F429758

General Info

Members Datasets Scaffolds Average Seq Length
383 298 168 253

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2841864319|2841870175
Length 279
Sequence GRSTGFKREEFTMPYRCSTSNRLLAGLAAVALMAGTAVPADAGTATGAATEWTQVLNNGELVALVGKSGEQIQNQLTQISQLAQQIETQLNIYQNLLQNTATLPSHMWGQVESDLNQLRSIVDQGQSISFSMGNADDVLQQRFQSYSSLKTNLPSSESFSSSYQTWSDTNRDTIASTLKAASLTAEQFDTEEGTMSSLRSMSETADGQMKALQVGHEIAAQQVAQMQKLRGLVSQQMTMMGTWLQTEQTDKDLAQARREKFFSGTAPSTSGGEKMKVEW

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
4 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
5 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
6 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
9 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
12 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
15 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
16 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
17 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
18 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
19 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
20 2516143018 Ensifer sp. BR816 Isolate Nodule
21 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
22 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
23 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
24 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
25 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
26 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
27 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
28 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
29 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
30 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
31 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
32 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
33 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
34 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
35 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
36 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
37 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
38 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
39 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
40 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
41 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
42 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
43 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
44 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
45 2643221558 Rhizobium sp. Root149 Isolate Unclassified
46 2643221568 Rhizobium sp. Root564 Isolate Unclassified
47 2643221582 Rhizobium sp. Root651 Isolate Unclassified
48 2643221626 Ensifer sp. Root31 Isolate Unclassified
49 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
50 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
51 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
52 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
53 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
54 2643221718 Rhizobium sp. Root268 Isolate Unclassified
55 2643221719 Rhizobium sp. Root274 Isolate Unclassified
56 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
57 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
58 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
59 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
60 2738541293 Rhizobium sp. GV031 Isolate Unclassified
61 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
62 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
63 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
64 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
65 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
66 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
67 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
68 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
69 2791355256 Rhizobium sp. M10 Isolate Nodule
70 2791355263 Rhizobium chutanense C5 Isolate Nodule
71 2791355266 Rhizobium sp. L43 Isolate Nodule
72 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
73 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
74 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
75 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
76 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
77 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
78 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
79 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
80 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
81 2802429633 Rhizobium anhuiense J3 Isolate Nodule
82 2802429634 Rhizobium anhuiense S10 Isolate Nodule
83 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
84 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
85 2802429637 Rhizobium anhuiense C15 Isolate Nodule
86 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
87 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
88 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
89 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
90 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
91 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
92 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
93 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
94 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
