bacteria 6621
166 Ga0207647_10105596 3300025904 Bacteria 1669
167 Ga0207647_10191694 3300025904 Unclassified 1184
168 Ga0207645_10428747 3300025907 Bacteria 891
169 Ga0207705_10000131 3300025909 Bacteria 81639
170 Ga0207705_10000234 3300025909 Bacteria 55024
171 Ga0207705_10039446 3300025909 Bacteria 3385
172 Ga0207705_10070763 3300025909 Bacteria 2528
173 Ga0207705_10105297 3300025909 Bacteria 2079
174 Ga0207705_10195090 3300025909 Bacteria 1533
175 Ga0207654_10183006 3300025911 Bacteria 1368
176 Ga0207707_10022651 3300025912 Bacteria 5493
177 Ga0207695_10077027 3300025913 Bacteria 3389
178 Ga0207671_10115269 3300025914 Bacteria 2048
179 Ga0207660_10001191 3300025917 Bacteria 17454
180 Ga0207660_10277888 3300025917 Bacteria 1328
181 Ga0207660_11027259 3300025917 Bacteria 672
182 Ga0207660_11289832 3300025917 Bacteria 593
183 Ga0207657_10000181 3300025919 Bacteria 65099
184 Ga0207657_10000598 3300025919 Bacteria 38277
185 Ga0207657_10009578 3300025919 Bacteria 9725
186 Ga0207657_10028130 3300025919 Bacteria 5135
187 Ga0207649_10000159 3300025920 Bacteria 54703
188 Ga0207649_10090108 3300025920 Bacteria 2006
189 Ga0207649_10188315 3300025920 Bacteria 1449
190 Ga0207649_10271090 3300025920 Bacteria 1230
191 Ga0207649_10348399 3300025920 Bacteria 1095
192 Ga0207652_10172658 3300025921 Bacteria 1940
193 Ga0207652_11124353 3300025921 Bacteria 686
194 Ga0207694_10035176 3300025924 Bacteria 3842
195 Ga0207694_10060948 3300025924 Bacteria 2936
196 Ga0207650_10014607 3300025925 Bacteria 5454
197 Ga0207650_10060923 3300025925 Bacteria 2816
198 Ga0207700_10698105 3300025928 Bacteria 906
199 Ga0207644_10005675 3300025931 Bacteria 8126
200 Ga0207644_10031913 3300025931 Bacteria 3673
201 Ga0207690_10000120 3300025932 Bacteria 65338
202 Ga0207690_10001891 3300025932 Bacteria 12848
203 Ga0207690_10023425 3300025932 Bacteria 3852
204 Ga0207690_10049291 3300025932 Bacteria 2807
205 Ga0207690_10073461 3300025932 Bacteria 2365
206 Ga0207690_10079547 3300025932 Bacteria 2285
207 Ga0207706_10000200 3300025933 Bacteria 65947
208 Ga0207706_10007955 3300025933 Bacteria 9789
209 Ga0207706_10152015 3300025933 Bacteria 2036
210 Ga0207706_10474525 3300025933 Bacteria 1081
211 Ga0207709_10108838 3300025935 Bacteria 1849
212 Ga0207711_10005431 3300025941 Bacteria 10778
213 Ga0207661_10001732 3300025944 Bacteria 14921
214 Ga0207661_10027360 3300025944 Bacteria 4355
215 Ga0207661_10048583 3300025944 Bacteria 3373
216 Ga0207661_10207778 3300025944 Unclassified 1724
217 Ga0207661_10588949 3300025944 Bacteria 1020
218 Ga0207679_10000150 3300025945 Bacteria 57426
219 Ga0207679_10022960 3300025945 Bacteria 4257
220 Ga0207679_10039053 3300025945 Bacteria 3387
221 Ga0207679_10042481 3300025945 Bacteria 3268
222 Ga0207667_10000282 3300025949 Bacteria 69790
223 Ga0207667_10000443 3300025949 Bacteria 55591
224 Ga0207667_10036759 3300025949 Bacteria 5243
225 Ga0207667_10070119 3300025949 Bacteria 3649
226 Ga0207667_10207557 3300025949 Bacteria 2008
227 Ga0207651_10656275 3300025960 Bacteria 921
228 Ga0207640_10008028 3300025981 Bacteria 5834
229 Ga0207640_10042763 3300025981 Bacteria 2891
230 Ga0207640_10496729 3300025981 Bacteria 1015
231 Ga0207658_10021756 3300025986 Bacteria 4456
232 Ga0207658_10074441 3300025986 Bacteria 2580
233 Ga0207658_10174962 3300025986 Bacteria 1772
234 Ga0207677_10564505 3300026023 Bacteria 994
235 Ga0207703_10007171 3300026035 Bacteria 8867
236 Ga0207703_10360285 3300026035 Bacteria 1341
237 Ga0207639_10013211 3300026041 Bacteria 5773
238 Ga0207639_10030651 3300026041 Bacteria 3946
239 Ga0207639_10068559 3300026041 Bacteria 2764
240 Ga0207678_10005267 3300026067 Bacteria 11583
241 Ga0207678_10021689 3300026067 Bacteria 5633
242 Ga0207678_10023348 3300026067 Bacteria 5409
243 Ga0207678_10094285 3300026067 Bacteria 2558
244 Ga0207678_10097916 3300026067 Bacteria 2506
245 Ga0207702_10001142 3300026078 Bacteria 27150
246 Ga0207702_10023021 3300026078 Bacteria 5167
247 Ga0207702_10041084 3300026078 Bacteria 3877
248 Ga0207702_10041976 3300026078 Bacteria 3836
249 Ga0207702_10240945 3300026078 Bacteria 1694
250 Ga0207702_10582015 3300026078 Bacteria 1097
251 Ga0207702_10805527 3300026078 Bacteria 928
252 Ga0207641_10056185 3300026088 Bacteria 3344
253 Ga0207641_10057056 3300026088 Bacteria 3320
254 Ga0207676_10049239 3300026095 Bacteria 3276
255 Ga0207676_10084903 3300026095 Bacteria 2582
256 Ga0207676_10193133 3300026095 Bacteria 1793
