F429773
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 384 | 140 | 384 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300001915|JGI24741J21665_1049709|JGI24741J21665_10497091 |
| Length | 171 |
| Sequence | MQVQVHPIHQTWLTAALPFVIIAVVLTLRLRSMSRERPLKLSTLWVVPVVYLLLVGWMLFALPPTAAGWALVAAGAVIGAVLGWHRGKMIRIERNTETGELRQKASPLAMLLLVALIVLKLGARAIFGETAAAQPGSSAMLLTDAFIGFALGLLSATRLELYLRAKRLLAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 105 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 106 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 107 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 108 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 109 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 115 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 116 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 117 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 118 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 119 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 120 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 121 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 122 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 123 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 124 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 128 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 129 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 130 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 131 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 132 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 135 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 136 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 137 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 138 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 139 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.43 |
| Rhizosphere | 95.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1049709 | 3300001915 | Unclassified | 617 |
| 2 | JGI24740J21852_10012975 | 3300001979 | Bacteria | 3126 |
| 3 | JGI24740J21852_10020525 | 3300001979 | Bacteria | 2302 |
| 4 | JGI24739J22299_10003816 | 3300001989 | Bacteria | 5751 |
| 5 | JGI24739J22299_10016411 | 3300001989 | Bacteria | 2680 |
| 6 | JGI24737J22298_10000290 | 3300001990 | Bacteria | 16658 |
| 7 | JGI24737J22298_10002168 | 3300001990 | Bacteria | 6998 |
| 8 | JGI24737J22298_10019419 | 3300001990 | Bacteria | 2173 |
| 9 | JGI24735J21928_10001752 | 3300002067 | Bacteria | 7650 |
| 10 | JGI24735J21928_10061780 | 3300002067 | Bacteria | 1076 |
| 11 | JGI24738J21930_10000677 | 3300002075 | Bacteria | 9844 |
| 12 | Ga0070658_10000183 | 3300005327 | Bacteria | 54970 |
| 13 | Ga0070683_100001584 | 3300005329 | Bacteria | 17600 |
| 14 | Ga0070683_100006972 | 3300005329 | Bacteria | 9504 |
| 15 | Ga0070683_100012444 | 3300005329 | Bacteria | 7395 |
| 16 | Ga0070683_100142351 | 3300005329 | Bacteria | 2272 |
| 17 | Ga0070683_100522240 | 3300005329 | Bacteria | 1135 |
| 18 | Ga0070670_100011909 | 3300005331 | Bacteria | 7436 |
| 19 | Ga0070670_100042083 | 3300005331 | Bacteria | 3926 |
| 20 | Ga0068869_100264629 | 3300005334 | Bacteria | 1377 |
| 21 | Ga0070666_10011303 | 3300005335 | Bacteria | 5602 |
| 22 | Ga0070680_100002188 | 3300005336 | Bacteria | 14408 |
| 23 | Ga0070680_100022410 | 3300005336 | Bacteria | 5031 |
| 24 | Ga0070680_100396967 | 3300005336 | Bacteria | 1175 |
| 25 | Ga0070680_101013970 | 3300005336 | Bacteria | 717 |
| 26 | Ga0070682_100003586 | 3300005337 | Bacteria | 8594 |
| 27 | Ga0070682_100085170 | 3300005337 | Bacteria | 2056 |
| 28 | Ga0068868_100267306 | 3300005338 | Bacteria | 1444 |
| 29 | Ga0070660_100000061 | 3300005339 | Bacteria | 63766 |
| 30 | Ga0070660_100000355 | 3300005339 | Bacteria | 30584 |
| 31 | Ga0070660_100211585 | 3300005339 | Bacteria | 1574 |
| 32 | Ga0070661_100000485 | 3300005344 | Bacteria | 30409 |
| 33 | Ga0070661_100031892 | 3300005344 | Bacteria | 3812 |
| 34 | Ga0070661_100045413 | 3300005344 | Bacteria | 3212 |
| 35 | Ga0070661_100425212 | 3300005344 | Bacteria | 1053 |
| 36 | Ga0070661_100558634 | 3300005344 | Bacteria | 922 |
| 37 | Ga0070692_10022598 | 3300005345 | Bacteria | 3073 |
| 38 | Ga0070692_10245537 | 3300005345 | Unclassified | 1069 |
| 39 | Ga0070692_10552003 | 3300005345 | Unclassified | 755 |
| 40 | Ga0070671_100023728 | 3300005355 | Bacteria | 5020 |
| 41 | Ga0070673_100239857 | 3300005364 | Bacteria | 1576 |
| 42 | Ga0070659_100000643 | 3300005366 | Bacteria | 25509 |
| 43 | Ga0070659_100052634 | 3300005366 | Bacteria | 3203 |
| 44 | Ga0070659_100066425 | 3300005366 | Bacteria | 2858 |
| 45 | Ga0070667_100053813 | 3300005367 | Bacteria | 3397 |
| 46 | Ga0070667_100531306 | 3300005367 | Bacteria | 1080 |
| 47 | Ga0070663_100097670 | 3300005455 | Bacteria | 2187 |
| 48 | Ga0070663_100117035 | 3300005455 | Unclassified | 2009 |
| 49 | Ga0070663_100144413 | 3300005455 | Bacteria | 1819 |
| 50 | Ga0070663_100504757 | 3300005455 | Bacteria | 1005 |
| 51 | Ga0070663_101176002 | 3300005455 | Unclassified | 673 |
| 52 | Ga0070662_100000793 | 3300005457 | Bacteria | 19387 |
| 53 | Ga0070662_100064070 | 3300005457 | Bacteria | 2690 |
| 54 | Ga0070662_101020460 | 3300005457 | Unclassified | 708 |
| 55 | Ga0070679_100138052 | 3300005530 | Bacteria | 2419 |
| 56 | Ga0070684_100064378 | 3300005535 | Bacteria | 3216 |
| 57 | Ga0070684_100113622 | 3300005535 | Bacteria | 2430 |
| 58 | Ga0070684_100157155 | 3300005535 | Bacteria | 2062 |
| 59 | Ga0070684_100541640 | 3300005535 | Bacteria | 1080 |
| 60 | Ga0068853_100000848 | 3300005539 | Bacteria | 21352 |
| 61 | Ga0068853_100015024 | 3300005539 | Bacteria | 6361 |
| 62 | Ga0068853_100032362 | 3300005539 | Bacteria | 4429 |
| 63 | Ga0068853_100073208 | 3300005539 | Bacteria | 2986 |
| 64 | Ga0068853_100663133 | 3300005539 | Bacteria | 993 |
| 65 | Ga0070696_100214713 | 3300005546 | Bacteria | 1441 |
| 66 | Ga0070693_100000320 | 3300005547 | Bacteria | 22053 |
| 67 | Ga0070693_100104683 | 3300005547 | Bacteria | 1730 |
| 68 | Ga0070693_100164460 | 3300005547 | Bacteria | 1416 |
| 69 | Ga0070693_100602417 | 3300005547 | Bacteria | 793 |
| 70 | Ga0070665_100016938 | 3300005548 | Bacteria | 7307 |
| 71 | Ga0068855_100000318 | 3300005563 | Bacteria | 60020 |
| 72 | Ga0068855_100001622 | 3300005563 | Bacteria | 28214 |
| 73 | Ga0068855_100028110 | 3300005563 | Bacteria | 6726 |
| 74 | Ga0068855_100295157 | 3300005563 | Bacteria | 1796 |
| 75 | Ga0068855_100380339 | 3300005563 | Bacteria | 1550 |
| 76 | Ga0070664_100000066 | 3300005564 | Bacteria | 65204 |
| 77 | Ga0070664_100007866 | 3300005564 | Bacteria | 8611 |
| 78 | Ga0070664_100026936 | 3300005564 | Bacteria | 4774 |
| 79 | Ga0070664_100045780 | 3300005564 | Bacteria | 3695 |
| 80 | Ga0070664_100077575 | 3300005564 | Bacteria | 2856 |