95 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
96 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
97 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
98 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
99 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
100 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
101 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
102 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
103 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
104 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
105 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
106 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
107 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
108 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
109 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
110 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
111 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
112 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
113 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
114 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
115 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
116 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
117 2854911287 Brucella lupini LUP21 Isolate Unclassified
118 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
119 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
120 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
121 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
122 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
123 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
124 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
125 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
126 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
127 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
128 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
129 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
130 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
131 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
132 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
133 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
134 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
135 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
136 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
137 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
138 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
139 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
140 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
141 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
142 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
143 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
144 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
145 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
146 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
147 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
148 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
149 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
150 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
151 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
152 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
153 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
154 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
155 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
156 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
157 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
158 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
159 2996887358 Rhizobium sp. R711 Isolate Nodule
160 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
161 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
162 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
163 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
164 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
165 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
166 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
167 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
168 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
169 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
170 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
171 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
172 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
173 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
174 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
175 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
176 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
177 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
178 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
179 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
180 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
181 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
182 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
183 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
184 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
185 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
186 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
187 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
188 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
189 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
190 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
193 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
196 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
198 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
205 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
206 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
207 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
208 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
209 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
210 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
211 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
214 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
222 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
244 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
245 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
246 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
247 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
248 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
254 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
255 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
261 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
262 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
263 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
264 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
265 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
266 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
267 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
268 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
269 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
270 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
271 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
272 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
273 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
274 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
275 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
276 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
279 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
280 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
281 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
282 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
283 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
284 8005321885 Rhizobium sp. R72 Isolate Nodule
285 8005395548 Rhizobium sp. R339 Isolate Nodule
286 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
287 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
288 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
289 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
290 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
291 8018176218 Rhizobium sp. N122 Isolate Nodule
292 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
293 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
294 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
295 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
296 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
297 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
298 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.86
Metatranscriptomes 0
Isolates 56.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.23
Nodule 43.86
Rhizoplane 0.26
Rhizosphere 19.06
Stem 0
Stem Tuber 0
Unclassified 19.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000766 3300002739 Bacteria 6150
2 JGI25150J39212_1000058 3300002774 Bacteria 66130
3 JGI25150J39212_1011267 3300002774 Bacteria 1628
4 JGI25159J45721_1000109 3300002987 Bacteria 38930
5 JGI25159J45721_1001093 3300002987 Bacteria 11574
6 JGI25151J46595_10000241 3300003187 Bacteria 64064
7 rootH1_10002814 3300003316 Bacteria 40375
8 rootH1_10002814 3300003323 Bacteria 12796
9 rootH2_10029723 3300003320 Bacteria 13503
10 rootL2_10010387 3300003322 Bacteria 55016
11 rootH1_10025473 3300003323 Bacteria 4607
12 rootH1_10215341 3300003323 Bacteria 6018
13 JGI25160J50197_1000103 3300003354 Bacteria 80968
14 JGI25160J50197_1003054 3300003354 Bacteria 7633
15 JGI25161J50226_1000090 3300003374 Bacteria 73647
16 JGI25161J50226_1000106 3300003374 Bacteria 65625
17 Ga0055524_1002811 3300003775 Bacteria 8740
18 Ga0055524_1043969 3300003775 Bacteria 1091
19 Ga0055528_1003238 3300003790 Bacteria 8305
20 Ga0055540_1000113 3300003792 Bacteria 86603
21 Ga0058692_1000019 3300003856 Bacteria 255580
22 Ga0055543_1000087 3300004625 Bacteria 81157
23 Ga0055543_1000169 3300004625 Bacteria 54844
24 Ga0065165_1000900 3300005262 Bacteria 38368
25 Ga0065165_1004719 3300005262 Bacteria 8183
26 Ga0070665_100114371 3300005548 Bacteria 2701
27 Ga0075363_100137033 3300006048 Bacteria 1376
28 Ga0075364_10070942 3300006051 Bacteria 2294
29 Ga0075367_10006329 3300006178 Bacteria 5971
30 Ga0123341_1008486 3300009765 Bacteria 9387
31 Ga0123341_1008780 3300009765 Bacteria 9231
32 Ga0123341_1018325 3300009765 Bacteria 6079
33 Ga0123342_1007895 3300009766 Bacteria 13782
34 Ga0123342_1008640 3300009766 Bacteria 12672
35 Ga0123342_1015871 3300009766 Bacteria 6710
36 Ga0182008_10181268 3300014497 Bacteria 1066