257 Ga0207674_10000626 3300026116 Bacteria 46240
258 Ga0207674_10001662 3300026116 Bacteria 28614
259 Ga0207674_10003393 3300026116 Bacteria 19537
260 Ga0207674_10003404 3300026116 Bacteria 19500
261 Ga0207674_10005506 3300026116 Bacteria 15034
262 Ga0207674_10031060 3300026116 Bacteria 5613
263 Ga0207698_10003075 3300026142 Bacteria 10003
264 Ga0207698_10005264 3300026142 Bacteria 7956
265 Ga0207698_10016128 3300026142 Bacteria 5026
266 Ga0207698_10018006 3300026142 Bacteria 4804
267 Ga0207698_10043973 3300026142 Bacteria 3351
268 Ga0207698_10357321 3300026142 Bacteria 1382
269 Ga0268266_10012433 3300028379 Bacteria 7359
270 Ga0268264_11384010 3300028381 Bacteria 714
271 Ga0373948_0212871 3300034817 Bacteria 508
272 Ga0373959_0067350 3300034820 Bacteria 803
273 Ga0373960_0162200 3300035121 Unclassified 770
274 Ga0373962_0143042 3300035242 Bacteria 778
275 Ga0373931_0006998 3300035691 Bacteria 5308
276 Ga0395899_0000154 3300037312 Bacteria 104239
277 Ga0395899_0008824 3300037312 Bacteria 7759
278 Ga0395899_0010217 3300037312 Bacteria 7190
279 Ga0395899_0045303 3300037312 Bacteria 3277
280 Ga0395900_0000293 3300037418 Bacteria 75318
281 Ga0395900_0005687 3300037418 Bacteria 13035
282 Ga0395900_0010635 3300037418 Bacteria 9410
283 Ga0395900_0019372 3300037418 Bacteria 6941
284 Ga0395900_0040973 3300037418 Bacteria 4774
285 Ga0395900_0054644 3300037418 Bacteria 4112
286 Ga0395900_0057054 3300037418 Bacteria 4020
287 Ga0395900_0062021 3300037418 Bacteria 3843
288 Ga0395900_0063706 3300037418 Bacteria 3790
289 Ga0395900_0084867 3300037418 Bacteria 3254
290 Ga0395900_0092768 3300037418 Bacteria 3102
291 Ga0395900_0126755 3300037418 Bacteria 2618
292 Ga0395900_0245023 3300037418 Unclassified 1796
293 Ga0395900_0276042 3300037418 Bacteria 1674
294 Ga0395900_0344282 3300037418 Bacteria 1465
295 Ga0395898_0000219 3300037466 Bacteria 146838
296 Ga0395898_0000732 3300037466 Bacteria 57501
297 Ga0395898_0012439 3300037466 Bacteria 8797
298 Ga0395898_0034157 3300037466 Bacteria 5070
299 Ga0395898_0048457 3300037466 Bacteria 4166
300 Ga0395898_0061014 3300037466 Bacteria 3663
301 Ga0395898_0130959 3300037466 Bacteria 2403
302 Ga0395898_0379908 3300037466 Bacteria 1347
303 Ga0395898_1061319 3300037466 Bacteria 744
304 Ga0395905_0000094 3300037471 Bacteria 147776
305 Ga0395905_0000335 3300037471 Bacteria 67466
306 Ga0395905_0011073 3300037471 Bacteria 8730
307 Ga0395905_0012841 3300037471 Bacteria 8051
308 Ga0395905_0036355 3300037471 Bacteria 4625
309 Ga0395905_0086334 3300037471 Bacteria 2940
310 Ga0395905_0087575 3300037471 Bacteria 2919
311 Ga0395905_0088899 3300037471 Bacteria 2895
312 Ga0395905_0103310 3300037471 Bacteria 2675
313 Ga0395905_0116108 3300037471 Bacteria 2515
314 Ga0395905_0157429 3300037471 Bacteria 2136
315 Ga0395905_0180523 3300037471 Bacteria 1981
316 Ga0395905_0258782 3300037471 Bacteria 1625
317 Ga0395905_0570277 3300037471 Bacteria 1033
318 Ga0395905_0601359 3300037471 Bacteria 1001
319 Ga0395905_0697901 3300037471 Bacteria 917
320 Ga0395901_0000188 3300038443 Bacteria 78908
321 Ga0395901_0000228 3300038443 Bacteria 70677
322 Ga0395901_0006402 3300038443 Bacteria 11930
323 Ga0395901_0008018 3300038443 Bacteria 10665
324 Ga0395901_0014286 3300038443 Bacteria 8083
325 Ga0395901_0015498 3300038443 Bacteria 7761
326 Ga0395901_0041035 3300038443 Unclassified 4795
327 Ga0395901_0047299 3300038443 Bacteria 4467
328 Ga0395901_0157444 3300038443 Bacteria 2385
329 Ga0395901_0178926 3300038443 Unclassified 2224
330 Ga0395901_0379735 3300038443 Bacteria 1454
331 Ga0395901_0424441 3300038443 Bacteria 1363
332 Ga0395901_0532290 3300038443 Bacteria 1192
333 Ga0395901_1414523 3300038443 Unclassified 653
334 Ga0439458_0001172 3300042157 Bacteria 6657
335 Ga0439458_0005460 3300042157 Bacteria 2859
336 Ga0466972_0029810 3300044658 Bacteria 2687
337 Ga0466966_0305884 3300044684 Bacteria 955
338 Ga0466961_0033672 3300044693 Bacteria 3291
339 Ga0466963_0013330 3300044694 Bacteria 5047
340 Ga0466963_0060255 3300044694 Bacteria 2534
341 Ga0466963_0226996 3300044694 Bacteria 1308
342 Ga0466963_0691726 3300044694 Bacteria 719
343 Ga0466971_0087765 3300044719 Bacteria 1422
344 Ga0466971_0187224 3300044719 Bacteria 974
345 Ga0466970_0129154 3300044765 Unclassified 1387
346 Ga0466957_0013396 3300044842 Bacteria 4755
347 Ga0466957_0305240 3300044842 Bacteria 1070
348 Ga0466957_0602293 3300044842 Bacteria 769
349 Ga0466960_0132926 3300044901 Bacteria 1315