| 81 | Ga0068857_100003820 | 3300005577 | Bacteria | 12676 |
| 82 | Ga0068857_100010546 | 3300005577 | Bacteria | 8034 |
| 83 | Ga0068857_100052081 | 3300005577 | Bacteria | 3632 |
| 84 | Ga0068857_100320901 | 3300005577 | Bacteria | 1430 |
| 85 | Ga0068854_100016766 | 3300005578 | Bacteria | 4889 |
| 86 | Ga0068854_100027419 | 3300005578 | Bacteria | 3926 |
| 87 | Ga0068854_101671811 | 3300005578 | Bacteria | 581 |
| 88 | Ga0068856_100000213 | 3300005614 | Bacteria | 62582 |
| 89 | Ga0068856_100140928 | 3300005614 | Bacteria | 2418 |
| 90 | Ga0068856_100260535 | 3300005614 | Bacteria | 1749 |
| 91 | Ga0068856_100433039 | 3300005614 | Bacteria | 1335 |
| 92 | Ga0068856_100528801 | 3300005614 | Bacteria | 1200 |
| 93 | Ga0068856_100565173 | 3300005614 | Bacteria | 1159 |
| 94 | Ga0068852_100001507 | 3300005616 | Bacteria | 15764 |
| 95 | Ga0068852_100004169 | 3300005616 | Bacteria | 10185 |
| 96 | Ga0068852_100019681 | 3300005616 | Bacteria | 5349 |
| 97 | Ga0068852_100268452 | 3300005616 | Bacteria | 1641 |
| 98 | Ga0068852_102203542 | 3300005616 | Bacteria | 572 |
| 99 | Ga0068859_100018056 | 3300005617 | Bacteria | 7087 |
| 100 | Ga0068864_100003712 | 3300005618 | Bacteria | 12602 |
| 101 | Ga0068864_100344443 | 3300005618 | Bacteria | 1405 |
| 102 | Ga0068851_10020242 | 3300005834 | Bacteria | 3219 |
| 103 | Ga0068851_10036340 | 3300005834 | Bacteria | 2466 |
| 104 | Ga0068851_10102556 | 3300005834 | Bacteria | 1520 |
| 105 | Ga0068863_100005172 | 3300005841 | Bacteria | 12867 |
| 106 | Ga0068863_100010570 | 3300005841 | Bacteria | 8960 |
| 107 | Ga0068858_100116331 | 3300005842 | Bacteria | 2499 |
| 108 | Ga0068860_100323580 | 3300005843 | Bacteria | 1514 |
| 109 | Ga0068860_100507070 | 3300005843 | Bacteria | 1205 |
| 110 | Ga0068860_101702947 | 3300005843 | Unclassified | 652 |
| 111 | Ga0070717_10169365 | 3300006028 | Bacteria | 1899 |
| 112 | Ga0068871_100089046 | 3300006358 | Bacteria | 2569 |
| 113 | Ga0097620_100018056 | 3300006931 | Bacteria | 7087 |
| 114 | Ga0105251_10148293 | 3300009011 | Unclassified | 1060 |
| 115 | Ga0105240_10191852 | 3300009093 | Bacteria | 2402 |
| 116 | Ga0105240_10408465 | 3300009093 | Bacteria | 1528 |
| 117 | Ga0105243_10035268 | 3300009148 | Bacteria | 3877 |
| 118 | Ga0105241_10057130 | 3300009174 | Bacteria | 2993 |
| 119 | Ga0105241_10186946 | 3300009174 | Bacteria | 1722 |
| 120 | Ga0105241_10588356 | 3300009174 | Unclassified | 1004 |
| 121 | Ga0105242_10215233 | 3300009176 | Bacteria | 1714 |
| 122 | Ga0105248_10001298 | 3300009177 | Bacteria | 27820 |
| 123 | Ga0105248_10041238 | 3300009177 | Bacteria | 5174 |
| 124 | Ga0105237_10015355 | 3300009545 | Bacteria | 7974 |
| 125 | Ga0105237_10706259 | 3300009545 | Bacteria | 1015 |
| 126 | Ga0105238_10017853 | 3300009551 | Bacteria | 7213 |
| 127 | Ga0105238_10084833 | 3300009551 | Bacteria | 3157 |
| 128 | Ga0157373_10012237 | 3300013100 | Bacteria | 6308 |
| 129 | Ga0157373_10058401 | 3300013100 | Bacteria | 2735 |
| 130 | Ga0157373_10117715 | 3300013100 | Bacteria | 1867 |
| 131 | Ga0157373_10581005 | 3300013100 | Bacteria | 814 |
| 132 | Ga0157371_10000616 | 3300013102 | Bacteria | 42353 |
| 133 | Ga0157371_10003299 | 3300013102 | Bacteria | 14770 |
| 134 | Ga0157371_10058821 | 3300013102 | Bacteria | 2726 |
| 135 | Ga0157371_10122192 | 3300013102 | Bacteria | 1852 |
| 136 | Ga0157371_10262917 | 3300013102 | Bacteria | 1244 |
| 137 | Ga0157371_10570643 | 3300013102 | Unclassified | 840 |
| 138 | Ga0157370_10102121 | 3300013104 | Bacteria | 2685 |
| 139 | Ga0157370_10165632 | 3300013104 | Bacteria | 2055 |
| 140 | Ga0157370_10184396 | 3300013104 | Bacteria | 1938 |
| 141 | Ga0157370_10249874 | 3300013104 | Bacteria | 1640 |
| 142 | Ga0157369_10136161 | 3300013105 | Bacteria | 2600 |
| 143 | Ga0157369_10220043 | 3300013105 | Bacteria | 1988 |
| 144 | Ga0157369_10450801 | 3300013105 | Bacteria | 1332 |
| 145 | Ga0157369_10861682 | 3300013105 | Bacteria | 930 |
| 146 | Ga0157374_10076673 | 3300013296 | Bacteria | 3161 |
| 147 | Ga0157374_10298344 | 3300013296 | Bacteria | 1594 |
| 148 | Ga0157374_10434529 | 3300013296 | Bacteria | 1313 |
| 149 | Ga0157372_10099009 | 3300013307 | Bacteria | 3326 |
| 150 | Ga0157372_10173744 | 3300013307 | Bacteria | 2493 |
| 151 | Ga0157372_10270767 | 3300013307 | Bacteria | 1973 |
| 152 | Ga0157372_10408395 | 3300013307 | Bacteria | 1582 |
| 153 | Ga0157375_11023624 | 3300013308 | Bacteria | 965 |
| 154 | Ga0163163_10000178 | 3300014325 | Bacteria | 65511 |
| 155 | Ga0163163_10359608 | 3300014325 | Bacteria | 1512 |
| 156 | Ga0182008_10016398 | 3300014497 | Bacteria | 3848 |
| 157 | Ga0157379_10014369 | 3300014968 | Bacteria | 6947 |
| 158 | Ga0206353_10998620 | 3300020082 | Bacteria | 3819 |
| 159 | Ga0207656_10033899 | 3300025321 | Bacteria | 2129 |
| 160 | Ga0207656_10130383 | 3300025321 | Bacteria | 1177 |
| 161 | Ga0207713_1113951 | 3300025735 | Unclassified | 915 |
| 162 | Ga0207688_10045051 | 3300025901 | Bacteria | 2460 |
| 163 | Ga0207680_10000519 | 3300025903 | Bacteria | 18402 |
| 164 | Ga0207647_10000721 | 3300025904 | Bacteria | 25921 |
| 165 | Ga0207647_10010247 | 3300025904 | Bacteria | 6621 |
| 166 | Ga0207647_10105596 | 3300025904 | Bacteria | 1669 |
| 167 | Ga0207647_10191694 | 3300025904 | Unclassified | 1184 |
| 168 | Ga0207645_10428747 | 3300025907 | Bacteria | 891 |
| 169 | Ga0207705_10000131 | 3300025909 | Bacteria | 81639 |
| 170 | Ga0207705_10000234 | 3300025909 | Bacteria | 55024 |
| 171 | Ga0207705_10039446 | 3300025909 | Bacteria | 3385 |
| 172 | Ga0207705_10070763 | 3300025909 | Bacteria | 2528 |
| 173 | Ga0207705_10105297 | 3300025909 | Bacteria | 2079 |
| 174 | Ga0207705_10195090 | 3300025909 | Bacteria | 1533 |
| 175 | Ga0207654_10183006 | 3300025911 | Bacteria | 1368 |
| 176 | Ga0207707_10022651 | 3300025912 | Bacteria | 5493 |
| 177 | Ga0207695_10077027 | 3300025913 | Bacteria | 3389 |
| 178 | Ga0207671_10115269 | 3300025914 | Bacteria | 2048 |
| 179 | Ga0207660_10001191 | 3300025917 | Bacteria | 17454 |
| 180 | Ga0207660_10277888 | 3300025917 | Bacteria | 1328 |
| 181 | Ga0207660_11027259 | 3300025917 | Bacteria | 672 |
| 182 | Ga0207660_11289832 | 3300025917 | Bacteria | 593 |
| 183 | Ga0207657_10000181 | 3300025919 | Bacteria | 65099 |
| 184 | Ga0207657_10000598 | 3300025919 | Bacteria | 38277 |
| 185 | Ga0207657_10009578 | 3300025919 | Bacteria | 9725 |
| 186 | Ga0207657_10028130 | 3300025919 | Bacteria | 5135 |
| 187 | Ga0207649_10000159 | 3300025920 | Bacteria | 54703 |
| 188 | Ga0207649_10090108 | 3300025920 | Bacteria | 2006 |
| 189 | Ga0207649_10188315 | 3300025920 | Bacteria | 1449 |
| 190 | Ga0207649_10271090 | 3300025920 | Bacteria | 1230 |
| 191 | Ga0207649_10348399 | 3300025920 | Bacteria | 1095 |
| 192 | Ga0207652_10172658 | 3300025921 | Bacteria | 1940 |
| 193 | Ga0207652_11124353 | 3300025921 | Bacteria | 686 |