37 Ga0214544_1000584 3300021320 Bacteria 68638
38 Ga0214543_1003317 3300021327 Bacteria 31302
39 Ga0214543_1015702 3300021327 Bacteria 8254
40 Ga0228710_1011825 3300022740 Bacteria 11087
41 Ga0209436_100001 3300025208 Bacteria 304543
42 Ga0207425_1000083 3300025245 Bacteria 96984
43 Ga0207425_1000808 3300025245 Bacteria 15733
44 Ga0209129_1000098 3300025258 Bacteria 163406
45 Ga0209129_1011551 3300025258 Bacteria 2099
46 Ga0209565_1031997 3300025263 Bacteria 1019
47 Ga0209673_1000845 3300025273 Bacteria 39932
48 Ga0209130_1000049 3300025284 Bacteria 226841
49 Ga0209130_1000098 3300025284 Bacteria 142506
50 Ga0209025_1000142 3300025294 Bacteria 183903
51 Ga0209564_1000354 3300025295 Bacteria 85718
52 Ga0209758_1000300 3300025297 Bacteria 97000
53 Ga0209758_1003216 3300025297 Bacteria 15213
54 Ga0209758_1008866 3300025297 Bacteria 6394
55 Ga0209758_1014459 3300025297 Bacteria 4195
56 Ga0209758_1027231 3300025297 Bacteria 2448
57 Ga0209256_1023094 3300025299 Bacteria 1864
58 Ga0209256_1029354 3300025299 Bacteria 1534
59 Ga0207426_1000043 3300025302 Bacteria 432827
60 Ga0207426_1000069 3300025302 Bacteria 334513
61 Ga0207426_1000283 3300025302 Bacteria 103487
62 Ga0209051_1000287 3300025303 Bacteria 80935
63 Ga0209257_1008940 3300025304 Bacteria 5511
64 Ga0209371_1000107 3300027312 Bacteria 141889
65 Ga0268266_10048274 3300028379 Bacteria 3649
66 Ga0268266_10142723 3300028379 Bacteria 2150
67 Ga0268256_1000093 3300030500 Bacteria 141889
68 Ga0395905_0004538 3300037471 Bacteria 14378
69 Ga0451833_0152513 3300041491 Bacteria 14791
70 Ga0451835_0471770 3300041492 Bacteria 8979
71 Ga0451839_0363184 3300041496 Bacteria 11590
72 Ga0451841_0555957 3300041498 Bacteria 30671
73 Ga0451845_0312366 3300041501 Bacteria 3937
74 Ga0451849_0565515 3300041505 Bacteria 6553
75 Ga0451851_0193482 3300041507 Bacteria 26742
76 Ga0451843_1389179 3300041509 Bacteria 16178
77 Ga0451853_0193996 3300041512 Bacteria 20097
78 Ga0495617_017166 3300046452 Bacteria 2443
79 Ga0495627_008644 3300046453 Bacteria 3799
80 Ga0495638_0000077 3300046460 Bacteria 158724
81 Ga0495638_0000181 3300046460 Bacteria 96473
82 Ga0495585_0021531 3300046492 Bacteria 3701
83 Ga0495583_0013284 3300046506 Bacteria 4601
84 Ga0495610_0026075 3300046512 Bacteria 3125
85 Ga0495610_0067422 3300046512 Bacteria 1681
86 Ga0495616_0024044 3300046513 Bacteria 3273
87 Ga0495616_0187727 3300046513 Bacteria 915
88 Ga0495620_0000107 3300046515 Bacteria 66810
89 Ga0495632_0000423 3300046519 Bacteria 40113
90 Ga0495637_0004274 3300046520 Bacteria 7418
91 Ga0495643_0003673 3300046522 Bacteria 11135
92 Ga0495643_0121772 3300046522 Bacteria 1317
93 Ga0495648_0120692 3300046524 Bacteria 1409
94 Ga0495663_0003852 3300046525 Bacteria 4277
95 Ga0495663_0009772 3300046525 Bacteria 2662
96 Ga0495654_0004327 3300046530 Bacteria 8462
97 Ga0495609_0014495 3300046538 Bacteria 3703
98 Ga0495622_0068553 3300046557 Bacteria 1638
99 Ga0495611_0000364 3300046648 Bacteria 29296
100 Ga0495625_0028159 3300046660 Bacteria 4217
101 Ga0495625_0161271 3300046660 Bacteria 1502
102 Ga0495661_0040836 3300046665 Bacteria 2874
103 Ga0495661_0049400 3300046665 Bacteria 2551
104 Ga0495588_0091270 3300046674 Bacteria 1596
105 Ga0495613_0004078 3300046689 Bacteria 10920
106 Ga0495670_0000149 3300046691 Bacteria 30870
107 Ga0495671_0001235 3300046692 Bacteria 17511
108 Ga0495649_0039528 3300046694 Bacteria 2586
109 Ga0495660_0080913 3300046810 Bacteria 1704
110 Ga0495687_000105 3300047443 Bacteria 128239
111 Ga0495679_048198 3300047446 Bacteria 1289
112 Ga0495681_0000657 3300047470 Bacteria 26280
113 Ga0495681_0057836 3300047470 Bacteria 1799
114 Ga0495686_0000500 3300047472 Bacteria 57459
115 Ga0495686_0159413 3300047472 Bacteria 1319
116 Ga0496116_0001726 3300048919 Bacteria 23861
117 Ga0496116_0089808 3300048919 Bacteria 1873
118 Ga0496117_0002417 3300048920 Bacteria 23697
119 Ga0496118_0080657 3300048921 Bacteria 2289
120 Ga0496119_0000569 3300048922 Bacteria 49819
121 Ga0496119_0069751 3300048922 Bacteria 2065
122 Ga0496120_0027180 3300048923 Bacteria 3524
123 Ga0496121_0000115 3300048924 Bacteria 178411
124 Ga0496121_0027857 3300048924 Bacteria 5277
125 Ga0496121_0061435 3300048924 Bacteria 3083
126 Ga0496121_0068952 3300048924 Bacteria 2857
127 Ga0496122_0037955 3300048925 Bacteria 3867
128 Ga0496123_0002390 3300048926 Bacteria 23485
129 Ga0496123_0049818 3300048926 Bacteria 2804
130 Ga0496123_0140316 3300048926 Bacteria 1322
131 Ga0496124_0104332 3300048927 Bacteria 2292
132 Ga0496125_0000182 3300048928 Bacteria 137747
133 Ga0496125_0015573 3300048928 Bacteria 7343
134 Ga0496125_0134597 3300048928 Bacteria 1731
135 Ga0496125_0227215 3300048928 Bacteria 1197
136 Ga0496126_0000471 3300048929 Bacteria 80080
137 Ga0496126_0069235 3300048929 Bacteria 3148
138 Ga0495678_000295 3300049459 Bacteria 54788
139 Ga0495682_0003871 3300049460 Bacteria 6550
140 Ga0501033_0000630 3300049570 Bacteria 32555
141 Ga0501036_0028684 3300049572 Bacteria 4704
142 Ga0501038_0006644 3300049574 Bacteria 10695
143 Ga0501035_0000231 3300049822 Bacteria 66354
144 Ga0501035_0000730 3300049822 Bacteria 35664
145 Ga0501035_0247257 3300049822 Bacteria 1516
146 Ga0501044_0001034 3300049823 Bacteria 33520
147 Ga0500610_0062327 3300053079 Bacteria 1946
148 Ga0500583_0001023 3300053092 Bacteria 7980
149 Ga0500555_002431 3300053103 Bacteria 5399