350 Ga0466959_0543988 3300045049 Bacteria 783
351 Ga0466959_1154745 3300045049 Unclassified 515
352 Ga0466958_0037795 3300045836 Bacteria 2894
353 Ga0466958_0100005 3300045836 Bacteria 1802
354 Ga0466958_0145161 3300045836 Bacteria 1495
355 Ga0466958_0193411 3300045836 Bacteria 1293
356 Ga0466958_0284791 3300045836 Bacteria 1059
357 Ga0466967_0004245 3300045976 Bacteria 9621
358 Ga0466967_0010489 3300045976 Bacteria 6955
359 Ga0466967_0045251 3300045976 Bacteria 3823
360 Ga0466967_0062393 3300045976 Bacteria 3308
361 Ga0466967_0068584 3300045976 Bacteria 3167
362 Ga0466967_0080150 3300045976 Bacteria 2945
363 Ga0466967_0581106 3300045976 Bacteria 1104
364 Ga0495669_0009485 3300046684 Bacteria 4105
365 Ga0496102_0318008 3300048905 Bacteria 1466
366 Ga0496104_0210618 3300048907 Bacteria 1855
367 Ga0496105_0233455 3300048908 Bacteria 1494
368 Ga0496106_0069677 3300048909 Bacteria 2685
369 Ga0496107_0028924 3300048910 Bacteria 3941
370 Ga0496107_0184541 3300048910 Bacteria 1549
371 Ga0496108_0002034 3300048911 Bacteria 16202
372 Ga0496109_0001634 3300048912 Bacteria 18733
373 Ga0496109_0079033 3300048912 Bacteria 3030
374 Ga0496109_0300083 3300048912 Bacteria 1515
375 Ga0496110_0027147 3300048913 Bacteria 4906
376 Ga0496111_0186280 3300048914 Bacteria 1543
377 Ga0496112_0005602 3300048915 Bacteria 10891
378 Ga0496112_0128345 3300048915 Bacteria 2506
379 Ga0496113_0025827 3300048916 Bacteria 4192
380 Ga0496113_0172277 3300048916 Bacteria 1714
381 Ga0496114_0000019 3300048917 Bacteria 244365
382 nmdc:mga0n895_1010560_c1 3300050512 Unclassified 812
383 Ga0466962_0048814 3300061719 Bacteria 2022
384 Ga0466962_0079509 3300061719 Bacteria 1567

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0010489 Ga0466967_0010489_1629_2048 138
2 3300034817 Ga0373948_0212871 Ga0373948_0212871_19_441 139
3 3300037471 Ga0395905_0601359 Ga0395905_0601359_19_441 139
4 3300045049 Ga0466959_1154745 Ga0466959_1154745_16_438 139
5 3300048907 Ga0496104_0210618 Ga0496104_0210618_139_561 139
6 3300048915 Ga0496112_0005602 Ga0496112_0005602_5491_5913 139
7 3300048916 Ga0496113_0172277 Ga0496113_0172277_476_898 139
8 3300001990 JGI24737J22298_10002168 JGI24737J22298_100021683 140
9 3300005331 Ga0070670_100042083 Ga0070670_1000420835 140
10 3300005366 Ga0070659_100052634 Ga0070659_1000526342 140
11 3300005577 Ga0068857_100003820 Ga0068857_1000038203 140
12 3300005618 Ga0068864_100344443 Ga0068864_1003444432 140
13 3300005843 Ga0068860_100507070 Ga0068860_1005070702 140
14 3300025901 Ga0207688_10045051 Ga0207688_100450512 140
15 3300025925 Ga0207650_10060923 Ga0207650_100609233 140
16 3300025932 Ga0207690_10079547 Ga0207690_100795472 140
17 3300026088 Ga0207641_10056185 Ga0207641_100561852 140
18 3300026095 Ga0207676_10193133 Ga0207676_101931332 140
19 3300037471 Ga0395905_0697901 Ga0395905_0697901_144_647 140
20 3300038443 Ga0395901_0157444 Ga0395901_0157444_352_813 144
21 3300044694 Ga0466963_0060255 Ga0466963_0060255_1772_2287 144
22 3300044842 Ga0466957_0602293 Ga0466957_0602293_37_552 144
23 3300045836 Ga0466958_0100005 Ga0466958_0100005_1133_1648 144
24 3300045976 Ga0466967_0068584 Ga0466967_0068584_2364_2879 144
25 3300037418 Ga0395900_0005687 Ga0395900_0005687_1373_1888 147
26 3300037466 Ga0395898_0379908 Ga0395898_0379908_41_556 147
27 3300038443 Ga0395901_0000188 Ga0395901_0000188_25979_26494 147
28 3300037312 Ga0395899_0000154 Ga0395899_0000154_20478_20927 148
29 3300037418 Ga0395900_0000293 Ga0395900_0000293_10271_10720 148
30 3300037466 Ga0395898_0000219 Ga0395898_0000219_108507_108956 148
31 3300037471 Ga0395905_0000094 Ga0395905_0000094_109445_109894 148
32 3300038443 Ga0395901_0000228 Ga0395901_0000228_10271_10720 148
33 3300005841 Ga0068863_100005172 Ga0068863_1000051728 149
34 3300042157 Ga0439458_0001172 Ga0439458_0001172_3140_3646 149
35 3300037418 Ga0395900_0054644 Ga0395900_0054644_1115_1591 151
36 3300037471 Ga0395905_0012841 Ga0395905_0012841_3225_3701 151
37 3300038443 Ga0395901_0006402 Ga0395901_0006402_3468_3944 151
38 3300037418 Ga0395900_0084867 Ga0395900_0084867_262_780 152
39 3300037418 Ga0395900_0245023 Ga0395900_0245023_275_736 152
40 3300037466 Ga0395898_0034157 Ga0395898_0034157_2454_2972 152
41 3300037471 Ga0395905_0570277 Ga0395905_0570277_11_472 152
42 3300038443 Ga0395901_0047299 Ga0395901_0047299_3185_3703 152
43 3300038443 Ga0395901_0178926 Ga0395901_0178926_1637_2098 152
44 3300013100 Ga0157373_10581005 Ga0157373_105810052 153