| 194 | Ga0207694_10035176 | 3300025924 | Bacteria | 3842 |
| 195 | Ga0207694_10060948 | 3300025924 | Bacteria | 2936 |
| 196 | Ga0207650_10014607 | 3300025925 | Bacteria | 5454 |
| 197 | Ga0207650_10060923 | 3300025925 | Bacteria | 2816 |
| 198 | Ga0207700_10698105 | 3300025928 | Bacteria | 906 |
| 199 | Ga0207644_10005675 | 3300025931 | Bacteria | 8126 |
| 200 | Ga0207644_10031913 | 3300025931 | Bacteria | 3673 |
| 201 | Ga0207690_10000120 | 3300025932 | Bacteria | 65338 |
| 202 | Ga0207690_10001891 | 3300025932 | Bacteria | 12848 |
| 203 | Ga0207690_10023425 | 3300025932 | Bacteria | 3852 |
| 204 | Ga0207690_10049291 | 3300025932 | Bacteria | 2807 |
| 205 | Ga0207690_10073461 | 3300025932 | Bacteria | 2365 |
| 206 | Ga0207690_10079547 | 3300025932 | Bacteria | 2285 |
| 207 | Ga0207706_10000200 | 3300025933 | Bacteria | 65947 |
| 208 | Ga0207706_10007955 | 3300025933 | Bacteria | 9789 |
| 209 | Ga0207706_10152015 | 3300025933 | Bacteria | 2036 |
| 210 | Ga0207706_10474525 | 3300025933 | Bacteria | 1081 |
| 211 | Ga0207709_10108838 | 3300025935 | Bacteria | 1849 |
| 212 | Ga0207711_10005431 | 3300025941 | Bacteria | 10778 |
| 213 | Ga0207661_10001732 | 3300025944 | Bacteria | 14921 |
| 214 | Ga0207661_10027360 | 3300025944 | Bacteria | 4355 |
| 215 | Ga0207661_10048583 | 3300025944 | Bacteria | 3373 |
| 216 | Ga0207661_10207778 | 3300025944 | Unclassified | 1724 |
| 217 | Ga0207661_10588949 | 3300025944 | Bacteria | 1020 |
| 218 | Ga0207679_10000150 | 3300025945 | Bacteria | 57426 |
| 219 | Ga0207679_10022960 | 3300025945 | Bacteria | 4257 |
| 220 | Ga0207679_10039053 | 3300025945 | Bacteria | 3387 |
| 221 | Ga0207679_10042481 | 3300025945 | Bacteria | 3268 |
| 222 | Ga0207667_10000282 | 3300025949 | Bacteria | 69790 |
| 223 | Ga0207667_10000443 | 3300025949 | Bacteria | 55591 |
| 224 | Ga0207667_10036759 | 3300025949 | Bacteria | 5243 |
| 225 | Ga0207667_10070119 | 3300025949 | Bacteria | 3649 |
| 226 | Ga0207667_10207557 | 3300025949 | Bacteria | 2008 |
| 227 | Ga0207651_10656275 | 3300025960 | Bacteria | 921 |
| 228 | Ga0207640_10008028 | 3300025981 | Bacteria | 5834 |
| 229 | Ga0207640_10042763 | 3300025981 | Bacteria | 2891 |
| 230 | Ga0207640_10496729 | 3300025981 | Bacteria | 1015 |
| 231 | Ga0207658_10021756 | 3300025986 | Bacteria | 4456 |
| 232 | Ga0207658_10074441 | 3300025986 | Bacteria | 2580 |
| 233 | Ga0207658_10174962 | 3300025986 | Bacteria | 1772 |
| 234 | Ga0207677_10564505 | 3300026023 | Bacteria | 994 |
| 235 | Ga0207703_10007171 | 3300026035 | Bacteria | 8867 |
| 236 | Ga0207703_10360285 | 3300026035 | Bacteria | 1341 |
| 237 | Ga0207639_10013211 | 3300026041 | Bacteria | 5773 |
| 238 | Ga0207639_10030651 | 3300026041 | Bacteria | 3946 |
| 239 | Ga0207639_10068559 | 3300026041 | Bacteria | 2764 |
| 240 | Ga0207678_10005267 | 3300026067 | Bacteria | 11583 |
| 241 | Ga0207678_10021689 | 3300026067 | Bacteria | 5633 |
| 242 | Ga0207678_10023348 | 3300026067 | Bacteria | 5409 |
| 243 | Ga0207678_10094285 | 3300026067 | Bacteria | 2558 |
| 244 | Ga0207678_10097916 | 3300026067 | Bacteria | 2506 |
| 245 | Ga0207702_10001142 | 3300026078 | Bacteria | 27150 |
| 246 | Ga0207702_10023021 | 3300026078 | Bacteria | 5167 |
| 247 | Ga0207702_10041084 | 3300026078 | Bacteria | 3877 |
| 248 | Ga0207702_10041976 | 3300026078 | Bacteria | 3836 |
| 249 | Ga0207702_10240945 | 3300026078 | Bacteria | 1694 |
| 250 | Ga0207702_10582015 | 3300026078 | Bacteria | 1097 |
| 251 | Ga0207702_10805527 | 3300026078 | Bacteria | 928 |
| 252 | Ga0207641_10056185 | 3300026088 | Bacteria | 3344 |
| 253 | Ga0207641_10057056 | 3300026088 | Bacteria | 3320 |
| 254 | Ga0207676_10049239 | 3300026095 | Bacteria | 3276 |
| 255 | Ga0207676_10084903 | 3300026095 | Bacteria | 2582 |
| 256 | Ga0207676_10193133 | 3300026095 | Bacteria | 1793 |
| 257 | Ga0207674_10000626 | 3300026116 | Bacteria | 46240 |
| 258 | Ga0207674_10001662 | 3300026116 | Bacteria | 28614 |
| 259 | Ga0207674_10003393 | 3300026116 | Bacteria | 19537 |
| 260 | Ga0207674_10003404 | 3300026116 | Bacteria | 19500 |
| 261 | Ga0207674_10005506 | 3300026116 | Bacteria | 15034 |
| 262 | Ga0207674_10031060 | 3300026116 | Bacteria | 5613 |
| 263 | Ga0207698_10003075 | 3300026142 | Bacteria | 10003 |
| 264 | Ga0207698_10005264 | 3300026142 | Bacteria | 7956 |
| 265 | Ga0207698_10016128 | 3300026142 | Bacteria | 5026 |
| 266 | Ga0207698_10018006 | 3300026142 | Bacteria | 4804 |
| 267 | Ga0207698_10043973 | 3300026142 | Bacteria | 3351 |
| 268 | Ga0207698_10357321 | 3300026142 | Bacteria | 1382 |
| 269 | Ga0268266_10012433 | 3300028379 | Bacteria | 7359 |
| 270 | Ga0268264_11384010 | 3300028381 | Bacteria | 714 |
| 271 | Ga0373948_0212871 | 3300034817 | Bacteria | 508 |
| 272 | Ga0373959_0067350 | 3300034820 | Bacteria | 803 |
| 273 | Ga0373960_0162200 | 3300035121 | Unclassified | 770 |
| 274 | Ga0373962_0143042 | 3300035242 | Bacteria | 778 |
| 275 | Ga0373931_0006998 | 3300035691 | Bacteria | 5308 |
| 276 | Ga0395899_0000154 | 3300037312 | Bacteria | 104239 |
| 277 | Ga0395899_0008824 | 3300037312 | Bacteria | 7759 |
| 278 | Ga0395899_0010217 | 3300037312 | Bacteria | 7190 |
| 279 | Ga0395899_0045303 | 3300037312 | Bacteria | 3277 |
| 280 | Ga0395900_0000293 | 3300037418 | Bacteria | 75318 |
| 281 | Ga0395900_0005687 | 3300037418 | Bacteria | 13035 |
| 282 | Ga0395900_0010635 | 3300037418 | Bacteria | 9410 |
| 283 | Ga0395900_0019372 | 3300037418 | Bacteria | 6941 |
| 284 | Ga0395900_0040973 | 3300037418 | Bacteria | 4774 |
| 285 | Ga0395900_0054644 | 3300037418 | Bacteria | 4112 |
| 286 | Ga0395900_0057054 | 3300037418 | Bacteria | 4020 |
| 287 | Ga0395900_0062021 | 3300037418 | Bacteria | 3843 |
| 288 | Ga0395900_0063706 | 3300037418 | Bacteria | 3790 |
| 289 | Ga0395900_0084867 | 3300037418 | Bacteria | 3254 |
| 290 | Ga0395900_0092768 | 3300037418 | Bacteria | 3102 |
| 291 | Ga0395900_0126755 | 3300037418 | Bacteria | 2618 |
| 292 | Ga0395900_0245023 | 3300037418 | Unclassified | 1796 |
| 293 | Ga0395900_0276042 | 3300037418 | Bacteria | 1674 |
| 294 | Ga0395900_0344282 | 3300037418 | Bacteria | 1465 |
| 295 | Ga0395898_0000219 | 3300037466 | Bacteria | 146838 |
| 296 | Ga0395898_0000732 | 3300037466 | Bacteria | 57501 |
| 297 | Ga0395898_0012439 | 3300037466 | Bacteria | 8797 |
| 298 | Ga0395898_0034157 | 3300037466 | Bacteria | 5070 |
| 299 | Ga0395898_0048457 | 3300037466 | Bacteria | 4166 |
| 300 | Ga0395898_0061014 | 3300037466 | Bacteria | 3663 |
| 301 | Ga0395898_0130959 | 3300037466 | Bacteria | 2403 |
| 302 | Ga0395898_0379908 | 3300037466 | Bacteria | 1347 |
| 303 | Ga0395898_1061319 | 3300037466 | Bacteria | 744 |
| 304 | Ga0395905_0000094 | 3300037471 | Bacteria | 147776 |
| 305 | Ga0395905_0000335 | 3300037471 | Bacteria | 67466 |
| 306 | Ga0395905_0011073 | 3300037471 | Bacteria | 8730 |
| 307 | Ga0395905_0012841 | 3300037471 | Bacteria | 8051 |