150 Ga0500560_079762 3300053107 Bacteria 1086
151 Ga0500597_103961 3300053120 Bacteria 1234
152 Ga0500608_000646 3300053122 Bacteria 12801
153 Ga0500618_000097 3300053125 Bacteria 71932
154 Ga0500618_000242 3300053125 Bacteria 43374
155 Ga0500618_000952 3300053125 Bacteria 14814
156 Ga0500618_036446 3300053125 Bacteria 1139
157 Ga0500652_117080 3300053131 Bacteria 1113
158 Ga0500561_0002629 3300053137 Bacteria 3042
159 Ga0500564_001819 3300053138 Bacteria 7570
160 Ga0500573_0003603 3300053140 Bacteria 8036
161 Ga0500574_000032 3300053141 Bacteria 18144
162 Ga0500619_002958 3300053154 Bacteria 3385
163 Ga0500622_0000278 3300053156 Bacteria 52272
164 Ga0500624_000353 3300053157 Bacteria 14950
165 Ga0500634_0097539 3300053161 Bacteria 1478
166 Ga0500638_000138 3300053162 Bacteria 13919
167 Ga0500636_0000121 3300053177 Bacteria 40628
168 Ga0500636_0030622 3300053177 Bacteria 3183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0000231 Ga0501035_0000231_21624_22427 203
2 3300021327 Ga0214543_1015702 Ga0214543_10157022 206
3 3300006178 Ga0075367_10006329 Ga0075367_100063293 207
4 3300053125 Ga0500618_000242 Ga0500618_000242_28830_29543 207
5 3300021320 Ga0214544_1000584 Ga0214544_100058411 209
6 3300021327 Ga0214543_1003317 Ga0214543_100331710 209
7 3300003856 Ga0058692_1000019 Ga0058692_1000019236 212
8 3300003856 Ga0058692_1000019 Ga0058692_100001999 212
9 3300027312 Ga0209371_1000107 Ga0209371_100010730 212
10 3300030500 Ga0268256_1000093 Ga0268256_100009330 212
11 3300046512 Ga0495610_0067422 Ga0495610_0067422_561_1355 212
12 3300046522 Ga0495643_0003673 Ga0495643_0003673_9253_10047 212
13 3300048927 Ga0496124_0104332 Ga0496124_0104332_597_1391 212
14 3300003316 rootH1_10002814 rootH1_1000281428 213
15 3300003320 rootH2_10029723 rootH2_100297237 213
16 3300003322 rootL2_10010387 rootL2_1001038739 213
17 3300003323 rootH1_10215341 rootH1_102153412 213
18 3300048924 Ga0496121_0068952 Ga0496121_0068952_1635_2402 213
19 iso_pu_bacteria 2924165586 2924171041 213
20 3300048929 Ga0496126_0000471 Ga0496126_0000471_41523_42272 216
21 3300003775 Ga0055524_1043969 Ga0055524_10439692 217
22 3300025273 Ga0209673_1000845 Ga0209673_100084517 217
23 3300025299 Ga0209256_1023094 Ga0209256_10230942 217
24 3300025302 Ga0207426_1000283 Ga0207426_100028389 217
25 3300048924 Ga0496121_0000115 Ga0496121_0000115_56460_57263 217
26 3300053177 Ga0500636_0000121 Ga0500636_0000121_35461_36237 218
27 iso_pu_bacteria 2838686498 2838691060 219
28 iso_pu_bacteria 2841851746 2841856376 219
29 iso_pu_bacteria 2842077413 2842083227 219
30 iso_pu_bacteria 2842110456 2842117298 219
31 iso_pu_bacteria 2842271015 2842275535 219
32 iso_pu_bacteria 2844454524 2844461925 219
33 iso_pu_bacteria 2844454524 2844462251 219
34 3300022740 Ga0228710_1011825 Ga0228710_101182512 220
35 3300002774 JGI25150J39212_1000058 JGI25150J39212_100005817 221
36 3300003187 JGI25151J46595_10000241 JGI25151J46595_1000024151 221
37 3300009765 Ga0123341_1008780 Ga0123341_100878010 221
38 3300009766 Ga0123342_1007895 Ga0123342_10078956 221
39 3300009766 Ga0123342_1015871 Ga0123342_10158713 221
40 3300025245 Ga0207425_1000083 Ga0207425_100008352 221
41 3300025258 Ga0209129_1000098 Ga0209129_1000098129 221
42 3300025294 Ga0209025_1000142 Ga0209025_1000142110 221
43 3300025297 Ga0209758_1000300 Ga0209758_100030052 221
44 3300025299 Ga0209256_1029354 Ga0209256_10293542 221
45 3300048928 Ga0496125_0134597 Ga0496125_0134597_158_967 221
46 3300049570 Ga0501033_0000630 Ga0501033_0000630_22799_23587 221
47 3300049572 Ga0501036_0028684 Ga0501036_0028684_2506_3294 221
48 3300049574 Ga0501038_0006644 Ga0501038_0006644_5859_6647 221
49 3300049822 Ga0501035_0000730 Ga0501035_0000730_5875_6663 221
50 3300049822 Ga0501035_0247257 Ga0501035_0247257_143_934 221
51 3300049823 Ga0501044_0001034 Ga0501044_0001034_5793_6581 221
52 iso_pu_bacteria 2513237159 2514002647 221
53 iso_pu_bacteria 2842285085 2842290221 222
54 iso_pu_bacteria 2842402390 2842407955 222
55 iso_pu_bacteria 2842409023 2842414633 222
56 iso_pu_bacteria 2842415677 2842421022 222
57 3300009765 Ga0123341_1008486 Ga0123341_100848611 223
58 3300009765 Ga0123341_1018325 Ga0123341_10183255 223
59 3300009766 Ga0123342_1008640 Ga0123342_100864012 223
60 3300014497 Ga0182008_10181268 Ga0182008_101812682 223
61 3300048922 Ga0496119_0000569 Ga0496119_0000569_4571_5380 223
62 3300048922 Ga0496119_0069751 Ga0496119_0069751_516_1274 223
63 3300048923 Ga0496120_0027180 Ga0496120_0027180_1310_2068 223
64 3300048926 Ga0496123_0140316 Ga0496123_0140316_186_995 223
65 3300048929 Ga0496126_0069235 Ga0496126_0069235_1138_1896 223
66 3300006051 Ga0075364_10070942 Ga0075364_100709422 224
67 3300025297 Ga0209758_1003216 Ga0209758_10032167 224
68 3300041491 Ga0451833_0152513 Ga0451833_0152513_10445_11254 224
69 3300041492 Ga0451835_0471770 Ga0451835_0471770_4669_5478 224
70 3300041496 Ga0451839_0363184 Ga0451839_0363184_8345_9154 224
71 3300041498 Ga0451841_0555957 Ga0451841_0555957_19389_20198 224
72 3300041501 Ga0451845_0312366 Ga0451845_0312366_52_861 224
73 3300041505 Ga0451849_0565515 Ga0451849_0565515_4673_5482 224
74 3300041507 Ga0451851_0193482 Ga0451851_0193482_22489_23298 224
75 3300041509 Ga0451843_1389179 Ga0451843_1389179_4405_5214 224
76 3300041512 Ga0451853_0193996 Ga0451853_0193996_10379_11188 224