45 3300013104 Ga0157370_10249874 Ga0157370_102498742 153
46 3300013105 Ga0157369_10450801 Ga0157369_104508012 153
47 3300026078 Ga0207702_10582015 Ga0207702_105820153 153
48 3300044694 Ga0466963_0013330 Ga0466963_0013330_2999_3520 153
49 3300045836 Ga0466958_0037795 Ga0466958_0037795_1839_2357 153
50 3300045836 Ga0466958_0145161 Ga0466958_0145161_645_1166 153
51 3300045976 Ga0466967_0080150 Ga0466967_0080150_1054_1575 153
52 3300005614 Ga0068856_100140928 Ga0068856_1001409282 154
53 3300044842 Ga0466957_0305240 Ga0466957_0305240_64_582 154
54 3300037471 Ga0395905_0157429 Ga0395905_0157429_846_1370 156
55 3300005616 Ga0068852_100004169 Ga0068852_1000041697 158
56 3300026142 Ga0207698_10003075 Ga0207698_100030758 158
57 3300013105 Ga0157369_10220043 Ga0157369_102200432 159
58 3300037312 Ga0395899_0010217 Ga0395899_0010217_3474_3980 159
59 3300037418 Ga0395900_0062021 Ga0395900_0062021_2962_3468 159
60 3300037466 Ga0395898_0012439 Ga0395898_0012439_2460_2966 159
61 3300038443 Ga0395901_0041035 Ga0395901_0041035_2636_3142 160
62 3300005334 Ga0068869_100264629 Ga0068869_1002646292 162
63 3300005367 Ga0070667_100531306 Ga0070667_1005313062 162
64 3300005547 Ga0070693_100602417 Ga0070693_1006024172 162
65 3300005843 Ga0068860_100323580 Ga0068860_1003235802 162
66 3300009148 Ga0105243_10035268 Ga0105243_100352684 162
67 3300009176 Ga0105242_10215233 Ga0105242_102152332 162
68 3300013102 Ga0157371_10058821 Ga0157371_100588214 162
69 3300025907 Ga0207645_10428747 Ga0207645_104287471 162
70 3300025920 Ga0207649_10348399 Ga0207649_103483992 162
71 3300025935 Ga0207709_10108838 Ga0207709_101088382 162
72 3300025986 Ga0207658_10174962 Ga0207658_101749623 162
73 3300026116 Ga0207674_10031060 Ga0207674_100310602 162
74 3300002067 JGI24735J21928_10061780 JGI24735J21928_100617802 164
75 3300005329 Ga0070683_100142351 Ga0070683_1001423512 164
76 3300005336 Ga0070680_101013970 Ga0070680_1010139701 164
77 3300005337 Ga0070682_100085170 Ga0070682_1000851702 164
78 3300005339 Ga0070660_100211585 Ga0070660_1002115852 164
79 3300005455 Ga0070663_100504757 Ga0070663_1005047571 164
80 3300005530 Ga0070679_100138052 Ga0070679_1001380523 164
81 3300005535 Ga0070684_100064378 Ga0070684_1000643782 164
82 3300005539 Ga0068853_100073208 Ga0068853_1000732082 164
83 3300005564 Ga0070664_100077575 Ga0070664_1000775754 164
84 3300005577 Ga0068857_100052081 Ga0068857_1000520814 164
85 3300005578 Ga0068854_100016766 Ga0068854_1000167666 164
86 3300005614 Ga0068856_100433039 Ga0068856_1004330392 164
87 3300005834 Ga0068851_10102556 Ga0068851_101025562 164
88 3300009093 Ga0105240_10408465 Ga0105240_104084651 164
89 3300009174 Ga0105241_10057130 Ga0105241_100571302 164
90 3300013100 Ga0157373_10117715 Ga0157373_101177152 164
91 3300013102 Ga0157371_10262917 Ga0157371_102629172 164
92 3300013104 Ga0157370_10184396 Ga0157370_101843962 164
93 3300013307 Ga0157372_10270767 Ga0157372_102707672 164
94 3300025321 Ga0207656_10033899 Ga0207656_100338994 164
95 3300025904 Ga0207647_10105596 Ga0207647_101055962 164
96 3300025909 Ga0207705_10105297 Ga0207705_101052973 164
97 3300025917 Ga0207660_11027259 Ga0207660_110272591 164
98 3300025919 Ga0207657_10028130 Ga0207657_100281305 164
99 3300025920 Ga0207649_10271090 Ga0207649_102710902 164
100 3300025932 Ga0207690_10073461 Ga0207690_100734612 164
101 3300025933 Ga0207706_10152015 Ga0207706_101520154 164
102 3300025944 Ga0207661_10027360 Ga0207661_100273602 164
103 3300025945 Ga0207679_10042481 Ga0207679_100424813 164
104 3300025949 Ga0207667_10207557 Ga0207667_102075572 164
105 3300025981 Ga0207640_10496729 Ga0207640_104967292 164
106 3300026041 Ga0207639_10068559 Ga0207639_100685592 164
107 3300026067 Ga0207678_10021689 Ga0207678_100216896 164
108 3300026078 Ga0207702_10023021 Ga0207702_100230213 164
109 3300026116 Ga0207674_10003393 Ga0207674_100033936 164
110 3300026142 Ga0207698_10018006 Ga0207698_100180062 164
111 3300001989 JGI24739J22299_10003816 JGI24739J22299_100038162 166
112 3300001990 JGI24737J22298_10000290 JGI24737J22298_100002906 166
113 3300002075 JGI24738J21930_10000677 JGI24738J21930_1000067711 166
114 3300005327 Ga0070658_10000183 Ga0070658_1000018320 166
115 3300005329 Ga0070683_100001584 Ga0070683_10000158412 166
116 3300005329 Ga0070683_100522240 Ga0070683_1005222402 166
117 3300005331 Ga0070670_100011909 Ga0070670_1000119092 166
118 3300005335 Ga0070666_10011303 Ga0070666_100113036 166