| 308 | Ga0395905_0036355 | 3300037471 | Bacteria | 4625 |
| 309 | Ga0395905_0086334 | 3300037471 | Bacteria | 2940 |
| 310 | Ga0395905_0087575 | 3300037471 | Bacteria | 2919 |
| 311 | Ga0395905_0088899 | 3300037471 | Bacteria | 2895 |
| 312 | Ga0395905_0103310 | 3300037471 | Bacteria | 2675 |
| 313 | Ga0395905_0116108 | 3300037471 | Bacteria | 2515 |
| 314 | Ga0395905_0157429 | 3300037471 | Bacteria | 2136 |
| 315 | Ga0395905_0180523 | 3300037471 | Bacteria | 1981 |
| 316 | Ga0395905_0258782 | 3300037471 | Bacteria | 1625 |
| 317 | Ga0395905_0570277 | 3300037471 | Bacteria | 1033 |
| 318 | Ga0395905_0601359 | 3300037471 | Bacteria | 1001 |
| 319 | Ga0395905_0697901 | 3300037471 | Bacteria | 917 |
| 320 | Ga0395901_0000188 | 3300038443 | Bacteria | 78908 |
| 321 | Ga0395901_0000228 | 3300038443 | Bacteria | 70677 |
| 322 | Ga0395901_0006402 | 3300038443 | Bacteria | 11930 |
| 323 | Ga0395901_0008018 | 3300038443 | Bacteria | 10665 |
| 324 | Ga0395901_0014286 | 3300038443 | Bacteria | 8083 |
| 325 | Ga0395901_0015498 | 3300038443 | Bacteria | 7761 |
| 326 | Ga0395901_0041035 | 3300038443 | Unclassified | 4795 |
| 327 | Ga0395901_0047299 | 3300038443 | Bacteria | 4467 |
| 328 | Ga0395901_0157444 | 3300038443 | Bacteria | 2385 |
| 329 | Ga0395901_0178926 | 3300038443 | Unclassified | 2224 |
| 330 | Ga0395901_0379735 | 3300038443 | Bacteria | 1454 |
| 331 | Ga0395901_0424441 | 3300038443 | Bacteria | 1363 |
| 332 | Ga0395901_0532290 | 3300038443 | Bacteria | 1192 |
| 333 | Ga0395901_1414523 | 3300038443 | Unclassified | 653 |
| 334 | Ga0439458_0001172 | 3300042157 | Bacteria | 6657 |
| 335 | Ga0439458_0005460 | 3300042157 | Bacteria | 2859 |
| 336 | Ga0466972_0029810 | 3300044658 | Bacteria | 2687 |
| 337 | Ga0466966_0305884 | 3300044684 | Bacteria | 955 |
| 338 | Ga0466961_0033672 | 3300044693 | Bacteria | 3291 |
| 339 | Ga0466963_0013330 | 3300044694 | Bacteria | 5047 |
| 340 | Ga0466963_0060255 | 3300044694 | Bacteria | 2534 |
| 341 | Ga0466963_0226996 | 3300044694 | Bacteria | 1308 |
| 342 | Ga0466963_0691726 | 3300044694 | Bacteria | 719 |
| 343 | Ga0466971_0087765 | 3300044719 | Bacteria | 1422 |
| 344 | Ga0466971_0187224 | 3300044719 | Bacteria | 974 |
| 345 | Ga0466970_0129154 | 3300044765 | Unclassified | 1387 |
| 346 | Ga0466957_0013396 | 3300044842 | Bacteria | 4755 |
| 347 | Ga0466957_0305240 | 3300044842 | Bacteria | 1070 |
| 348 | Ga0466957_0602293 | 3300044842 | Bacteria | 769 |
| 349 | Ga0466960_0132926 | 3300044901 | Bacteria | 1315 |
| 350 | Ga0466959_0543988 | 3300045049 | Bacteria | 783 |
| 351 | Ga0466959_1154745 | 3300045049 | Unclassified | 515 |
| 352 | Ga0466958_0037795 | 3300045836 | Bacteria | 2894 |
| 353 | Ga0466958_0100005 | 3300045836 | Bacteria | 1802 |
| 354 | Ga0466958_0145161 | 3300045836 | Bacteria | 1495 |
| 355 | Ga0466958_0193411 | 3300045836 | Bacteria | 1293 |
| 356 | Ga0466958_0284791 | 3300045836 | Bacteria | 1059 |
| 357 | Ga0466967_0004245 | 3300045976 | Bacteria | 9621 |
| 358 | Ga0466967_0010489 | 3300045976 | Bacteria | 6955 |
| 359 | Ga0466967_0045251 | 3300045976 | Bacteria | 3823 |
| 360 | Ga0466967_0062393 | 3300045976 | Bacteria | 3308 |
| 361 | Ga0466967_0068584 | 3300045976 | Bacteria | 3167 |
| 362 | Ga0466967_0080150 | 3300045976 | Bacteria | 2945 |
| 363 | Ga0466967_0581106 | 3300045976 | Bacteria | 1104 |
| 364 | Ga0495669_0009485 | 3300046684 | Bacteria | 4105 |
| 365 | Ga0496102_0318008 | 3300048905 | Bacteria | 1466 |
| 366 | Ga0496104_0210618 | 3300048907 | Bacteria | 1855 |
| 367 | Ga0496105_0233455 | 3300048908 | Bacteria | 1494 |
| 368 | Ga0496106_0069677 | 3300048909 | Bacteria | 2685 |
| 369 | Ga0496107_0028924 | 3300048910 | Bacteria | 3941 |
| 370 | Ga0496107_0184541 | 3300048910 | Bacteria | 1549 |
| 371 | Ga0496108_0002034 | 3300048911 | Bacteria | 16202 |
| 372 | Ga0496109_0001634 | 3300048912 | Bacteria | 18733 |
| 373 | Ga0496109_0079033 | 3300048912 | Bacteria | 3030 |
| 374 | Ga0496109_0300083 | 3300048912 | Bacteria | 1515 |
| 375 | Ga0496110_0027147 | 3300048913 | Bacteria | 4906 |
| 376 | Ga0496111_0186280 | 3300048914 | Bacteria | 1543 |
| 377 | Ga0496112_0005602 | 3300048915 | Bacteria | 10891 |
| 378 | Ga0496112_0128345 | 3300048915 | Bacteria | 2506 |
| 379 | Ga0496113_0025827 | 3300048916 | Bacteria | 4192 |
| 380 | Ga0496113_0172277 | 3300048916 | Bacteria | 1714 |
| 381 | Ga0496114_0000019 | 3300048917 | Bacteria | 244365 |
| 382 | nmdc:mga0n895_1010560_c1 | 3300050512 | Unclassified | 812 |
| 383 | Ga0466962_0048814 | 3300061719 | Bacteria | 2022 |
| 384 | Ga0466962_0079509 | 3300061719 | Bacteria | 1567 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0010489 | Ga0466967_0010489_1629_2048 | 138 |
| 2 | 3300034817 | Ga0373948_0212871 | Ga0373948_0212871_19_441 | 139 |
| 3 | 3300037471 | Ga0395905_0601359 | Ga0395905_0601359_19_441 | 139 |
| 4 | 3300045049 | Ga0466959_1154745 | Ga0466959_1154745_16_438 | 139 |
| 5 | 3300048907 | Ga0496104_0210618 | Ga0496104_0210618_139_561 | 139 |
| 6 | 3300048915 | Ga0496112_0005602 | Ga0496112_0005602_5491_5913 | 139 |
| 7 | 3300048916 | Ga0496113_0172277 | Ga0496113_0172277_476_898 | 139 |
| 8 | 3300001990 | JGI24737J22298_10002168 | JGI24737J22298_100021683 | 140 |
| 9 | 3300005331 | Ga0070670_100042083 | Ga0070670_1000420835 | 140 |
| 10 | 3300005366 | Ga0070659_100052634 | Ga0070659_1000526342 | 140 |
| 11 | 3300005577 | Ga0068857_100003820 | Ga0068857_1000038203 | 140 |
| 12 | 3300005618 | Ga0068864_100344443 | Ga0068864_1003444432 | 140 |
| 13 | 3300005843 | Ga0068860_100507070 | Ga0068860_1005070702 | 140 |
| 14 | 3300025901 | Ga0207688_10045051 | Ga0207688_100450512 | 140 |
| 15 | 3300025925 | Ga0207650_10060923 | Ga0207650_100609233 | 140 |
| 16 | 3300025932 | Ga0207690_10079547 | Ga0207690_100795472 | 140 |
| 17 | 3300026088 | Ga0207641_10056185 | Ga0207641_100561852 | 140 |
| 18 | 3300026095 | Ga0207676_10193133 | Ga0207676_101931332 | 140 |
| 19 | 3300037471 | Ga0395905_0697901 | Ga0395905_0697901_144_647 | 140 |
| 20 | 3300038443 | Ga0395901_0157444 | Ga0395901_0157444_352_813 | 144 |
| 21 | 3300044694 | Ga0466963_0060255 | Ga0466963_0060255_1772_2287 | 144 |
| 22 | 3300044842 | Ga0466957_0602293 | Ga0466957_0602293_37_552 | 144 |
| 23 | 3300045836 | Ga0466958_0100005 | Ga0466958_0100005_1133_1648 | 144 |
| 24 | 3300045976 | Ga0466967_0068584 | Ga0466967_0068584_2364_2879 | 144 |
| 25 | 3300037418 | Ga0395900_0005687 | Ga0395900_0005687_1373_1888 | 147 |
| 26 | 3300037466 | Ga0395898_0379908 | Ga0395898_0379908_41_556 | 147 |
| 27 | 3300038443 | Ga0395901_0000188 | Ga0395901_0000188_25979_26494 | 147 |
| 28 | 3300037312 | Ga0395899_0000154 | Ga0395899_0000154_20478_20927 | 148 |
| 29 | 3300037418 | Ga0395900_0000293 | Ga0395900_0000293_10271_10720 | 148 |
| 30 | 3300037466 | Ga0395898_0000219 | Ga0395898_0000219_108507_108956 | 148 |