77 3300046452 Ga0495617_017166 Ga0495617_017166_1346_2146 224
78 3300046460 Ga0495638_0000181 Ga0495638_0000181_37973_38773 224
79 3300046492 Ga0495585_0021531 Ga0495585_0021531_580_1380 224
80 3300046515 Ga0495620_0000107 Ga0495620_0000107_40426_41226 224
81 3300046522 Ga0495643_0121772 Ga0495643_0121772_499_1299 224
82 3300046524 Ga0495648_0120692 Ga0495648_0120692_185_985 224
83 3300046525 Ga0495663_0003852 Ga0495663_0003852_67_867 224
84 3300046557 Ga0495622_0068553 Ga0495622_0068553_419_1219 224
85 3300046648 Ga0495611_0000364 Ga0495611_0000364_1049_1849 224
86 3300046660 Ga0495625_0028159 Ga0495625_0028159_1117_1917 224
87 3300046665 Ga0495661_0040836 Ga0495661_0040836_1026_1826 224
88 3300046689 Ga0495613_0004078 Ga0495613_0004078_8617_9417 224
89 3300046691 Ga0495670_0000149 Ga0495670_0000149_24973_25773 224
90 3300046692 Ga0495671_0001235 Ga0495671_0001235_15135_15935 224
91 3300046694 Ga0495649_0039528 Ga0495649_0039528_1049_1849 224
92 3300047443 Ga0495687_000105 Ga0495687_000105_86997_87797 224
93 3300047470 Ga0495681_0000657 Ga0495681_0000657_18443_19243 224
94 3300047472 Ga0495686_0000500 Ga0495686_0000500_40424_41224 224
95 3300048919 Ga0496116_0089808 Ga0496116_0089808_478_1287 224
96 3300049459 Ga0495678_000295 Ga0495678_000295_17181_17981 224
97 3300049460 Ga0495682_0003871 Ga0495682_0003871_4746_5546 224
98 3300053092 Ga0500583_0001023 Ga0500583_0001023_3384_4184 224
99 3300053103 Ga0500555_002431 Ga0500555_002431_1278_2078 224
100 3300053120 Ga0500597_103961 Ga0500597_103961_404_1204 224
101 3300053122 Ga0500608_000646 Ga0500608_000646_5659_6459 224
102 3300053125 Ga0500618_036446 Ga0500618_036446_282_1082 224
103 3300053131 Ga0500652_117080 Ga0500652_117080_282_1082 224
104 3300053138 Ga0500564_001819 Ga0500564_001819_4660_5460 224
105 3300053141 Ga0500574_000032 Ga0500574_000032_2732_3532 224
106 3300053154 Ga0500619_002958 Ga0500619_002958_181_981 224
107 3300053157 Ga0500624_000353 Ga0500624_000353_11673_12473 224
108 3300053161 Ga0500634_0097539 Ga0500634_0097539_328_1128 224
109 3300053162 Ga0500638_000138 Ga0500638_000138_7201_8001 224
110 3300003323 rootH1_10025473 rootH1_100254734 225
111 3300046453 Ga0495627_008644 Ga0495627_008644_2691_3491 226
112 3300046506 Ga0495583_0013284 Ga0495583_0013284_1543_2343 226
113 3300046512 Ga0495610_0026075 Ga0495610_0026075_276_1076 226
114 3300046513 Ga0495616_0024044 Ga0495616_0024044_1643_2443 226
115 3300046519 Ga0495632_0000423 Ga0495632_0000423_24337_25122 226
116 3300046520 Ga0495637_0004274 Ga0495637_0004274_703_1503 226
117 3300046525 Ga0495663_0009772 Ga0495663_0009772_1553_2353 226
118 3300046530 Ga0495654_0004327 Ga0495654_0004327_1759_2559 226
119 3300046538 Ga0495609_0014495 Ga0495609_0014495_1848_2648 226
120 3300046665 Ga0495661_0049400 Ga0495661_0049400_790_1590 226
121 3300046674 Ga0495588_0091270 Ga0495588_0091270_757_1557 226
122 3300046810 Ga0495660_0080913 Ga0495660_0080913_234_1034 226
123 3300047446 Ga0495679_048198 Ga0495679_048198_475_1275 226
124 3300047470 Ga0495681_0057836 Ga0495681_0057836_553_1353 226
125 3300053079 Ga0500610_0062327 Ga0500610_0062327_981_1781 226
126 3300053107 Ga0500560_079762 Ga0500560_079762_113_913 226
127 3300053125 Ga0500618_000952 Ga0500618_000952_1131_1931 226
128 3300053137 Ga0500561_0002629 Ga0500561_0002629_1007_1807 226
129 3300053140 Ga0500573_0003603 Ga0500573_0003603_5484_6284 226
130 3300053177 Ga0500636_0030622 Ga0500636_0030622_2301_3101 226
131 3300005548 Ga0070665_100114371 Ga0070665_1001143712 227
132 3300028379 Ga0268266_10142723 Ga0268266_101427232 227
133 iso_pu_bacteria 2838029111 2838033488 227
134 iso_pu_bacteria 2842317721 2842324047 227
135 iso_pu_bacteria 2842475841 2842480241 227
136 iso_pu_bacteria 2842502639 2842507653 227
137 3300025297 Ga0209758_1008866 Ga0209758_10088665 229
138 3300002987 JGI25159J45721_1000109 JGI25159J45721_100010920 230
139 3300003354 JGI25160J50197_1000103 JGI25160J50197_100010321 230
140 3300003374 JGI25161J50226_1000090 JGI25161J50226_100009019 230
141 3300004625 Ga0055543_1000087 Ga0055543_100008761 230
142 3300005262 Ga0065165_1000900 Ga0065165_100090026 230
143 3300025284 Ga0209130_1000098 Ga0209130_100009820 230
144 3300025302 Ga0207426_1000069 Ga0207426_1000069240 230
145 3300046660 Ga0495625_0161271 Ga0495625_0161271_498_1298 231
146 3300048924 Ga0496121_0061435 Ga0496121_0061435_764_1510 231
147 3300048926 Ga0496123_0049818 Ga0496123_0049818_805_1605 231
148 3300048928 Ga0496125_0015573 Ga0496125_0015573_4611_5357 231
149 3300053156 Ga0500622_0000278 Ga0500622_0000278_19616_20362 231
150 3300046460 Ga0495638_0000077 Ga0495638_0000077_98423_99187 232
151 3300053125 Ga0500618_000097 Ga0500618_000097_28824_29582 232
152 iso_pu_bacteria 2857516855 2857524276 232
153 3300025297 Ga0209758_1014459 Ga0209758_10144592 233
154 3300037471 Ga0395905_0004538 Ga0395905_0004538_2054_2857 233
155 3300048920 Ga0496117_0002417 Ga0496117_0002417_12288_13046 233
156 3300048921 Ga0496118_0080657 Ga0496118_0080657_161_919 233
157 3300048924 Ga0496121_0027857 Ga0496121_0027857_628_1413 233
158 3300006048 Ga0075363_100137033 Ga0075363_1001370333 234
159 iso_pu_bacteria 2821123053 2821128897 234
160 iso_pu_bacteria 2857531043 2857537245 234
161 3300048919 Ga0496116_0001726 Ga0496116_0001726_8950_9708 235
162 3300048925 Ga0496122_0037955 Ga0496122_0037955_1972_2730 235