119 3300005338 Ga0068868_100267306 Ga0068868_1002673062 166
120 3300005339 Ga0070660_100000355 Ga0070660_10000035520 166
121 3300005344 Ga0070661_100000485 Ga0070661_10000048515 166
122 3300005355 Ga0070671_100023728 Ga0070671_1000237282 166
123 3300005366 Ga0070659_100000643 Ga0070659_10000064322 166
124 3300005455 Ga0070663_100097670 Ga0070663_1000976702 166
125 3300005457 Ga0070662_100000793 Ga0070662_1000007933 166
126 3300005535 Ga0070684_100157155 Ga0070684_1001571554 166
127 3300005539 Ga0068853_100000848 Ga0068853_10000084822 166
128 3300005539 Ga0068853_100032362 Ga0068853_1000323621 166
129 3300005546 Ga0070696_100214713 Ga0070696_1002147132 166
130 3300005547 Ga0070693_100000320 Ga0070693_1000003205 166
131 3300005548 Ga0070665_100016938 Ga0070665_1000169386 166
132 3300005563 Ga0068855_100001622 Ga0068855_10000162216 166
133 3300005564 Ga0070664_100000066 Ga0070664_10000006615 166
134 3300005578 Ga0068854_100027419 Ga0068854_1000274192 166
135 3300005614 Ga0068856_100000213 Ga0068856_10000021320 166
136 3300005616 Ga0068852_100001507 Ga0068852_1000015075 166
137 3300005842 Ga0068858_100116331 Ga0068858_1001163312 166
138 3300009174 Ga0105241_10186946 Ga0105241_101869462 166
139 3300009177 Ga0105248_10001298 Ga0105248_1000129823 166
140 3300009545 Ga0105237_10706259 Ga0105237_107062592 166
141 3300009551 Ga0105238_10084833 Ga0105238_100848332 166
142 3300013100 Ga0157373_10012237 Ga0157373_100122375 166
143 3300013102 Ga0157371_10003299 Ga0157371_100032997 166
144 3300013296 Ga0157374_10076673 Ga0157374_100766732 166
145 3300013296 Ga0157374_10434529 Ga0157374_104345292 166
146 3300014325 Ga0163163_10000178 Ga0163163_1000017856 166
147 3300025903 Ga0207680_10000519 Ga0207680_1000051912 166
148 3300025904 Ga0207647_10010247 Ga0207647_100102472 166
149 3300025909 Ga0207705_10000234 Ga0207705_1000023420 166
150 3300025911 Ga0207654_10183006 Ga0207654_101830062 166
151 3300025919 Ga0207657_10000598 Ga0207657_1000059820 166
152 3300025920 Ga0207649_10000159 Ga0207649_1000015939 166
153 3300025924 Ga0207694_10035176 Ga0207694_100351762 166
154 3300025925 Ga0207650_10014607 Ga0207650_100146073 166
155 3300025931 Ga0207644_10005675 Ga0207644_100056757 166
156 3300025932 Ga0207690_10000120 Ga0207690_1000012022 166
157 3300025933 Ga0207706_10000200 Ga0207706_1000020020 166
158 3300025941 Ga0207711_10005431 Ga0207711_100054316 166
159 3300025944 Ga0207661_10001732 Ga0207661_100017327 166
160 3300025944 Ga0207661_10588949 Ga0207661_105889492 166
161 3300025945 Ga0207679_10000150 Ga0207679_1000015038 166
162 3300025949 Ga0207667_10000443 Ga0207667_1000044334 166
163 3300025981 Ga0207640_10008028 Ga0207640_100080287 166
164 3300025986 Ga0207658_10074441 Ga0207658_100744412 166
165 3300026023 Ga0207677_10564505 Ga0207677_105645052 166
166 3300026035 Ga0207703_10007171 Ga0207703_100071717 166
167 3300026041 Ga0207639_10013211 Ga0207639_100132114 166
168 3300026067 Ga0207678_10097916 Ga0207678_100979163 166
169 3300026078 Ga0207702_10001142 Ga0207702_1000114213 166
170 3300026078 Ga0207702_10805527 Ga0207702_108055272 166
171 3300026095 Ga0207676_10084903 Ga0207676_100849031 166
172 3300026142 Ga0207698_10043973 Ga0207698_100439735 166
173 3300028379 Ga0268266_10012433 Ga0268266_100124336 166
174 3300034820 Ga0373959_0067350 Ga0373959_0067350_188_691 166
175 3300035242 Ga0373962_0143042 Ga0373962_0143042_25_528 166
176 3300035691 Ga0373931_0006998 Ga0373931_0006998_635_1138 166
177 3300037312 Ga0395899_0008824 Ga0395899_0008824_1762_2265 166
178 3300037418 Ga0395900_0126755 Ga0395900_0126755_1514_2017 166
179 3300037466 Ga0395898_0000732 Ga0395898_0000732_47427_47930 166
180 3300038443 Ga0395901_0014286 Ga0395901_0014286_5824_6327 166
181 3300044658 Ga0466972_0029810 Ga0466972_0029810_1670_2173 166
182 3300044694 Ga0466963_0691726 Ga0466963_0691726_32_535 166
183 3300044765 Ga0466970_0129154 Ga0466970_0129154_159_662 166
184 3300044842 Ga0466957_0013396 Ga0466957_0013396_3766_4269 166
185 3300045976 Ga0466967_0004245 Ga0466967_0004245_3186_3686 166
186 3300045976 Ga0466967_0045251 Ga0466967_0045251_3085_3588 166
187 3300045976 Ga0466967_0062393 Ga0466967_0062393_99_602 166
188 3300046684 Ga0495669_0009485 Ga0495669_0009485_2665_3168 166
189 3300048910 Ga0496107_0184541 Ga0496107_0184541_958_1461 166
190 3300048912 Ga0496109_0079033 Ga0496109_0079033_188_694 166
191 3300048912 Ga0496109_0300083 Ga0496109_0300083_514_1017 166