| 31 | 3300037471 | Ga0395905_0000094 | Ga0395905_0000094_109445_109894 | 148 |
| 32 | 3300038443 | Ga0395901_0000228 | Ga0395901_0000228_10271_10720 | 148 |
| 33 | 3300005841 | Ga0068863_100005172 | Ga0068863_1000051728 | 149 |
| 34 | 3300042157 | Ga0439458_0001172 | Ga0439458_0001172_3140_3646 | 149 |
| 35 | 3300037418 | Ga0395900_0054644 | Ga0395900_0054644_1115_1591 | 151 |
| 36 | 3300037471 | Ga0395905_0012841 | Ga0395905_0012841_3225_3701 | 151 |
| 37 | 3300038443 | Ga0395901_0006402 | Ga0395901_0006402_3468_3944 | 151 |
| 38 | 3300037418 | Ga0395900_0084867 | Ga0395900_0084867_262_780 | 152 |
| 39 | 3300037418 | Ga0395900_0245023 | Ga0395900_0245023_275_736 | 152 |
| 40 | 3300037466 | Ga0395898_0034157 | Ga0395898_0034157_2454_2972 | 152 |
| 41 | 3300037471 | Ga0395905_0570277 | Ga0395905_0570277_11_472 | 152 |
| 42 | 3300038443 | Ga0395901_0047299 | Ga0395901_0047299_3185_3703 | 152 |
| 43 | 3300038443 | Ga0395901_0178926 | Ga0395901_0178926_1637_2098 | 152 |
| 44 | 3300013100 | Ga0157373_10581005 | Ga0157373_105810052 | 153 |
| 45 | 3300013104 | Ga0157370_10249874 | Ga0157370_102498742 | 153 |
| 46 | 3300013105 | Ga0157369_10450801 | Ga0157369_104508012 | 153 |
| 47 | 3300026078 | Ga0207702_10582015 | Ga0207702_105820153 | 153 |
| 48 | 3300044694 | Ga0466963_0013330 | Ga0466963_0013330_2999_3520 | 153 |
| 49 | 3300045836 | Ga0466958_0037795 | Ga0466958_0037795_1839_2357 | 153 |
| 50 | 3300045836 | Ga0466958_0145161 | Ga0466958_0145161_645_1166 | 153 |
| 51 | 3300045976 | Ga0466967_0080150 | Ga0466967_0080150_1054_1575 | 153 |
| 52 | 3300005614 | Ga0068856_100140928 | Ga0068856_1001409282 | 154 |
| 53 | 3300044842 | Ga0466957_0305240 | Ga0466957_0305240_64_582 | 154 |
| 54 | 3300037471 | Ga0395905_0157429 | Ga0395905_0157429_846_1370 | 156 |
| 55 | 3300005616 | Ga0068852_100004169 | Ga0068852_1000041697 | 158 |
| 56 | 3300026142 | Ga0207698_10003075 | Ga0207698_100030758 | 158 |
| 57 | 3300013105 | Ga0157369_10220043 | Ga0157369_102200432 | 159 |
| 58 | 3300037312 | Ga0395899_0010217 | Ga0395899_0010217_3474_3980 | 159 |
| 59 | 3300037418 | Ga0395900_0062021 | Ga0395900_0062021_2962_3468 | 159 |
| 60 | 3300037466 | Ga0395898_0012439 | Ga0395898_0012439_2460_2966 | 159 |
| 61 | 3300038443 | Ga0395901_0041035 | Ga0395901_0041035_2636_3142 | 160 |
| 62 | 3300005334 | Ga0068869_100264629 | Ga0068869_1002646292 | 162 |
| 63 | 3300005367 | Ga0070667_100531306 | Ga0070667_1005313062 | 162 |
| 64 | 3300005547 | Ga0070693_100602417 | Ga0070693_1006024172 | 162 |
| 65 | 3300005843 | Ga0068860_100323580 | Ga0068860_1003235802 | 162 |
| 66 | 3300009148 | Ga0105243_10035268 | Ga0105243_100352684 | 162 |
| 67 | 3300009176 | Ga0105242_10215233 | Ga0105242_102152332 | 162 |
| 68 | 3300013102 | Ga0157371_10058821 | Ga0157371_100588214 | 162 |
| 69 | 3300025907 | Ga0207645_10428747 | Ga0207645_104287471 | 162 |
| 70 | 3300025920 | Ga0207649_10348399 | Ga0207649_103483992 | 162 |
| 71 | 3300025935 | Ga0207709_10108838 | Ga0207709_101088382 | 162 |
| 72 | 3300025986 | Ga0207658_10174962 | Ga0207658_101749623 | 162 |
| 73 | 3300026116 | Ga0207674_10031060 | Ga0207674_100310602 | 162 |
| 74 | 3300002067 | JGI24735J21928_10061780 | JGI24735J21928_100617802 | 164 |
| 75 | 3300005329 | Ga0070683_100142351 | Ga0070683_1001423512 | 164 |
| 76 | 3300005336 | Ga0070680_101013970 | Ga0070680_1010139701 | 164 |
| 77 | 3300005337 | Ga0070682_100085170 | Ga0070682_1000851702 | 164 |
| 78 | 3300005339 | Ga0070660_100211585 | Ga0070660_1002115852 | 164 |
| 79 | 3300005455 | Ga0070663_100504757 | Ga0070663_1005047571 | 164 |
| 80 | 3300005530 | Ga0070679_100138052 | Ga0070679_1001380523 | 164 |
| 81 | 3300005535 | Ga0070684_100064378 | Ga0070684_1000643782 | 164 |
| 82 | 3300005539 | Ga0068853_100073208 | Ga0068853_1000732082 | 164 |
| 83 | 3300005564 | Ga0070664_100077575 | Ga0070664_1000775754 | 164 |
| 84 | 3300005577 | Ga0068857_100052081 | Ga0068857_1000520814 | 164 |
| 85 | 3300005578 | Ga0068854_100016766 | Ga0068854_1000167666 | 164 |
| 86 | 3300005614 | Ga0068856_100433039 | Ga0068856_1004330392 | 164 |
| 87 | 3300005834 | Ga0068851_10102556 | Ga0068851_101025562 | 164 |
| 88 | 3300009093 | Ga0105240_10408465 | Ga0105240_104084651 | 164 |
| 89 | 3300009174 | Ga0105241_10057130 | Ga0105241_100571302 | 164 |
| 90 | 3300013100 | Ga0157373_10117715 | Ga0157373_101177152 | 164 |
| 91 | 3300013102 | Ga0157371_10262917 | Ga0157371_102629172 | 164 |
| 92 | 3300013104 | Ga0157370_10184396 | Ga0157370_101843962 | 164 |
| 93 | 3300013307 | Ga0157372_10270767 | Ga0157372_102707672 | 164 |
| 94 | 3300025321 | Ga0207656_10033899 | Ga0207656_100338994 | 164 |
| 95 | 3300025904 | Ga0207647_10105596 | Ga0207647_101055962 | 164 |
| 96 | 3300025909 | Ga0207705_10105297 | Ga0207705_101052973 | 164 |
| 97 | 3300025917 | Ga0207660_11027259 | Ga0207660_110272591 | 164 |
| 98 | 3300025919 | Ga0207657_10028130 | Ga0207657_100281305 | 164 |
| 99 | 3300025920 | Ga0207649_10271090 | Ga0207649_102710902 | 164 |
| 100 | 3300025932 | Ga0207690_10073461 | Ga0207690_100734612 | 164 |
| 101 | 3300025933 | Ga0207706_10152015 | Ga0207706_101520154 | 164 |
| 102 | 3300025944 | Ga0207661_10027360 | Ga0207661_100273602 | 164 |
| 103 | 3300025945 | Ga0207679_10042481 | Ga0207679_100424813 | 164 |
| 104 | 3300025949 | Ga0207667_10207557 | Ga0207667_102075572 | 164 |
| 105 | 3300025981 | Ga0207640_10496729 | Ga0207640_104967292 | 164 |
| 106 | 3300026041 | Ga0207639_10068559 | Ga0207639_100685592 | 164 |
| 107 | 3300026067 | Ga0207678_10021689 | Ga0207678_100216896 | 164 |
| 108 | 3300026078 | Ga0207702_10023021 | Ga0207702_100230213 | 164 |
| 109 | 3300026116 | Ga0207674_10003393 | Ga0207674_100033936 | 164 |
| 110 | 3300026142 | Ga0207698_10018006 | Ga0207698_100180062 | 164 |
| 111 | 3300001989 | JGI24739J22299_10003816 | JGI24739J22299_100038162 | 166 |
| 112 | 3300001990 | JGI24737J22298_10000290 | JGI24737J22298_100002906 | 166 |
| 113 | 3300002075 | JGI24738J21930_10000677 | JGI24738J21930_1000067711 | 166 |
| 114 | 3300005327 | Ga0070658_10000183 | Ga0070658_1000018320 | 166 |
| 115 | 3300005329 | Ga0070683_100001584 | Ga0070683_10000158412 | 166 |
| 116 | 3300005329 | Ga0070683_100522240 | Ga0070683_1005222402 | 166 |
| 117 | 3300005331 | Ga0070670_100011909 | Ga0070670_1000119092 | 166 |
| 118 | 3300005335 | Ga0070666_10011303 | Ga0070666_100113036 | 166 |
| 119 | 3300005338 | Ga0068868_100267306 | Ga0068868_1002673062 | 166 |
| 120 | 3300005339 | Ga0070660_100000355 | Ga0070660_10000035520 | 166 |
| 121 | 3300005344 | Ga0070661_100000485 | Ga0070661_10000048515 | 166 |
| 122 | 3300005355 | Ga0070671_100023728 | Ga0070671_1000237282 | 166 |
| 123 | 3300005366 | Ga0070659_100000643 | Ga0070659_10000064322 | 166 |
| 124 | 3300005455 | Ga0070663_100097670 | Ga0070663_1000976702 | 166 |
| 125 | 3300005457 | Ga0070662_100000793 | Ga0070662_1000007933 | 166 |