163 3300048926 Ga0496123_0002390 Ga0496123_0002390_10961_11719 235
164 3300048928 Ga0496125_0000182 Ga0496125_0000182_10017_10775 235
165 iso_pu_bacteria 2847417321 2847421863 236
166 3300047472 Ga0495686_0159413 Ga0495686_0159413_450_1247 238
167 iso_pu_bacteria 2599185236 2599723324 242
168 iso_pu_bacteria 2513237140 2513885919 243
169 iso_pu_bacteria 2919100787 2919107361 243
170 iso_pu_bacteria 2920760137 2920762320 243
171 iso_pu_bacteria 8003992118 8003999213 243
172 iso_pu_bacteria 2513237102 2513706779 244
173 iso_pu_bacteria 2582581294 2585205206 244
174 iso_pu_bacteria 2643221582 2643918127 244
175 iso_pu_bacteria 2643221636 2644200553 244
176 iso_pu_bacteria 2791355263 2793343376 244
177 iso_pu_bacteria 2791355263 2793343567 244
178 iso_pu_bacteria 2802429636 2806070902 244
179 iso_pu_bacteria 2802429637 2806076290 244
180 iso_pu_bacteria 2888378607 2888387960 244
181 iso_pu_bacteria 2903768456 2903776791 244
182 iso_pu_bacteria 2935703347 2935713072 244
183 iso_pu_bacteria 2935992306 2936001783 244
184 iso_pu_bacteria 8019576017 8019586544 244
185 iso_pu_bacteria 8019586578 8019597528 244
186 iso_pu_bacteria 8019597564 8019607726 244
187 iso_pu_bacteria 8019608314 8019619096 244
188 iso_pu_bacteria 2512875026 2512975104 245
189 iso_pu_bacteria 2513237086 2513586404 245
190 iso_pu_bacteria 2513237089 2513605140 245
191 iso_pu_bacteria 2513237156 2513989295 245
192 iso_pu_bacteria 2513237160 2514007829 245
193 iso_pu_bacteria 2517487022 2517567748 245
194 iso_pu_bacteria 2551306087 2551699249 245
195 iso_pu_bacteria 2558860100 2558864271 245
196 iso_pu_bacteria 2558860100 2558867016 245
197 iso_pu_bacteria 2582581306 2585268304 245
198 iso_pu_bacteria 2582581307 2585275731 245
199 iso_pu_bacteria 2582581308 2585281744 245
200 iso_pu_bacteria 2582581316 2585334818 245
201 iso_pu_bacteria 2585427527 2585534392 245
202 iso_pu_bacteria 2585427530 2585553936 245
203 iso_pu_bacteria 2585427531 2585563678 245
204 iso_pu_bacteria 2585427608 2585897380 245
205 iso_pu_bacteria 2585427609 2585908929 245
206 iso_pu_bacteria 2585428125 2587984252 245
207 iso_pu_bacteria 2791355094 2792641093 245
208 iso_pu_bacteria 2791355094 2792642041 245
209 iso_pu_bacteria 2802428858 2802721037 245
210 iso_pu_bacteria 2802428859 2802728125 245
211 iso_pu_bacteria 2802428860 2802733591 245
212 iso_pu_bacteria 2802428861 2802736664 245
213 iso_pu_bacteria 2802428862 2802746732 245
214 iso_pu_bacteria 2802428863 2802749771 245
215 iso_pu_bacteria 2818991461 2819688121 245
216 iso_pu_bacteria 2842521101 2842524146 245
217 iso_pu_bacteria 2915980308 2915986714 245
218 iso_pu_bacteria 2916061851 2916064163 245
219 iso_pu_bacteria 2916068649 2916072060 245
220 iso_pu_bacteria 2921250672 2921254081 245
221 iso_pu_bacteria 2921289301 2921296164 245
222 iso_pu_bacteria 2924221636 2924226706 245
223 iso_pu_bacteria 2937029754 2937035492 245
224 iso_pu_bacteria 2937036028 2937039919 245
225 iso_pu_bacteria 2937078374 2937078943 245
226 iso_pu_bacteria 2937084907 2937087478 245
227 iso_pu_bacteria 2957375807 2957376333 245
228 iso_pu_bacteria 2957422303 2957429311 245
229 iso_pu_bacteria 2957437181 2957440506 245
230 iso_pu_bacteria 2960591022 2960597371 245
231 iso_pu_bacteria 2960631154 2960636564 245
232 iso_pu_bacteria 2960645483 2960651024 245
233 iso_pu_bacteria 2960680706 2960686075 245
234 iso_pu_bacteria 2960693952 2960695818 245
235 iso_pu_bacteria 2967686174 2967690986 245
236 iso_pu_bacteria 2967706974 2967713035 245
237 iso_pu_bacteria 2967728569 2967733693 245
238 iso_pu_bacteria 2970026789 2970029035 245
239 iso_pu_bacteria 2970122695 2970125129 245
240 iso_pu_bacteria 2970136068 2970141385 245
241 iso_pu_bacteria 2970143518 2970148076 245
242 iso_pu_bacteria 2977530762 2977533377 245
243 iso_pu_bacteria 2977544691 2977548866 245
244 iso_pu_bacteria 8003999396 8004005294 245
245 iso_pu_bacteria 8046767195 8046767824 245
246 3300002739 JGI25158J39367_1000766 JGI25158J39367_10007666 246
247 3300002774 JGI25150J39212_1011267 JGI25150J39212_10112672 246
248 3300002987 JGI25159J45721_1001093 JGI25159J45721_10010935 246
249 3300003354 JGI25160J50197_1003054 JGI25160J50197_10030545 246
250 3300003374 JGI25161J50226_1000106 JGI25161J50226_100010642 246
251 3300003775 Ga0055524_1002811 Ga0055524_10028115 246
252 3300003790 Ga0055528_1003238 Ga0055528_10032386 246
253 3300003792 Ga0055540_1000113 Ga0055540_100011361 246
254 3300004625 Ga0055543_1000169 Ga0055543_100016929 246
255 3300005262 Ga0065165_1004719 Ga0065165_10047195 246
256 3300025208 Ga0209436_100001 Ga0209436_100001287 246
257 3300025245 Ga0207425_1000808 Ga0207425_100080815 246
258 3300025258 Ga0209129_1011551 Ga0209129_10115512 246
259 3300025263 Ga0209565_1031997 Ga0209565_10319971 246
260 3300025284 Ga0209130_1000049 Ga0209130_1000049176 246
261 3300025295 Ga0209564_1000354 Ga0209564_100035439 246
262 3300025297 Ga0209758_1027231 Ga0209758_10272312 246
263 3300025302 Ga0207426_1000043 Ga0207426_100004342 246
264 3300025303 Ga0209051_1000287 Ga0209051_100028755 246
265 3300025304 Ga0209257_1008940 Ga0209257_10089404 246
266 3300028379 Ga0268266_10048274 Ga0268266_100482743 246
267 3300046513 Ga0495616_0187727 Ga0495616_0187727_99_899 246
268 3300048928 Ga0496125_0227215 Ga0496125_0227215_215_1006 246
269 iso_pu_bacteria 2508501122 2509111908 246
270 iso_pu_bacteria 2509276019 2509378646 246