192 3300001979 JGI24740J21852_10020525 JGI24740J21852_100205251 167
193 3300001989 JGI24739J22299_10016411 JGI24739J22299_100164113 167
194 3300001990 JGI24737J22298_10019419 JGI24737J22298_100194191 167
195 3300002067 JGI24735J21928_10001752 JGI24735J21928_100017529 167
196 3300005329 Ga0070683_100006972 Ga0070683_1000069724 167
197 3300005337 Ga0070682_100003586 Ga0070682_10000358611 167
198 3300005344 Ga0070661_100031892 Ga0070661_1000318922 167
199 3300005344 Ga0070661_100045413 Ga0070661_1000454132 167
200 3300005345 Ga0070692_10245537 Ga0070692_102455372 167
201 3300005364 Ga0070673_100239857 Ga0070673_1002398571 167
202 3300005366 Ga0070659_100066425 Ga0070659_1000664252 167
203 3300005367 Ga0070667_100053813 Ga0070667_1000538131 167
204 3300005455 Ga0070663_100117035 Ga0070663_1001170354 167
205 3300005455 Ga0070663_101176002 Ga0070663_1011760021 167
206 3300005457 Ga0070662_100064070 Ga0070662_1000640702 167
207 3300005535 Ga0070684_100541640 Ga0070684_1005416402 167
208 3300005539 Ga0068853_100663133 Ga0068853_1006631332 167
209 3300005547 Ga0070693_100104683 Ga0070693_1001046832 167
210 3300005547 Ga0070693_100164460 Ga0070693_1001644602 167
211 3300005563 Ga0068855_100295157 Ga0068855_1002951572 167
212 3300005563 Ga0068855_100380339 Ga0068855_1003803392 167
213 3300005564 Ga0070664_100007866 Ga0070664_1000078663 167
214 3300005564 Ga0070664_100045780 Ga0070664_1000457806 167
215 3300005577 Ga0068857_100010546 Ga0068857_10001054610 167
216 3300005577 Ga0068857_100320901 Ga0068857_1003209012 167
217 3300005614 Ga0068856_100528801 Ga0068856_1005288012 167
218 3300005616 Ga0068852_100268452 Ga0068852_1002684522 167
219 3300005617 Ga0068859_100018056 Ga0068859_1000180563 167
220 3300005618 Ga0068864_100003712 Ga0068864_1000037124 167
221 3300005834 Ga0068851_10036340 Ga0068851_100363402 167
222 3300005841 Ga0068863_100010570 Ga0068863_1000105703 167
223 3300005843 Ga0068860_101702947 Ga0068860_1017029472 167
224 3300006028 Ga0070717_10169365 Ga0070717_101693652 167
225 3300006358 Ga0068871_100089046 Ga0068871_1000890462 167
226 3300006931 Ga0097620_100018056 Ga0097620_1000180563 167
227 3300009011 Ga0105251_10148293 Ga0105251_101482932 167
228 3300009174 Ga0105241_10588356 Ga0105241_105883562 167
229 3300009177 Ga0105248_10041238 Ga0105248_100412383 167
230 3300009545 Ga0105237_10015355 Ga0105237_100153553 167
231 3300013100 Ga0157373_10058401 Ga0157373_100584012 167
232 3300013105 Ga0157369_10861682 Ga0157369_108616822 167
233 3300013296 Ga0157374_10298344 Ga0157374_102983442 167
234 3300013307 Ga0157372_10173744 Ga0157372_101737442 167
235 3300013307 Ga0157372_10408395 Ga0157372_104083952 167
236 3300013308 Ga0157375_11023624 Ga0157375_110236242 167
237 3300014325 Ga0163163_10359608 Ga0163163_103596082 167
238 3300014497 Ga0182008_10016398 Ga0182008_100163983 167
239 3300014968 Ga0157379_10014369 Ga0157379_100143693 167
240 3300025735 Ga0207713_1113951 Ga0207713_11139512 167
241 3300025904 Ga0207647_10191694 Ga0207647_101916942 167
242 3300025909 Ga0207705_10070763 Ga0207705_100707633 167
243 3300025912 Ga0207707_10022651 Ga0207707_100226513 167
244 3300025914 Ga0207671_10115269 Ga0207671_101152692 167
245 3300025917 Ga0207660_11289832 Ga0207660_112898321 167
246 3300025920 Ga0207649_10090108 Ga0207649_100901082 167
247 3300025921 Ga0207652_10172658 Ga0207652_101726584 167
248 3300025928 Ga0207700_10698105 Ga0207700_106981051 167
249 3300025931 Ga0207644_10031913 Ga0207644_100319133 167
250 3300025932 Ga0207690_10001891 Ga0207690_100018915 167
251 3300025932 Ga0207690_10049291 Ga0207690_100492912 167
252 3300025933 Ga0207706_10007955 Ga0207706_1000795510 167
253 3300025944 Ga0207661_10207778 Ga0207661_102077782 167
254 3300025945 Ga0207679_10039053 Ga0207679_100390533 167
255 3300025960 Ga0207651_10656275 Ga0207651_106562752 167
256 3300025986 Ga0207658_10021756 Ga0207658_100217562 167
257 3300026035 Ga0207703_10360285 Ga0207703_103602852 167
258 3300026067 Ga0207678_10005267 Ga0207678_1000526712 167
259 3300026078 Ga0207702_10041976 Ga0207702_100419764 167
260 3300026088 Ga0207641_10057056 Ga0207641_100570562 167
261 3300026095 Ga0207676_10049239 Ga0207676_100492393 167
262 3300026116 Ga0207674_10000626 Ga0207674_100006268 167
263 3300026116 Ga0207674_10005506 Ga0207674_100055064 167
264 3300026142 Ga0207698_10357321 Ga0207698_103573212 167
265 3300028381 Ga0268264_11384010 Ga0268264_113840101 167
266 3300035121 Ga0373960_0162200 Ga0373960_0162200_237_743 167