| 126 | 3300005535 | Ga0070684_100157155 | Ga0070684_1001571554 | 166 |
| 127 | 3300005539 | Ga0068853_100000848 | Ga0068853_10000084822 | 166 |
| 128 | 3300005539 | Ga0068853_100032362 | Ga0068853_1000323621 | 166 |
| 129 | 3300005546 | Ga0070696_100214713 | Ga0070696_1002147132 | 166 |
| 130 | 3300005547 | Ga0070693_100000320 | Ga0070693_1000003205 | 166 |
| 131 | 3300005548 | Ga0070665_100016938 | Ga0070665_1000169386 | 166 |
| 132 | 3300005563 | Ga0068855_100001622 | Ga0068855_10000162216 | 166 |
| 133 | 3300005564 | Ga0070664_100000066 | Ga0070664_10000006615 | 166 |
| 134 | 3300005578 | Ga0068854_100027419 | Ga0068854_1000274192 | 166 |
| 135 | 3300005614 | Ga0068856_100000213 | Ga0068856_10000021320 | 166 |
| 136 | 3300005616 | Ga0068852_100001507 | Ga0068852_1000015075 | 166 |
| 137 | 3300005842 | Ga0068858_100116331 | Ga0068858_1001163312 | 166 |
| 138 | 3300009174 | Ga0105241_10186946 | Ga0105241_101869462 | 166 |
| 139 | 3300009177 | Ga0105248_10001298 | Ga0105248_1000129823 | 166 |
| 140 | 3300009545 | Ga0105237_10706259 | Ga0105237_107062592 | 166 |
| 141 | 3300009551 | Ga0105238_10084833 | Ga0105238_100848332 | 166 |
| 142 | 3300013100 | Ga0157373_10012237 | Ga0157373_100122375 | 166 |
| 143 | 3300013102 | Ga0157371_10003299 | Ga0157371_100032997 | 166 |
| 144 | 3300013296 | Ga0157374_10076673 | Ga0157374_100766732 | 166 |
| 145 | 3300013296 | Ga0157374_10434529 | Ga0157374_104345292 | 166 |
| 146 | 3300014325 | Ga0163163_10000178 | Ga0163163_1000017856 | 166 |
| 147 | 3300025903 | Ga0207680_10000519 | Ga0207680_1000051912 | 166 |
| 148 | 3300025904 | Ga0207647_10010247 | Ga0207647_100102472 | 166 |
| 149 | 3300025909 | Ga0207705_10000234 | Ga0207705_1000023420 | 166 |
| 150 | 3300025911 | Ga0207654_10183006 | Ga0207654_101830062 | 166 |
| 151 | 3300025919 | Ga0207657_10000598 | Ga0207657_1000059820 | 166 |
| 152 | 3300025920 | Ga0207649_10000159 | Ga0207649_1000015939 | 166 |
| 153 | 3300025924 | Ga0207694_10035176 | Ga0207694_100351762 | 166 |
| 154 | 3300025925 | Ga0207650_10014607 | Ga0207650_100146073 | 166 |
| 155 | 3300025931 | Ga0207644_10005675 | Ga0207644_100056757 | 166 |
| 156 | 3300025932 | Ga0207690_10000120 | Ga0207690_1000012022 | 166 |
| 157 | 3300025933 | Ga0207706_10000200 | Ga0207706_1000020020 | 166 |
| 158 | 3300025941 | Ga0207711_10005431 | Ga0207711_100054316 | 166 |
| 159 | 3300025944 | Ga0207661_10001732 | Ga0207661_100017327 | 166 |
| 160 | 3300025944 | Ga0207661_10588949 | Ga0207661_105889492 | 166 |
| 161 | 3300025945 | Ga0207679_10000150 | Ga0207679_1000015038 | 166 |
| 162 | 3300025949 | Ga0207667_10000443 | Ga0207667_1000044334 | 166 |
| 163 | 3300025981 | Ga0207640_10008028 | Ga0207640_100080287 | 166 |
| 164 | 3300025986 | Ga0207658_10074441 | Ga0207658_100744412 | 166 |
| 165 | 3300026023 | Ga0207677_10564505 | Ga0207677_105645052 | 166 |
| 166 | 3300026035 | Ga0207703_10007171 | Ga0207703_100071717 | 166 |
| 167 | 3300026041 | Ga0207639_10013211 | Ga0207639_100132114 | 166 |
| 168 | 3300026067 | Ga0207678_10097916 | Ga0207678_100979163 | 166 |
| 169 | 3300026078 | Ga0207702_10001142 | Ga0207702_1000114213 | 166 |
| 170 | 3300026078 | Ga0207702_10805527 | Ga0207702_108055272 | 166 |
| 171 | 3300026095 | Ga0207676_10084903 | Ga0207676_100849031 | 166 |
| 172 | 3300026142 | Ga0207698_10043973 | Ga0207698_100439735 | 166 |
| 173 | 3300028379 | Ga0268266_10012433 | Ga0268266_100124336 | 166 |
| 174 | 3300034820 | Ga0373959_0067350 | Ga0373959_0067350_188_691 | 166 |
| 175 | 3300035242 | Ga0373962_0143042 | Ga0373962_0143042_25_528 | 166 |
| 176 | 3300035691 | Ga0373931_0006998 | Ga0373931_0006998_635_1138 | 166 |
| 177 | 3300037312 | Ga0395899_0008824 | Ga0395899_0008824_1762_2265 | 166 |
| 178 | 3300037418 | Ga0395900_0126755 | Ga0395900_0126755_1514_2017 | 166 |
| 179 | 3300037466 | Ga0395898_0000732 | Ga0395898_0000732_47427_47930 | 166 |
| 180 | 3300038443 | Ga0395901_0014286 | Ga0395901_0014286_5824_6327 | 166 |
| 181 | 3300044658 | Ga0466972_0029810 | Ga0466972_0029810_1670_2173 | 166 |
| 182 | 3300044694 | Ga0466963_0691726 | Ga0466963_0691726_32_535 | 166 |
| 183 | 3300044765 | Ga0466970_0129154 | Ga0466970_0129154_159_662 | 166 |
| 184 | 3300044842 | Ga0466957_0013396 | Ga0466957_0013396_3766_4269 | 166 |
| 185 | 3300045976 | Ga0466967_0004245 | Ga0466967_0004245_3186_3686 | 166 |
| 186 | 3300045976 | Ga0466967_0045251 | Ga0466967_0045251_3085_3588 | 166 |
| 187 | 3300045976 | Ga0466967_0062393 | Ga0466967_0062393_99_602 | 166 |
| 188 | 3300046684 | Ga0495669_0009485 | Ga0495669_0009485_2665_3168 | 166 |
| 189 | 3300048910 | Ga0496107_0184541 | Ga0496107_0184541_958_1461 | 166 |
| 190 | 3300048912 | Ga0496109_0079033 | Ga0496109_0079033_188_694 | 166 |
| 191 | 3300048912 | Ga0496109_0300083 | Ga0496109_0300083_514_1017 | 166 |
| 192 | 3300001979 | JGI24740J21852_10020525 | JGI24740J21852_100205251 | 167 |
| 193 | 3300001989 | JGI24739J22299_10016411 | JGI24739J22299_100164113 | 167 |
| 194 | 3300001990 | JGI24737J22298_10019419 | JGI24737J22298_100194191 | 167 |
| 195 | 3300002067 | JGI24735J21928_10001752 | JGI24735J21928_100017529 | 167 |
| 196 | 3300005329 | Ga0070683_100006972 | Ga0070683_1000069724 | 167 |
| 197 | 3300005337 | Ga0070682_100003586 | Ga0070682_10000358611 | 167 |
| 198 | 3300005344 | Ga0070661_100031892 | Ga0070661_1000318922 | 167 |
| 199 | 3300005344 | Ga0070661_100045413 | Ga0070661_1000454132 | 167 |
| 200 | 3300005345 | Ga0070692_10245537 | Ga0070692_102455372 | 167 |
| 201 | 3300005364 | Ga0070673_100239857 | Ga0070673_1002398571 | 167 |
| 202 | 3300005366 | Ga0070659_100066425 | Ga0070659_1000664252 | 167 |
| 203 | 3300005367 | Ga0070667_100053813 | Ga0070667_1000538131 | 167 |
| 204 | 3300005455 | Ga0070663_100117035 | Ga0070663_1001170354 | 167 |
| 205 | 3300005455 | Ga0070663_101176002 | Ga0070663_1011760021 | 167 |
| 206 | 3300005457 | Ga0070662_100064070 | Ga0070662_1000640702 | 167 |
| 207 | 3300005535 | Ga0070684_100541640 | Ga0070684_1005416402 | 167 |
| 208 | 3300005539 | Ga0068853_100663133 | Ga0068853_1006631332 | 167 |
| 209 | 3300005547 | Ga0070693_100104683 | Ga0070693_1001046832 | 167 |
| 210 | 3300005547 | Ga0070693_100164460 | Ga0070693_1001644602 | 167 |
| 211 | 3300005563 | Ga0068855_100295157 | Ga0068855_1002951572 | 167 |
| 212 | 3300005563 | Ga0068855_100380339 | Ga0068855_1003803392 | 167 |
| 213 | 3300005564 | Ga0070664_100007866 | Ga0070664_1000078663 | 167 |
| 214 | 3300005564 | Ga0070664_100045780 | Ga0070664_1000457806 | 167 |
| 215 | 3300005577 | Ga0068857_100010546 | Ga0068857_10001054610 | 167 |
| 216 | 3300005577 | Ga0068857_100320901 | Ga0068857_1003209012 | 167 |
| 217 | 3300005614 | Ga0068856_100528801 | Ga0068856_1005288012 | 167 |
| 218 | 3300005616 | Ga0068852_100268452 | Ga0068852_1002684522 | 167 |
| 219 | 3300005617 | Ga0068859_100018056 | Ga0068859_1000180563 | 167 |
| 220 | 3300005618 | Ga0068864_100003712 | Ga0068864_1000037124 | 167 |