271 iso_pu_bacteria 2512047086 2512531270 246
272 iso_pu_bacteria 2513237084 2513573048 246
273 iso_pu_bacteria 2513237085 2513580873 246
274 iso_pu_bacteria 2513237088 2513600618 246
275 iso_pu_bacteria 2513237138 2513869314 246
276 iso_pu_bacteria 2513237138 2513869944 246
277 iso_pu_bacteria 2513237140 2513881842 246
278 iso_pu_bacteria 2513237144 2513914242 246
279 iso_pu_bacteria 2513237146 2513930108 246
280 iso_pu_bacteria 2513237156 2513988055 246
281 iso_pu_bacteria 2513237159 2513998921 246
282 iso_pu_bacteria 2513237159 2514001283 246
283 iso_pu_bacteria 2515075009 2515109927 246
284 iso_pu_bacteria 2515154107 2515611280 246
285 iso_pu_bacteria 2515154107 2515611853 246
286 iso_pu_bacteria 2516143018 2516210365 246
287 iso_pu_bacteria 2524023207 2524451574 246
288 iso_pu_bacteria 2524023209 2524460893 246
289 iso_pu_bacteria 2524023209 2524462822 246
290 iso_pu_bacteria 2524023209 2524462871 246
291 iso_pu_bacteria 2534681796 2535521026 246
292 iso_pu_bacteria 2558860100 2558867707 246
293 iso_pu_bacteria 2582581304 2585258064 246
294 iso_pu_bacteria 2582581865 2585391201 246
295 iso_pu_bacteria 2585427633 2585994093 246
296 iso_pu_bacteria 2599185170 2599413972 246
297 iso_pu_bacteria 2615840626 2616310042 246
298 iso_pu_bacteria 2615840626 2616311766 246
299 iso_pu_bacteria 2615840698 2616551458 246
300 iso_pu_bacteria 2643221558 2643810872 246
301 iso_pu_bacteria 2643221568 2643858398 246
302 iso_pu_bacteria 2643221626 2644147392 246
303 iso_pu_bacteria 2643221634 2644192468 246
304 iso_pu_bacteria 2643221637 2644208162 246
305 iso_pu_bacteria 2643221643 2644238393 246
306 iso_pu_bacteria 2643221653 2644300760 246
307 iso_pu_bacteria 2643221718 2644651920 246
308 iso_pu_bacteria 2643221719 2644658982 246
309 iso_pu_bacteria 2657244999 2657686637 246
310 iso_pu_bacteria 2690316117 2692320941 246
311 iso_pu_bacteria 2718218233 2720617067 246
312 iso_pu_bacteria 2724679232 2725949143 246
313 iso_pu_bacteria 2738541293 2738805200 246
314 iso_pu_bacteria 2738541293 2738805876 246
315 iso_pu_bacteria 2751185821 2753459421 246
316 iso_pu_bacteria 2775506902 2776268190 246
317 iso_pu_bacteria 2775506904 2776283970 246
318 iso_pu_bacteria 2775507266 2778176768 246
319 iso_pu_bacteria 2775507266 2778179991 246
320 iso_pu_bacteria 2775507266 2778180297 246
321 iso_pu_bacteria 2791355091 2792623752 246
322 iso_pu_bacteria 2791355091 2792624680 246
323 iso_pu_bacteria 2791355092 2792630015 246
324 iso_pu_bacteria 2791355092 2792630800 246
325 iso_pu_bacteria 2791355253 2793283262 246
326 iso_pu_bacteria 2791355256 2793298071 246
327 iso_pu_bacteria 2791355266 2793363138 246
328 iso_pu_bacteria 2791355266 2793363446 246
329 iso_pu_bacteria 2791355266 2793364261 246
330 iso_pu_bacteria 2802429268 2804750496 246
331 iso_pu_bacteria 2802429605 2805931154 246
332 iso_pu_bacteria 2802429606 2805936956 246
333 iso_pu_bacteria 2802429606 2805937706 246
334 iso_pu_bacteria 2802429633 2806048257 246
335 iso_pu_bacteria 2802429634 2806055725 246
336 iso_pu_bacteria 2802429635 2806062560 246
337 iso_pu_bacteria 2838029111 2838034520 246
338 iso_pu_bacteria 2838035591 2838042541 246
339 iso_pu_bacteria 2838074704 2838080831 246
340 iso_pu_bacteria 2838661181 2838668385 246
341 iso_pu_bacteria 2841864319 2841870175 246
342 iso_pu_bacteria 2842198810 2842202712 246
343 iso_pu_bacteria 2842298080 2842302335 246
344 iso_pu_bacteria 2842298080 2842303816 246
345 iso_pu_bacteria 2842357229 2842363293 246
346 iso_pu_bacteria 2842395702 2842402003 246
347 iso_pu_bacteria 2842402390 2842408271 246
348 iso_pu_bacteria 2842409023 2842414542 246
349 iso_pu_bacteria 2842415677 2842421612 246
350 iso_pu_bacteria 2842475841 2842481267 246
351 iso_pu_bacteria 2842482326 2842488245 246
352 iso_pu_bacteria 2842482326 2842488554 246
353 iso_pu_bacteria 2842489311 2842494733 246
354 iso_pu_bacteria 2842502639 2842508148 246
355 iso_pu_bacteria 2842509118 2842513971 246
356 iso_pu_bacteria 2842509118 2842514813 246
357 iso_pu_bacteria 2842521101 2842526946 246
358 iso_pu_bacteria 2848992105 2848996636 246
359 iso_pu_bacteria 2850079185 2850083351 246
360 iso_pu_bacteria 2854911287 2854911457 246
361 iso_pu_bacteria 2855872281 2855876216 246
362 iso_pu_bacteria 2913295892 2913298781 246
363 iso_pu_bacteria 2933016740 2933023043 246
364 iso_pu_bacteria 2933586486 2933590020 246
365 iso_pu_bacteria 2989776772 2989780900 246
366 iso_pu_bacteria 2996887358 2996889810 246
367 iso_pu_bacteria 3005409236 3005410234 246
368 iso_pu_bacteria 639633055 639651344 246
369 iso_pu_bacteria 643692032 643692049 246
370 iso_pu_bacteria 8003570095 8003574978 246
371 iso_pu_bacteria 8003570095 8003575139 246
372 iso_pu_bacteria 8005301065 8005301748 246
373 iso_pu_bacteria 8005321885 8005324337 246
374 iso_pu_bacteria 8005395548 8005402179 246
375 iso_pu_bacteria 8005460587 8005465961 246
376 iso_pu_bacteria 8005484373 8005488248 246
377 iso_pu_bacteria 8005542996 8005549966 246
378 iso_pu_bacteria 8005688590 8005693072 246
379 iso_pu_bacteria 8018150411 8018153807 246
380 iso_pu_bacteria 8018176218 8018179067 246
381 iso_pu_bacteria 8046767195 8046770035 246
382 iso_pu_bacteria 8057575449 8057581437 246
383 iso_pu_bacteria 8057874678 8057880205 246

Feature Viewer

pLDDT pTM Quality
37.49 0.24 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map