267 3300037418 Ga0395900_0057054 Ga0395900_0057054_3396_3902 167
268 3300037418 Ga0395900_0063706 Ga0395900_0063706_2172_2678 167
269 3300037418 Ga0395900_0092768 Ga0395900_0092768_708_1214 167
270 3300037466 Ga0395898_0048457 Ga0395898_0048457_1487_1993 167
271 3300037466 Ga0395898_1061319 Ga0395898_1061319_183_698 167
272 3300037471 Ga0395905_0000335 Ga0395905_0000335_66055_66561 167
273 3300037471 Ga0395905_0011073 Ga0395905_0011073_402_908 167
274 3300037471 Ga0395905_0036355 Ga0395905_0036355_2240_2746 167
275 3300037471 Ga0395905_0087575 Ga0395905_0087575_983_1489 167
276 3300037471 Ga0395905_0088899 Ga0395905_0088899_1141_1647 167
277 3300037471 Ga0395905_0103310 Ga0395905_0103310_1837_2352 167
278 3300037471 Ga0395905_0180523 Ga0395905_0180523_117_632 167
279 3300038443 Ga0395901_0015498 Ga0395901_0015498_4441_4947 167
280 3300038443 Ga0395901_0379735 Ga0395901_0379735_518_1024 167
281 3300038443 Ga0395901_0532290 Ga0395901_0532290_117_632 167
282 3300042157 Ga0439458_0005460 Ga0439458_0005460_1900_2406 167
283 3300044901 Ga0466960_0132926 Ga0466960_0132926_335_850 167
284 3300048905 Ga0496102_0318008 Ga0496102_0318008_779_1285 167
285 3300048908 Ga0496105_0233455 Ga0496105_0233455_921_1427 167
286 3300048909 Ga0496106_0069677 Ga0496106_0069677_164_670 167
287 3300048910 Ga0496107_0028924 Ga0496107_0028924_746_1252 167
288 3300048911 Ga0496108_0002034 Ga0496108_0002034_12944_13450 167
289 3300048912 Ga0496109_0001634 Ga0496109_0001634_5087_5593 167
290 3300048913 Ga0496110_0027147 Ga0496110_0027147_2914_3420 167
291 3300048914 Ga0496111_0186280 Ga0496111_0186280_66_572 167
292 3300048915 Ga0496112_0128345 Ga0496112_0128345_860_1366 167
293 3300048916 Ga0496113_0025827 Ga0496113_0025827_2699_3205 167
294 3300050512 nmdc:mga0n895_1010560_c1 nmdc:mga0n895_1010560_c1_201_704 167
295 3300005339 Ga0070660_100000061 Ga0070660_10000006169 168
296 3300005345 Ga0070692_10552003 Ga0070692_105520031 168
297 3300005563 Ga0068855_100000318 Ga0068855_10000031813 168
298 3300013102 Ga0157371_10000616 Ga0157371_1000061622 168
299 3300013104 Ga0157370_10102121 Ga0157370_101021212 168
300 3300025909 Ga0207705_10000131 Ga0207705_100001312 168
301 3300025919 Ga0207657_10000181 Ga0207657_100001816 168
302 3300025949 Ga0207667_10000282 Ga0207667_1000028237 168
303 3300048917 Ga0496114_0000019 Ga0496114_0000019_120800_121315 169
304 3300037418 Ga0395900_0040973 Ga0395900_0040973_3043_3561 170
305 3300037471 Ga0395905_0116108 Ga0395905_0116108_623_1141 170
306 3300001915 JGI24741J21665_1049709 JGI24741J21665_10497091 171
307 3300001979 JGI24740J21852_10012975 JGI24740J21852_100129751 171
308 3300005329 Ga0070683_100012444 Ga0070683_1000124447 171
309 3300005336 Ga0070680_100002188 Ga0070680_10000218816 171
310 3300005336 Ga0070680_100022410 Ga0070680_1000224102 171
311 3300005336 Ga0070680_100396967 Ga0070680_1003969672 171
312 3300005344 Ga0070661_100425212 Ga0070661_1004252122 171
313 3300005344 Ga0070661_100558634 Ga0070661_1005586341 171
314 3300005345 Ga0070692_10022598 Ga0070692_100225982 171
315 3300005455 Ga0070663_100144413 Ga0070663_1001444132 171
316 3300005457 Ga0070662_101020460 Ga0070662_1010204601 171
317 3300005535 Ga0070684_100113622 Ga0070684_1001136222 171
318 3300005539 Ga0068853_100015024 Ga0068853_1000150248 171
319 3300005563 Ga0068855_100028110 Ga0068855_1000281102 171
320 3300005564 Ga0070664_100026936 Ga0070664_1000269362 171
321 3300005578 Ga0068854_101671811 Ga0068854_1016718111 171
322 3300005614 Ga0068856_100260535 Ga0068856_1002605352 171
323 3300005614 Ga0068856_100565173 Ga0068856_1005651732 171
324 3300005616 Ga0068852_100019681 Ga0068852_1000196816 171
325 3300005616 Ga0068852_102203542 Ga0068852_1022035421 171
326 3300005834 Ga0068851_10020242 Ga0068851_100202424 171
327 3300009093 Ga0105240_10191852 Ga0105240_101918522 171
328 3300009551 Ga0105238_10017853 Ga0105238_100178532 171
329 3300013102 Ga0157371_10122192 Ga0157371_101221922 171
330 3300013102 Ga0157371_10570643 Ga0157371_105706432 171
331 3300013104 Ga0157370_10165632 Ga0157370_101656322 171
332 3300013105 Ga0157369_10136161 Ga0157369_101361612 171
333 3300013307 Ga0157372_10099009 Ga0157372_100990091 171
334 3300020082 Ga0206353_10998620 Ga0206353_109986202 171
335 3300025321 Ga0207656_10130383 Ga0207656_101303832 171
336 3300025904 Ga0207647_10000721 Ga0207647_1000072124 171
337 3300025909 Ga0207705_10039446 Ga0207705_100394463 171
338 3300025909 Ga0207705_10195090 Ga0207705_101950902 171
339 3300025913 Ga0207695_10077027 Ga0207695_100770275 171
340 3300025917 Ga0207660_10001191 Ga0207660_1000119115 171
341 3300025917 Ga0207660_10277888 Ga0207660_102778881 171
342 3300025919 Ga0207657_10009578 Ga0207657_100095788 171
343 3300025920 Ga0207649_10188315 Ga0207649_101883152 171
344 3300025921 Ga0207652_11124353 Ga0207652_111243531 171
345 3300025924 Ga0207694_10060948 Ga0207694_100609481 171
346 3300025932 Ga0207690_10023425 Ga0207690_100234253 171
347 3300025933 Ga0207706_10474525 Ga0207706_104745252 171
348 3300025944 Ga0207661_10048583 Ga0207661_100485833 171
349 3300025945 Ga0207679_10022960 Ga0207679_100229606 171
350 3300025949 Ga0207667_10036759 Ga0207667_100367592 171
351 3300025949 Ga0207667_10070119 Ga0207667_100701195 171
352 3300025981 Ga0207640_10042763 Ga0207640_100427632 171
353 3300026041 Ga0207639_10030651 Ga0207639_100306512 171
354 3300026067 Ga0207678_10023348 Ga0207678_100233487 171
355 3300026067 Ga0207678_10094285 Ga0207678_100942854 171
356 3300026078 Ga0207702_10041084 Ga0207702_100410842 171
357 3300026078 Ga0207702_10240945 Ga0207702_102409452 171
358 3300026116 Ga0207674_10001662 Ga0207674_1000166211 171
359 3300026116 Ga0207674_10003404 Ga0207674_100034042 171
360 3300026142 Ga0207698_10005264 Ga0207698_100052648 171
361 3300026142 Ga0207698_10016128 Ga0207698_100161282 171
362 3300037312 Ga0395899_0045303 Ga0395899_0045303_1458_1973 171
363 3300037418 Ga0395900_0010635 Ga0395900_0010635_8186_8701 171
364 3300037418 Ga0395900_0019372 Ga0395900_0019372_3642_4157 171
365 3300037418 Ga0395900_0276042 Ga0395900_0276042_977_1495 171
366 3300037418 Ga0395900_0344282 Ga0395900_0344282_45_560 171
367 3300037466 Ga0395898_0061014 Ga0395898_0061014_101_616 171
368 3300037466 Ga0395898_0130959 Ga0395898_0130959_600_1115 171
369 3300037471 Ga0395905_0086334 Ga0395905_0086334_1132_1647 171
370 3300037471 Ga0395905_0258782 Ga0395905_0258782_183_701 171
371 3300038443 Ga0395901_0008018 Ga0395901_0008018_296_811 171
372 3300038443 Ga0395901_0424441 Ga0395901_0424441_225_743 171
373 3300038443 Ga0395901_1414523 Ga0395901_1414523_96_611 171
374 3300044684 Ga0466966_0305884 Ga0466966_0305884_82_600 171
375 3300044693 Ga0466961_0033672 Ga0466961_0033672_332_850 171
376 3300044694 Ga0466963_0226996 Ga0466963_0226996_520_1038 171
377 3300044719 Ga0466971_0087765 Ga0466971_0087765_675_1193 171
378 3300044719 Ga0466971_0187224 Ga0466971_0187224_380_898 171
379 3300045049 Ga0466959_0543988 Ga0466959_0543988_146_664 171
380 3300045836 Ga0466958_0193411 Ga0466958_0193411_383_901 171
381 3300045836 Ga0466958_0284791 Ga0466958_0284791_261_779 171
382 3300045976 Ga0466967_0581106 Ga0466967_0581106_451_969 171
383 3300061719 Ga0466962_0048814 Ga0466962_0048814_804_1322 171
384 3300061719 Ga0466962_0079509 Ga0466962_0079509_368_886 171

Structural Annotation

Top 5 Hits

ID Description Score Start End
6trc-assembly1.cif.gz_L cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6 0.6893 109 170
7m76-assembly1.cif.gz_L room temperature xfel crystallography reveals asymmetry in the vicinity of the two phylloquinones in photosystem i 0.6245 71 170
7f4v-assembly1.cif.gz_cL cryo-em structure of a primordial cyanobacterial photosystem i 0.6169 71 171
7y5e-assembly1.cif.gz_LN in situ single-pbs-psii-psi-lhcs megacomplex. 0.5775 71 166
8bvs-assembly1.cif.gz_A cryo-em structure of rat slc22a6 bound to tenofovir 0.5694 71 163
ID Description Score Start End Superfamily
af_Q2FYT5_1_136_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7062 23 167 1.20.1250.20
af_Q2FYT5_1_136_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6878 23 167 1.20.1250.20
af_B7F9N5_61_203_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.607 90 132 1.10.10.10
af_I1MMI0_226_612_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5886 71 157 1.20.1250.20
af_Q2G226_196_445_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5746 68 164 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V5B8F3-F1-model_v4 deleted 0.8761 9 171
AF-A0A7X1F5Y7-F1-model_v4 DUF1453 family protein 0.8709 8 168 GO:0016020
AF-A0A5C0WGQ2-F1-model_v4 DUF1453 domain-containing protein 0.8653 19 170 GO:0016020
AF-A0A838L5Q8-F1-model_v4 DUF1453 family protein 0.8639 1 170 GO:0016020
AF-A0A2V5B8F3-F1-model_v4 deleted 0.8608 9 171

Feature Viewer

pLDDT pTM Quality
77.41 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map