| 221 | 3300005834 | Ga0068851_10036340 | Ga0068851_100363402 | 167 |
| 222 | 3300005841 | Ga0068863_100010570 | Ga0068863_1000105703 | 167 |
| 223 | 3300005843 | Ga0068860_101702947 | Ga0068860_1017029472 | 167 |
| 224 | 3300006028 | Ga0070717_10169365 | Ga0070717_101693652 | 167 |
| 225 | 3300006358 | Ga0068871_100089046 | Ga0068871_1000890462 | 167 |
| 226 | 3300006931 | Ga0097620_100018056 | Ga0097620_1000180563 | 167 |
| 227 | 3300009011 | Ga0105251_10148293 | Ga0105251_101482932 | 167 |
| 228 | 3300009174 | Ga0105241_10588356 | Ga0105241_105883562 | 167 |
| 229 | 3300009177 | Ga0105248_10041238 | Ga0105248_100412383 | 167 |
| 230 | 3300009545 | Ga0105237_10015355 | Ga0105237_100153553 | 167 |
| 231 | 3300013100 | Ga0157373_10058401 | Ga0157373_100584012 | 167 |
| 232 | 3300013105 | Ga0157369_10861682 | Ga0157369_108616822 | 167 |
| 233 | 3300013296 | Ga0157374_10298344 | Ga0157374_102983442 | 167 |
| 234 | 3300013307 | Ga0157372_10173744 | Ga0157372_101737442 | 167 |
| 235 | 3300013307 | Ga0157372_10408395 | Ga0157372_104083952 | 167 |
| 236 | 3300013308 | Ga0157375_11023624 | Ga0157375_110236242 | 167 |
| 237 | 3300014325 | Ga0163163_10359608 | Ga0163163_103596082 | 167 |
| 238 | 3300014497 | Ga0182008_10016398 | Ga0182008_100163983 | 167 |
| 239 | 3300014968 | Ga0157379_10014369 | Ga0157379_100143693 | 167 |
| 240 | 3300025735 | Ga0207713_1113951 | Ga0207713_11139512 | 167 |
| 241 | 3300025904 | Ga0207647_10191694 | Ga0207647_101916942 | 167 |
| 242 | 3300025909 | Ga0207705_10070763 | Ga0207705_100707633 | 167 |
| 243 | 3300025912 | Ga0207707_10022651 | Ga0207707_100226513 | 167 |
| 244 | 3300025914 | Ga0207671_10115269 | Ga0207671_101152692 | 167 |
| 245 | 3300025917 | Ga0207660_11289832 | Ga0207660_112898321 | 167 |
| 246 | 3300025920 | Ga0207649_10090108 | Ga0207649_100901082 | 167 |
| 247 | 3300025921 | Ga0207652_10172658 | Ga0207652_101726584 | 167 |
| 248 | 3300025928 | Ga0207700_10698105 | Ga0207700_106981051 | 167 |
| 249 | 3300025931 | Ga0207644_10031913 | Ga0207644_100319133 | 167 |
| 250 | 3300025932 | Ga0207690_10001891 | Ga0207690_100018915 | 167 |
| 251 | 3300025932 | Ga0207690_10049291 | Ga0207690_100492912 | 167 |
| 252 | 3300025933 | Ga0207706_10007955 | Ga0207706_1000795510 | 167 |
| 253 | 3300025944 | Ga0207661_10207778 | Ga0207661_102077782 | 167 |
| 254 | 3300025945 | Ga0207679_10039053 | Ga0207679_100390533 | 167 |
| 255 | 3300025960 | Ga0207651_10656275 | Ga0207651_106562752 | 167 |
| 256 | 3300025986 | Ga0207658_10021756 | Ga0207658_100217562 | 167 |
| 257 | 3300026035 | Ga0207703_10360285 | Ga0207703_103602852 | 167 |
| 258 | 3300026067 | Ga0207678_10005267 | Ga0207678_1000526712 | 167 |
| 259 | 3300026078 | Ga0207702_10041976 | Ga0207702_100419764 | 167 |
| 260 | 3300026088 | Ga0207641_10057056 | Ga0207641_100570562 | 167 |
| 261 | 3300026095 | Ga0207676_10049239 | Ga0207676_100492393 | 167 |
| 262 | 3300026116 | Ga0207674_10000626 | Ga0207674_100006268 | 167 |
| 263 | 3300026116 | Ga0207674_10005506 | Ga0207674_100055064 | 167 |
| 264 | 3300026142 | Ga0207698_10357321 | Ga0207698_103573212 | 167 |
| 265 | 3300028381 | Ga0268264_11384010 | Ga0268264_113840101 | 167 |
| 266 | 3300035121 | Ga0373960_0162200 | Ga0373960_0162200_237_743 | 167 |
| 267 | 3300037418 | Ga0395900_0057054 | Ga0395900_0057054_3396_3902 | 167 |
| 268 | 3300037418 | Ga0395900_0063706 | Ga0395900_0063706_2172_2678 | 167 |
| 269 | 3300037418 | Ga0395900_0092768 | Ga0395900_0092768_708_1214 | 167 |
| 270 | 3300037466 | Ga0395898_0048457 | Ga0395898_0048457_1487_1993 | 167 |
| 271 | 3300037466 | Ga0395898_1061319 | Ga0395898_1061319_183_698 | 167 |
| 272 | 3300037471 | Ga0395905_0000335 | Ga0395905_0000335_66055_66561 | 167 |
| 273 | 3300037471 | Ga0395905_0011073 | Ga0395905_0011073_402_908 | 167 |
| 274 | 3300037471 | Ga0395905_0036355 | Ga0395905_0036355_2240_2746 | 167 |
| 275 | 3300037471 | Ga0395905_0087575 | Ga0395905_0087575_983_1489 | 167 |
| 276 | 3300037471 | Ga0395905_0088899 | Ga0395905_0088899_1141_1647 | 167 |
| 277 | 3300037471 | Ga0395905_0103310 | Ga0395905_0103310_1837_2352 | 167 |
| 278 | 3300037471 | Ga0395905_0180523 | Ga0395905_0180523_117_632 | 167 |
| 279 | 3300038443 | Ga0395901_0015498 | Ga0395901_0015498_4441_4947 | 167 |
| 280 | 3300038443 | Ga0395901_0379735 | Ga0395901_0379735_518_1024 | 167 |
| 281 | 3300038443 | Ga0395901_0532290 | Ga0395901_0532290_117_632 | 167 |
| 282 | 3300042157 | Ga0439458_0005460 | Ga0439458_0005460_1900_2406 | 167 |
| 283 | 3300044901 | Ga0466960_0132926 | Ga0466960_0132926_335_850 | 167 |
| 284 | 3300048905 | Ga0496102_0318008 | Ga0496102_0318008_779_1285 | 167 |
| 285 | 3300048908 | Ga0496105_0233455 | Ga0496105_0233455_921_1427 | 167 |
| 286 | 3300048909 | Ga0496106_0069677 | Ga0496106_0069677_164_670 | 167 |
| 287 | 3300048910 | Ga0496107_0028924 | Ga0496107_0028924_746_1252 | 167 |
| 288 | 3300048911 | Ga0496108_0002034 | Ga0496108_0002034_12944_13450 | 167 |
| 289 | 3300048912 | Ga0496109_0001634 | Ga0496109_0001634_5087_5593 | 167 |
| 290 | 3300048913 | Ga0496110_0027147 | Ga0496110_0027147_2914_3420 | 167 |
| 291 | 3300048914 | Ga0496111_0186280 | Ga0496111_0186280_66_572 | 167 |
| 292 | 3300048915 | Ga0496112_0128345 | Ga0496112_0128345_860_1366 | 167 |
| 293 | 3300048916 | Ga0496113_0025827 | Ga0496113_0025827_2699_3205 | 167 |
| 294 | 3300050512 | nmdc:mga0n895_1010560_c1 | nmdc:mga0n895_1010560_c1_201_704 | 167 |
| 295 | 3300005339 | Ga0070660_100000061 | Ga0070660_10000006169 | 168 |
| 296 | 3300005345 | Ga0070692_10552003 | Ga0070692_105520031 | 168 |
| 297 | 3300005563 | Ga0068855_100000318 | Ga0068855_10000031813 | 168 |
| 298 | 3300013102 | Ga0157371_10000616 | Ga0157371_1000061622 | 168 |
| 299 | 3300013104 | Ga0157370_10102121 | Ga0157370_101021212 | 168 |
| 300 | 3300025909 | Ga0207705_10000131 | Ga0207705_100001312 | 168 |
| 301 | 3300025919 | Ga0207657_10000181 | Ga0207657_100001816 | 168 |
| 302 | 3300025949 | Ga0207667_10000282 | Ga0207667_1000028237 | 168 |
| 303 | 3300048917 | Ga0496114_0000019 | Ga0496114_0000019_120800_121315 | 169 |
| 304 | 3300037418 | Ga0395900_0040973 | Ga0395900_0040973_3043_3561 | 170 |
| 305 | 3300037471 | Ga0395905_0116108 | Ga0395905_0116108_623_1141 | 170 |
| 306 | 3300001915 | JGI24741J21665_1049709 | JGI24741J21665_10497091 | 171 |
| 307 | 3300001979 | JGI24740J21852_10012975 | JGI24740J21852_100129751 | 171 |
| 308 | 3300005329 | Ga0070683_100012444 | Ga0070683_1000124447 | 171 |
| 309 | 3300005336 | Ga0070680_100002188 | Ga0070680_10000218816 | 171 |
| 310 | 3300005336 | Ga0070680_100022410 | Ga0070680_1000224102 | 171 |
| 311 | 3300005336 | Ga0070680_100396967 | Ga0070680_1003969672 | 171 |
| 312 | 3300005344 | Ga0070661_100425212 | Ga0070661_1004252122 | 171 |
| 313 | 3300005344 | Ga0070661_100558634 | Ga0070661_1005586341 | 171 |
| 314 | 3300005345 | Ga0070692_10022598 | Ga0070692_100225982 | 171 |
| 315 | 3300005455 | Ga0070663_100144413 | Ga0070663_1001444132 | 171 |
| 316 | 3300005457 | Ga0070662_101020460 | Ga0070662_1010204601 | 171 |
| 317 | 3300005535 | Ga0070684_100113622 | Ga0070684_1001136222 | 171 |
| 318 | 3300005539 | Ga0068853_100015024 | Ga0068853_1000150248 | 171 |
| 319 | 3300005563 | Ga0068855_100028110 | Ga0068855_1000281102 | 171 |
| 320 | 3300005564 | Ga0070664_100026936 | Ga0070664_1000269362 | 171 |
| 321 | 3300005578 | Ga0068854_101671811 | Ga0068854_1016718111 | 171 |
| 322 | 3300005614 | Ga0068856_100260535 | Ga0068856_1002605352 | 171 |
| 323 | 3300005614 | Ga0068856_100565173 | Ga0068856_1005651732 | 171 |
| 324 | 3300005616 | Ga0068852_100019681 | Ga0068852_1000196816 | 171 |
| 325 | 3300005616 | Ga0068852_102203542 | Ga0068852_1022035421 | 171 |
| 326 | 3300005834 | Ga0068851_10020242 | Ga0068851_100202424 | 171 |
| 327 | 3300009093 | Ga0105240_10191852 | Ga0105240_101918522 | 171 |
| 328 | 3300009551 | Ga0105238_10017853 | Ga0105238_100178532 | 171 |
| 329 | 3300013102 | Ga0157371_10122192 | Ga0157371_101221922 | 171 |
| 330 | 3300013102 | Ga0157371_10570643 | Ga0157371_105706432 | 171 |
| 331 | 3300013104 | Ga0157370_10165632 | Ga0157370_101656322 | 171 |
| 332 | 3300013105 | Ga0157369_10136161 | Ga0157369_101361612 | 171 |
| 333 | 3300013307 | Ga0157372_10099009 | Ga0157372_100990091 | 171 |
| 334 | 3300020082 | Ga0206353_10998620 | Ga0206353_109986202 | 171 |
| 335 | 3300025321 | Ga0207656_10130383 | Ga0207656_101303832 | 171 |
| 336 | 3300025904 | Ga0207647_10000721 | Ga0207647_1000072124 | 171 |
| 337 | 3300025909 | Ga0207705_10039446 | Ga0207705_100394463 | 171 |
| 338 | 3300025909 | Ga0207705_10195090 | Ga0207705_101950902 | 171 |
| 339 | 3300025913 | Ga0207695_10077027 | Ga0207695_100770275 | 171 |
| 340 | 3300025917 | Ga0207660_10001191 | Ga0207660_1000119115 | 171 |
| 341 | 3300025917 | Ga0207660_10277888 | Ga0207660_102778881 | 171 |
| 342 | 3300025919 | Ga0207657_10009578 | Ga0207657_100095788 | 171 |
| 343 | 3300025920 | Ga0207649_10188315 | Ga0207649_101883152 | 171 |
| 344 | 3300025921 | Ga0207652_11124353 | Ga0207652_111243531 | 171 |
| 345 | 3300025924 | Ga0207694_10060948 | Ga0207694_100609481 | 171 |
| 346 | 3300025932 | Ga0207690_10023425 | Ga0207690_100234253 | 171 |
| 347 | 3300025933 | Ga0207706_10474525 | Ga0207706_104745252 | 171 |
| 348 | 3300025944 | Ga0207661_10048583 | Ga0207661_100485833 | 171 |
| 349 | 3300025945 | Ga0207679_10022960 | Ga0207679_100229606 | 171 |
| 350 | 3300025949 | Ga0207667_10036759 | Ga0207667_100367592 | 171 |
| 351 | 3300025949 | Ga0207667_10070119 | Ga0207667_100701195 | 171 |
| 352 | 3300025981 | Ga0207640_10042763 | Ga0207640_100427632 | 171 |
| 353 | 3300026041 | Ga0207639_10030651 | Ga0207639_100306512 | 171 |
| 354 | 3300026067 | Ga0207678_10023348 | Ga0207678_100233487 | 171 |
| 355 | 3300026067 | Ga0207678_10094285 | Ga0207678_100942854 | 171 |
| 356 | 3300026078 | Ga0207702_10041084 | Ga0207702_100410842 | 171 |
| 357 | 3300026078 | Ga0207702_10240945 | Ga0207702_102409452 | 171 |
| 358 | 3300026116 | Ga0207674_10001662 | Ga0207674_1000166211 | 171 |
| 359 | 3300026116 | Ga0207674_10003404 | Ga0207674_100034042 | 171 |
| 360 | 3300026142 | Ga0207698_10005264 | Ga0207698_100052648 | 171 |
| 361 | 3300026142 | Ga0207698_10016128 | Ga0207698_100161282 | 171 |
| 362 | 3300037312 | Ga0395899_0045303 | Ga0395899_0045303_1458_1973 | 171 |
| 363 | 3300037418 | Ga0395900_0010635 | Ga0395900_0010635_8186_8701 | 171 |
| 364 | 3300037418 | Ga0395900_0019372 | Ga0395900_0019372_3642_4157 | 171 |
| 365 | 3300037418 | Ga0395900_0276042 | Ga0395900_0276042_977_1495 | 171 |
| 366 | 3300037418 | Ga0395900_0344282 | Ga0395900_0344282_45_560 | 171 |
| 367 | 3300037466 | Ga0395898_0061014 | Ga0395898_0061014_101_616 | 171 |
| 368 | 3300037466 | Ga0395898_0130959 | Ga0395898_0130959_600_1115 | 171 |
| 369 | 3300037471 | Ga0395905_0086334 | Ga0395905_0086334_1132_1647 | 171 |
| 370 | 3300037471 | Ga0395905_0258782 | Ga0395905_0258782_183_701 | 171 |
| 371 | 3300038443 | Ga0395901_0008018 | Ga0395901_0008018_296_811 | 171 |
| 372 | 3300038443 | Ga0395901_0424441 | Ga0395901_0424441_225_743 | 171 |
| 373 | 3300038443 | Ga0395901_1414523 | Ga0395901_1414523_96_611 | 171 |
| 374 | 3300044684 | Ga0466966_0305884 | Ga0466966_0305884_82_600 | 171 |
| 375 | 3300044693 | Ga0466961_0033672 | Ga0466961_0033672_332_850 | 171 |
| 376 | 3300044694 | Ga0466963_0226996 | Ga0466963_0226996_520_1038 | 171 |
| 377 | 3300044719 | Ga0466971_0087765 | Ga0466971_0087765_675_1193 | 171 |
| 378 | 3300044719 | Ga0466971_0187224 | Ga0466971_0187224_380_898 | 171 |
| 379 | 3300045049 | Ga0466959_0543988 | Ga0466959_0543988_146_664 | 171 |
| 380 | 3300045836 | Ga0466958_0193411 | Ga0466958_0193411_383_901 | 171 |
| 381 | 3300045836 | Ga0466958_0284791 | Ga0466958_0284791_261_779 | 171 |
| 382 | 3300045976 | Ga0466967_0581106 | Ga0466967_0581106_451_969 | 171 |
| 383 | 3300061719 | Ga0466962_0048814 | Ga0466962_0048814_804_1322 | 171 |
| 384 | 3300061719 | Ga0466962_0079509 | Ga0466962_0079509_368_886 | 171 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6trc-assembly1.cif.gz_L | cryo- em structure of the thermosynechococcus elongatus photosystem i in the presence of cytochrome c6 | 0.6893 | 109 | 170 |
| 7m76-assembly1.cif.gz_L | room temperature xfel crystallography reveals asymmetry in the vicinity of the two phylloquinones in photosystem i | 0.6245 | 71 | 170 |
| 7f4v-assembly1.cif.gz_cL | cryo-em structure of a primordial cyanobacterial photosystem i | 0.6169 | 71 | 171 |
| 7y5e-assembly1.cif.gz_LN | in situ single-pbs-psii-psi-lhcs megacomplex. | 0.5775 | 71 | 166 |
| 8bvs-assembly1.cif.gz_A | cryo-em structure of rat slc22a6 bound to tenofovir | 0.5694 | 71 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FYT5_1_136_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.7062 | 23 | 167 | 1.20.1250.20 |
| af_Q2FYT5_1_136_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.6878 | 23 | 167 | 1.20.1250.20 |
| af_B7F9N5_61_203_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.607 | 90 | 132 | 1.10.10.10 |
| af_I1MMI0_226_612_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5886 | 71 | 157 | 1.20.1250.20 |
| af_Q2G226_196_445_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5746 | 68 | 164 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5B8F3-F1-model_v4 | deleted | 0.8761 | 9 | 171 |
|
| AF-A0A7X1F5Y7-F1-model_v4 | DUF1453 family protein | 0.8709 | 8 | 168 |
GO:0016020
|
| AF-A0A5C0WGQ2-F1-model_v4 | DUF1453 domain-containing protein | 0.8653 | 19 | 170 |
GO:0016020
|
| AF-A0A838L5Q8-F1-model_v4 | DUF1453 family protein | 0.8639 | 1 | 170 |
GO:0016020
|
| AF-A0A2V5B8F3-F1-model_v4 | deleted | 0.8608 | 9 | 171 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar