F429687

General Info

Members Datasets Scaffolds Average Seq Length
383 139 758 259

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000213|Ga0495650_0000213_116894_117760
Length 288
Sequence MGRLHTSCVLAWMLAAGAADAALGQEAPASPVPAGDVTPGPGKEGVVHVNAMKNPEMHSYRAIVAGLDTFDEFHAMAPKVPRLLFAVRSRNSGPLRGDLPSAKLQGDDFALALPVDADARFEVPRSRQAWDTDAELILSRKRKEVRVWPYIRTPGLADNQRRLGDIRLECRVMVAIAKKEASFYVVALVNTVLLTGDWCTFMKDKNSNWSVRMPAELASAVLVDGNRSRNLRVEDNAFMVPLFDTSWSDDALIEVAYASAAAPAAGVSATDTVDATTRTAGETPRTGP

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
11 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
12 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
13 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
16 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
29 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
30 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
31 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
32 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
33 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
34 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
35 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
36 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
37 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
38 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
39 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
40 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
41 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
42 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
43 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
44 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
45 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
48 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
49 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
50 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
51 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
52 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
53 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
54 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
55 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
56 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
57 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
58 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
59 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
60 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
61 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
62 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
63 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
64 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
65 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
66 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
67 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
68 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
69 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
70 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
71 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
72 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
73 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
74 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
75 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
76 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
77 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
81 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
82 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
83 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
91 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
92 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
93 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
97 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
98 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
101 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
107 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
110 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
111 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
112 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
117 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
135 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 2643221556 Massilia sp. Root1485 Isolate Unclassified
138 2643221684 Massilia sp. Root133 Isolate Unclassified
139 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 3.92
Rhizosphere 90.6
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0000213 3300046471 Bacteria 123910
2 Ga0055525_1000047 3300003759 Bacteria 261507
3 Ga0065165_1004511 3300005262 Bacteria 8552
4 Ga0070658_10149247 3300005327 Bacteria 1956
5 Ga0070658_10149400 3300005327 Bacteria 1955
6 Ga0070660_100031038 3300005339 Bacteria 4011
7 Ga0070661_100156461 3300005344 Bacteria 1724
8 Ga0070659_100014090 3300005366 Bacteria 5967
9 Ga0070662_100061682 3300005457 Bacteria 2738
10 Ga0070662_100079438 3300005457 Bacteria 2439
11 Ga0070664_100185012 3300005564 Bacteria 1853
12 Ga0097621_100342317 3300006237 Bacteria 1328
13 Ga0105243_10017415 3300009148 Bacteria 5432
14 Ga0105241_10048102 3300009174 Bacteria 3244
15 Ga0105242_10679684 3300009176 Bacteria 1005
16 Ga0105246_10121569 3300011119 Bacteria 1936
17 Ga0157373_10456553 3300013100 Bacteria 920
18 Ga0157378_10147550 3300013297 Bacteria 2189
19 Ga0157372_10261574 3300013307 Bacteria 2009
20 Ga0209563_100003 3300025230 Bacteria 1932942
21 Ga0209148_1000352 3300025254 Bacteria 59377
22 Ga0207705_10328394 3300025909 Bacteria 1176
23 Ga0207654_10032600 3300025911 Bacteria 2881
24 Ga0207657_10033275 3300025919 Bacteria 4648
25 Ga0207657_10164725 3300025919 Bacteria 1799
26 Ga0207649_10319462 3300025920 Bacteria 1140
27 Ga0207706_10056673 3300025933 Bacteria 3454
28 Ga0207706_10168713 3300025933 Bacteria 1924
29 Ga0207709_10023664 3300025935 Bacteria 3498
30 Ga0207679_10053318 3300025945 Bacteria 2971
31 Ga0207667_10018295 3300025949 Bacteria 7863
32 Ga0395899_0013749 3300037312 Bacteria 6188
33 Ga0395899_0020532 3300037312 Bacteria 5006
34 Ga0395899_0064064 3300037312 Bacteria 2703
35 Ga0395899_0133576 3300037312 Bacteria 1770
36 Ga0395899_0136865 3300037312 Bacteria 1745
37 Ga0395900_0029626 3300037418 Bacteria 5615
38 Ga0395900_0110530 3300037418 Bacteria 2823
39 Ga0395900_0130879 3300037418 Bacteria 2571
40 Ga0395900_0131694 3300037418 Bacteria 2562
41 Ga0395900_0258682 3300037418 Bacteria 1739
42 Ga0395900_0272025 3300037418 Bacteria 1688
43 Ga0395898_0065734 3300037466 Bacteria 3515
44 Ga0395898_0114413 3300037466 Bacteria 2585
45 Ga0395898_0394624 3300037466 Bacteria 1319
46 Ga0395905_0076827 3300037471 Bacteria 3129
47 Ga0395905_0169078 3300037471 Bacteria 2053
48 Ga0395905_0275428 3300037471 Bacteria 1568
49 Ga0395905_0363322 3300037471 Bacteria 1340
50 Ga0395905_0393421 3300037471 Bacteria 1280
51 Ga0395905_0598051 3300037471 Bacteria 1005
52 Ga0395901_0079441 3300038443 Bacteria 3425
53 Ga0395901_0090569 3300038443 Bacteria 3201
54 Ga0395901_0342090 3300038443 Bacteria 1545
55 Ga0439448_0000921 3300042005 Bacteria 7242
56 Ga0439448_0006410 3300042005 Bacteria 3383
57 Ga0439449_0019699 3300042007 Bacteria 2528
58 Ga0439450_011027 3300042008 Bacteria 1758
59 Ga0439458_0010876 3300042157 Bacteria 2032
60 Ga0466969_0034332 3300044656 Bacteria 2570
61 Ga0466969_0077839 3300044656 Bacteria 1586
62 Ga0466972_0079295 3300044658 Bacteria 1563
63 Ga0466965_0001668 3300044683 Bacteria 9112
64 Ga0466965_0063415 3300044683 Bacteria 1849
65 Ga0466965_0074976 3300044683 Bacteria 1705
66 Ga0466966_0010816 3300044684 Bacteria 6062
67 Ga0466966_0034463 3300044684 Bacteria 3272
68 Ga0466966_0037789 3300044684 Bacteria 3111
69 Ga0466961_0059647 3300044693 Bacteria 2426
70 Ga0466961_0214266 3300044693 Bacteria 1188
71 Ga0466964_0000358 3300044706 Bacteria 13719
72 Ga0466968_0005103 3300044735 Bacteria 4912
73 Ga0466957_0018411 3300044842 Bacteria 4102
74 Ga0466959_0015613 3300045049 Bacteria 5536
75 Ga0466959_0084036 3300045049 Bacteria 2291
76 Ga0466959_0219963 3300045049 Bacteria 1317
77 Ga0466967_0013588 3300045976 Bacteria 6300
78 Ga0495617_000009 3300046452 Bacteria 312936
79 Ga0495617_019514 3300046452 Bacteria 2293
80 Ga0495617_046743 3300046452 Bacteria 1442
81 Ga0495627_000119 3300046453 Bacteria 99048
82 Ga0495603_0164681 3300046455 Bacteria 1285
83 Ga0495603_0226745 3300046455 Bacteria 1077
84 Ga0495590_0000080 3300046457 Bacteria 63569
85 Ga0495590_0000253 3300046457 Bacteria 29076
86 Ga0495590_0081904 3300046457 Bacteria 1137
87 Ga0495591_000043 3300046458 Bacteria 148885
88 Ga0495591_031007 3300046458 Bacteria 1608
89 Ga0495629_0036609 3300046459 Bacteria 3463
90 Ga0495629_0232877 3300046459 Bacteria 1269
91 Ga0495638_0076829 3300046460 Bacteria 2034
92 Ga0495653_0005134 3300046463 Bacteria 10626
93 Ga0495653_0066002 3300046463 Bacteria 2722
94 Ga0495653_0082706 3300046463 Bacteria 2369
95 Ga0495650_0020585 3300046471 Bacteria 3212
96 Ga0495580_0216868 3300046472 Bacteria 1315
97 Ga0495582_0016967 3300046473 Bacteria 3987
98 Ga0495582_0019063 3300046473 Bacteria 3754
99 Ga0495605_0000024 3300046474 Bacteria 236016
100 Ga0495605_0000728 3300046474 Bacteria 24222
101 Ga0495605_0006256 3300046474 Bacteria 6863
102 Ga0495605_0012873 3300046474 Bacteria 4630
103 Ga0495605_0021283 3300046474 Bacteria 3437
104 Ga0495605_0029229 3300046474 Bacteria 2839
105 Ga0495605_0073100 3300046474 Bacteria 1615
106 Ga0495605_0075736 3300046474 Bacteria 1582
107 Ga0495584_0002407 3300046491 Bacteria 10632
108 Ga0495584_0005658 3300046491 Bacteria 6606
109 Ga0495584_0006804 3300046491 Bacteria 5972
110 Ga0495584_0051663 3300046491 Bacteria 2069
111 Ga0495584_0052606 3300046491 Bacteria 2049
112 Ga0495584_0087805 3300046491 Bacteria 1567
113 Ga0495585_0013540 3300046492 Bacteria 4768
114 Ga0495585_0016837 3300046492 Bacteria 4234
115 Ga0495585_0037163 3300046492 Bacteria 2742
116 Ga0495585_0163070 3300046492 Bacteria 1155
117 Ga0495585_0173626 3300046492 Bacteria 1111
118 Ga0495585_0181565 3300046492 Bacteria 1081
119 Ga0495594_0002538 3300046499 Bacteria 9506
120 Ga0495594_0044841 3300046499 Bacteria 2426
121 Ga0495594_0205469 3300046499 Bacteria 1122
122 Ga0495596_0009239 3300046500 Bacteria 4346
123 Ga0495596_0010813 3300046500 Bacteria 3960
124 Ga0495596_0069820 3300046500 Bacteria 1365
125 Ga0495596_0073502 3300046500 Bacteria 1327
126 Ga0495607_0003993 3300046501 Bacteria 11083
127 Ga0495607_0004598 3300046501 Bacteria 10112
128 Ga0495607_0007631 3300046501 Bacteria 7452
129 Ga0495607_0008532 3300046501 Bacteria 7003
130 Ga0495607_0013601 3300046501 Bacteria 5327
131 Ga0495607_0018960 3300046501 Bacteria 4375
132 Ga0495607_0059057 3300046501 Bacteria 2189
133 Ga0495607_0108042 3300046501 Bacteria 1479
134 Ga0495583_0004861 3300046506 Bacteria 9389
135 Ga0495583_0009544 3300046506 Bacteria 5783
136 Ga0495583_0011097 3300046506 Bacteria 5192
137 Ga0495583_0015338 3300046506 Bacteria 4171
138 Ga0495583_0048825 3300046506 Bacteria 1940
139 Ga0495606_0017911 3300046507 Bacteria 5333
140 Ga0495606_0033771 3300046507 Bacteria 3523
141 Ga0495606_0058112 3300046507 Bacteria 2488
142 Ga0495606_0118888 3300046507 Bacteria 1584
143 Ga0495606_0135944 3300046507 Bacteria 1456
144 Ga0495606_0190162 3300046507 Bacteria 1177
145 Ga0495610_0004008 3300046512 Bacteria 11115
146 Ga0495616_0003289 3300046513 Bacteria 10390
147 Ga0495616_0010773 3300046513 Bacteria 5272
148 Ga0495616_0016791 3300046513 Bacteria 4045
149 Ga0495616_0025557 3300046513 Bacteria 3153
150 Ga0495616_0029351 3300046513 Bacteria 2905
151 Ga0495616_0029471 3300046513 Bacteria 2897
152 Ga0495616_0045167 3300046513 Bacteria 2231
153 Ga0495616_0123978 3300046513 Unclassified 1190
154 Ga0495616_0183998 3300046513 Bacteria 927
155 Ga0495631_0004253 3300046518 Bacteria 7658
156 Ga0495631_0004973 3300046518 Bacteria 7005
157 Ga0495631_0038043 3300046518 Bacteria 2141
158 Ga0495631_0048521 3300046518 Bacteria 1861
159 Ga0495631_0067371 3300046518 Bacteria 1548
160 Ga0495631_0082348 3300046518 Bacteria 1387
161 Ga0495631_0085467 3300046518 Bacteria 1359
162 Ga0495632_0000073 3300046519 Bacteria 104293
163 Ga0495632_0002911 3300046519 Bacteria 12580
164 Ga0495632_0006784 3300046519 Bacteria 7311
165 Ga0495632_0008391 3300046519 Bacteria 6347
166 Ga0495632_0033009 3300046519 Bacteria 2661
167 Ga0495632_0068391 3300046519 Bacteria 1711
168 Ga0495637_0000009 3300046520 Bacteria 402028
169 Ga0495637_0054850 3300046520 Bacteria 1654
170 Ga0495643_0003488 3300046522 Bacteria 11466
171 Ga0495643_0042950 3300046522 Bacteria 2461
172 Ga0495643_0068896 3300046522 Bacteria 1861
173 Ga0495643_0111650 3300046522 Bacteria 1389
174 Ga0495643_0163098 3300046522 Bacteria 1095
175 Ga0495644_0002906 3300046523 Bacteria 6799
176 Ga0495644_0018472 3300046523 Bacteria 2664
177 Ga0495644_0026950 3300046523 Bacteria 2179
178 Ga0495644_0029756 3300046523 Bacteria 2062
179 Ga0495644_0054043 3300046523 Bacteria 1508
180 Ga0495648_0002589 3300046524 Bacteria 16563
181 Ga0495648_0004156 3300046524 Bacteria 12446
182 Ga0495648_0012044 3300046524 Bacteria 6478
183 Ga0495648_0023313 3300046524 Bacteria 4243
184 Ga0495648_0031115 3300046524 Bacteria 3519
185 Ga0495666_0005906 3300046526 Bacteria 6168
186 Ga0495642_0000125 3300046528 Bacteria 43793
187 Ga0495642_0004287 3300046528 Bacteria 5545
188 Ga0495642_0006553 3300046528 Bacteria 4468
189 Ga0495642_0018975 3300046528 Bacteria 2693
190 Ga0495642_0021274 3300046528 Bacteria 2551
191 Ga0495642_0026352 3300046528 Bacteria 2308
192 Ga0495642_0049211 3300046528 Bacteria 1731
193 Ga0495642_0087282 3300046528 Bacteria 1318
194 Ga0495642_0108606 3300046528 Bacteria 1185
195 Ga0495652_0011535 3300046529 Bacteria 7990
196 Ga0495654_0061810 3300046530 Bacteria 1797
197 Ga0495654_0207178 3300046530 Bacteria 836
198 Ga0495665_0004078 3300046531 Bacteria 7878
199 Ga0495586_0001441 3300046535 Bacteria 13144
200 Ga0495586_0085922 3300046535 Bacteria 1733
201 Ga0495587_0046760 3300046536 Bacteria 2567
202 Ga0495587_0078622 3300046536 Bacteria 1913
203 Ga0495609_0000030 3300046538 Bacteria 215885
204 Ga0495609_0008896 3300046538 Bacteria 4886
205 Ga0495609_0012666 3300046538 Bacteria 3998
206 Ga0495609_0017054 3300046538 Bacteria 3378
207 Ga0495609_0035486 3300046538 Bacteria 2257
208 Ga0495609_0039473 3300046538 Bacteria 2125
209 Ga0495597_0008475 3300046542 Bacteria 5152
210 Ga0495597_0017234 3300046542 Bacteria 3402
211 Ga0495597_0045331 3300046542 Bacteria 1951
212 Ga0495622_0004220 3300046557 Bacteria 6698
213 Ga0495622_0035208 3300046557 Bacteria 2335
214 Ga0495622_0129608 3300046557 Bacteria 1149
215 Ga0495622_0166065 3300046557 Bacteria 994
216 Ga0495633_0005089 3300046558 Bacteria 8170
217 Ga0495633_0016430 3300046558 Bacteria 3815
218 Ga0495633_0048624 3300046558 Bacteria 2002
219 Ga0495633_0049143 3300046558 Bacteria 1991
220 Ga0495656_0004221 3300046615 Bacteria 4905
221 Ga0495656_0033273 3300046615 Bacteria 2103
222 Ga0495668_0003950 3300046616 Bacteria 10817
223 Ga0495668_0004289 3300046616 Bacteria 10222
224 Ga0495668_0023216 3300046616 Bacteria 3540
225 Ga0495668_0128303 3300046616 Bacteria 1388
226 Ga0495668_0165591 3300046616 Bacteria 1211
227 Ga0495634_0003011 3300046642 Bacteria 13716
228 Ga0495611_0000631 3300046648 Bacteria 20289
229 Ga0495611_0005715 3300046648 Bacteria 5305
230 Ga0495611_0006412 3300046648 Bacteria 5013
231 Ga0495611_0048581 3300046648 Bacteria 1907
232 Ga0495611_0107534 3300046648 Unclassified 1297
233 Ga0495625_0048755 3300046660 Bacteria 3048
234 Ga0495625_0076874 3300046660 Bacteria 2333
235 Ga0495635_0001560 3300046663 Bacteria 15374
236 Ga0495661_0000754 3300046665 Bacteria 31377
237 Ga0495661_0001856 3300046665 Bacteria 16872
238 Ga0495661_0003100 3300046665 Bacteria 12480
239 Ga0495661_0003593 3300046665 Bacteria 11414
240 Ga0495661_0018558 3300046665 Bacteria 4572
241 Ga0495661_0019955 3300046665 Bacteria 4383
242 Ga0495661_0035425 3300046665 Bacteria 3131
243 Ga0495661_0052101 3300046665 Bacteria 2467
244 Ga0495661_0053796 3300046665 Bacteria 2420
245 Ga0495661_0098732 3300046665 Bacteria 1647
246 Ga0495661_0265063 3300046665 Unclassified 871
247 Ga0495588_0000062 3300046674 Bacteria 253674
248 Ga0495588_0012421 3300046674 Bacteria 4024
249 Ga0495588_0015336 3300046674 Bacteria 3686
250 Ga0495588_0074600 3300046674 Bacteria 1766
251 Ga0495588_0114439 3300046674 Bacteria 1421
252 Ga0495588_0144712 3300046674 Bacteria 1256
253 Ga0495588_0171470 3300046674 Bacteria 1147
254 Ga0495623_0009279 3300046679 Bacteria 6387
255 Ga0495623_0013940 3300046679 Bacteria 5211
256 Ga0495669_0000035 3300046684 Bacteria 96159
257 Ga0495669_0005196 3300046684 Bacteria 5416
258 Ga0495669_0012362 3300046684 Bacteria 3633
259 Ga0495669_0024659 3300046684 Bacteria 2619
260 Ga0495669_0057847 3300046684 Bacteria 1749
261 Ga0495613_0057332 3300046689 Bacteria 2860
262 Ga0495613_0072531 3300046689 Bacteria 2510
263 Ga0495670_0034072 3300046691 Bacteria 2535
264 Ga0495670_0040399 3300046691 Bacteria 2326
265 Ga0495670_0051507 3300046691 Bacteria 2060
266 Ga0495670_0102681 3300046691 Bacteria 1473
267 Ga0495671_0001431 3300046692 Bacteria 16052
268 Ga0495671_0061672 3300046692 Bacteria 1849
269 Ga0495649_0000028 3300046694 Bacteria 163229
270 Ga0495649_0005510 3300046694 Bacteria 8026
271 Ga0495589_0000021 3300046794 Bacteria 197941
272 Ga0495589_0002782 3300046794 Bacteria 9680
273 Ga0495589_0004510 3300046794 Bacteria 7397
274 Ga0495589_0007001 3300046794 Bacteria 5914
275 Ga0495589_0007526 3300046794 Bacteria 5704
276 Ga0495589_0026169 3300046794 Bacteria 2957
277 Ga0495589_0066289 3300046794 Bacteria 1768
278 Ga0495600_0020308 3300046809 Bacteria 4249
279 Ga0495660_0000077 3300046810 Bacteria 105543
280 Ga0495660_0003463 3300046810 Bacteria 9749
281 Ga0495660_0032018 3300046810 Bacteria 2954
282 Ga0495660_0033303 3300046810 Bacteria 2890
283 Ga0495660_0073400 3300046810 Bacteria 1809
284 Ga0495660_0197803 3300046810 Bacteria 961
285 Ga0495581_0009977 3300047315 Bacteria 5492
286 Ga0495604_0005207 3300047317 Bacteria 10304
287 Ga0495604_0312073 3300047317 Bacteria 1053
288 Ga0495672_0000055 3300047320 Bacteria 229428
289 Ga0495672_0003998 3300047320 Bacteria 12327
290 Ga0495672_0013123 3300047320 Bacteria 5731
291 Ga0495672_0038076 3300047320 Bacteria 2936
292 Ga0495676_0000017 3300047321 Bacteria 181815
293 Ga0495676_0145832 3300047321 Bacteria 1691
294 Ga0495680_0001614 3300047322 Bacteria 23981
295 Ga0495680_0021326 3300047322 Bacteria 5425
296 Ga0495683_0003271 3300047323 Bacteria 9468
297 Ga0495683_0003359 3300047323 Bacteria 9349
298 Ga0495683_0007591 3300047323 Bacteria 5844
299 Ga0495683_0019851 3300047323 Bacteria 3466
300 Ga0495687_000036 3300047443 Bacteria 255427
301 Ga0495687_000360 3300047443 Bacteria 57082
302 Ga0495687_004931 3300047443 Bacteria 8734
303 Ga0495675_0001986 3300047444 Bacteria 12215
304 Ga0495677_0000450 3300047445 Bacteria 17523
305 Ga0495677_0001772 3300047445 Bacteria 8645
306 Ga0495677_0001957 3300047445 Bacteria 8223
307 Ga0495677_0003530 3300047445 Bacteria 6068
308 Ga0495677_0010112 3300047445 Bacteria 3469
309 Ga0495677_0010700 3300047445 Bacteria 3361
310 Ga0495677_0017784 3300047445 Bacteria 2576
311 Ga0495677_0019372 3300047445 Bacteria 2468
312 Ga0495677_0055261 3300047445 Bacteria 1465
313 Ga0495679_004982 3300047446 Bacteria 5983
314 Ga0495679_008881 3300047446 Bacteria 4057
315 Ga0495679_009440 3300047446 Bacteria 3905
316 Ga0495679_046907 3300047446 Bacteria 1312
317 Ga0495685_005744 3300047447 Bacteria 4051
318 Ga0495685_014058 3300047447 Bacteria 2716
319 Ga0495681_0003087 3300047470 Bacteria 11679
320 Ga0495681_0003477 3300047470 Bacteria 10955
321 Ga0495681_0042713 3300047470 Bacteria 2192
322 Ga0495681_0064267 3300047470 Bacteria 1681
323 Ga0495681_0136815 3300047470 Unclassified 1038
324 Ga0495686_0003067 3300047472 Bacteria 14809
325 Ga0495686_0021634 3300047472 Bacteria 4266
326 Ga0495686_0083413 3300047472 Bacteria 1949
327 Ga0495593_0005623 3300047673 Bacteria 7399
328 Ga0495602_0029146 3300048088 Bacteria 5267
329 Ga0495614_0042104 3300048089 Bacteria 1958
330 Ga0495626_0000017 3300048091 Bacteria 231648
331 Ga0495626_0000624 3300048091 Bacteria 34501
332 Ga0495626_0002763 3300048091 Bacteria 11774
333 Ga0495626_0005310 3300048091 Bacteria 7596
334 Ga0495626_0029679 3300048091 Bacteria 2644
335 Ga0495626_0033471 3300048091 Bacteria 2463
336 Ga0495626_0035104 3300048091 Bacteria 2394
337 Ga0495626_0070697 3300048091 Bacteria 1569
338 Ga0495626_0075140 3300048091 Bacteria 1511
339 Ga0495626_0103755 3300048091 Bacteria 1237
340 Ga0496100_0061303 3300048903 Bacteria 2478
341 Ga0496102_0002955 3300048905 Bacteria 14396
342 Ga0496102_0234200 3300048905 Bacteria 1731
343 Ga0496102_0497966 3300048905 Bacteria 1140
344 Ga0496103_0181644 3300048906 Bacteria 1352
345 Ga0496106_0359039 3300048909 Bacteria 1170
346 Ga0496107_0047030 3300048910 Bacteria 3106
347 Ga0496108_0193731 3300048911 Bacteria 1762
348 Ga0496109_0039130 3300048912 Bacteria 4291
349 Ga0496110_0219952 3300048913 Bacteria 1727
350 Ga0496110_0244016 3300048913 Bacteria 1635
351 Ga0496112_0165554 3300048915 Bacteria 2177
352 Ga0496112_0359452 3300048915 Bacteria 1398
353 Ga0496113_0037914 3300048916 Bacteria 3540
354 Ga0496115_0057767 3300048918 Bacteria 3121
355 Ga0496121_0156914 3300048924 Bacteria 1669
356 Ga0496122_0000452 3300048925 Bacteria 85514
357 Ga0496122_0012683 3300048925 Bacteria 8348
358 Ga0496122_0069841 3300048925 Bacteria 2513
359 Ga0496123_0004472 3300048926 Bacteria 14661
360 Ga0496123_0004664 3300048926 Bacteria 14227
361 Ga0496123_0082086 3300048926 Bacteria 1956
362 Ga0496124_0014324 3300048927 Bacteria 7670
363 Ga0496124_0072535 3300048927 Bacteria 2851
364 Ga0496124_0083764 3300048927 Bacteria 2616
365 Ga0496124_0114613 3300048927 Bacteria 2164
366 Ga0496124_0115414 3300048927 Bacteria 2155
367 Ga0496124_0260954 3300048927 Bacteria 1275
368 Ga0496125_0005373 3300048928 Bacteria 14290
369 Ga0496125_0290657 3300048928 Bacteria 1007
370 Ga0495678_000025 3300049459 Bacteria 227891
371 Ga0495678_000041 3300049459 Bacteria 185715
372 Ga0495678_016777 3300049459 Bacteria 3337
373 Ga0495678_096310 3300049459 Bacteria 1033
374 Ga0495682_0031009 3300049460 Bacteria 1977
375 Ga0495682_0111357 3300049460 Bacteria 981
376 Ga0466962_0058183 3300061719 Bacteria 1845
377 2643802865 2643221556 Bacteria 7251154
378 2644472374 2643221684 Bacteria 7145183
379 8047678528 8047673197 Bacteria 7395230
380 Ga0495650_0000213
381 Ga0055525_1000047
382 Ga0065165_1004511
383 Ga0070658_10149247
384 Ga0070658_10149400
385 Ga0070660_100031038
386 Ga0070661_100156461
387 Ga0070659_100014090
388 Ga0070662_100061682
389 Ga0070662_100079438
390 Ga0070664_100185012
391 Ga0097621_100342317
392 Ga0105243_10017415
393 Ga0105241_10048102
394 Ga0105242_10679684
395 Ga0105246_10121569
396 Ga0157373_10456553
397 Ga0157378_10147550
398 Ga0157372_10261574
399 Ga0209563_100003
400 Ga0209148_1000352
401 Ga0207705_10328394
402 Ga0207654_10032600
403 Ga0207657_10033275
404 Ga0207657_10164725
405 Ga0207649_10319462
406 Ga0207706_10056673
407 Ga0207706_10168713
408 Ga0207709_10023664
409 Ga0207679_10053318
410 Ga0207667_10018295
411 Ga0395899_0013749
412 Ga0395899_0020532
413 Ga0395899_0064064
414 Ga0395899_0133576
415 Ga0395899_0136865
416 Ga0395900_0029626
417 Ga0395900_0110530
418 Ga0395900_0130879
419 Ga0395900_0131694
420 Ga0395900_0258682
421 Ga0395900_0272025
422 Ga0395898_0065734
423 Ga0395898_0114413
424 Ga0395898_0394624
425 Ga0395905_0076827
426 Ga0395905_0169078
427 Ga0395905_0275428
428 Ga0395905_0363322
429 Ga0395905_0393421
430 Ga0395905_0598051
431 Ga0395901_0079441
432 Ga0395901_0090569
433 Ga0395901_0342090
434 Ga0439448_0000921
435 Ga0439448_0006410
436 Ga0439449_0019699
437 Ga0439450_011027
438 Ga0439458_0010876
439 Ga0466969_0034332
440 Ga0466969_0077839
441 Ga0466972_0079295
442 Ga0466965_0001668
443 Ga0466965_0063415
444 Ga0466965_0074976
445 Ga0466966_0010816
446 Ga0466966_0034463
447 Ga0466966_0037789
448 Ga0466961_0059647
449 Ga0466961_0214266
450 Ga0466964_0000358
451 Ga0466968_0005103
452 Ga0466957_0018411
453 Ga0466959_0015613
454 Ga0466959_0084036
455 Ga0466959_0219963
456 Ga0466967_0013588
457 Ga0495617_000009
458 Ga0495617_019514
459 Ga0495617_046743
460 Ga0495627_000119
461 Ga0495603_0164681
462 Ga0495603_0226745
463 Ga0495590_0000080
464 Ga0495590_0000253
465 Ga0495590_0081904
466 Ga0495591_000043
467 Ga0495591_031007
468 Ga0495629_0036609
469 Ga0495629_0232877
470 Ga0495638_0076829
471 Ga0495653_0005134
472 Ga0495653_0066002
473 Ga0495653_0082706
474 Ga0495650_0020585
475 Ga0495580_0216868
476 Ga0495582_0016967
477 Ga0495582_0019063
478 Ga0495605_0000024
479 Ga0495605_0000728
480 Ga0495605_0006256
481 Ga0495605_0012873
482 Ga0495605_0021283
483 Ga0495605_0029229
484 Ga0495605_0073100
485 Ga0495605_0075736
486 Ga0495584_0002407
487 Ga0495584_0005658
488 Ga0495584_0006804
489 Ga0495584_0051663
490 Ga0495584_0052606
491 Ga0495584_0087805
492 Ga0495585_0013540
493 Ga0495585_0016837
494 Ga0495585_0037163
495 Ga0495585_0163070
496 Ga0495585_0173626
497 Ga0495585_0181565
498 Ga0495594_0002538
499 Ga0495594_0044841
500 Ga0495594_0205469
501 Ga0495596_0009239
502 Ga0495596_0010813
503 Ga0495596_0069820
504 Ga0495596_0073502
505 Ga0495607_0003993
506 Ga0495607_0004598
507 Ga0495607_0007631
508 Ga0495607_0008532
509 Ga0495607_0013601
510 Ga0495607_0018960
511 Ga0495607_0059057
512 Ga0495607_0108042
513 Ga0495583_0004861
514 Ga0495583_0009544
515 Ga0495583_0011097
516 Ga0495583_0015338
517 Ga0495583_0048825
518 Ga0495606_0017911
519 Ga0495606_0033771
520 Ga0495606_0058112
521 Ga0495606_0118888
522 Ga0495606_0135944
523 Ga0495606_0190162
524 Ga0495610_0004008
525 Ga0495616_0003289
526 Ga0495616_0010773
527 Ga0495616_0016791
528 Ga0495616_0025557
529 Ga0495616_0029351
530 Ga0495616_0029471
531 Ga0495616_0045167
532 Ga0495616_0123978
533 Ga0495616_0183998
534 Ga0495631_0004253
535 Ga0495631_0004973
536 Ga0495631_0038043
537 Ga0495631_0048521
538 Ga0495631_0067371
539 Ga0495631_0082348
540 Ga0495631_0085467
541 Ga0495632_0000073
542 Ga0495632_0002911
543 Ga0495632_0006784
544 Ga0495632_0008391
545 Ga0495632_0033009
546 Ga0495632_0068391
547 Ga0495637_0000009
548 Ga0495637_0054850
549 Ga0495643_0003488
550 Ga0495643_0042950
551 Ga0495643_0068896
552 Ga0495643_0111650
553 Ga0495643_0163098
554 Ga0495644_0002906
555 Ga0495644_0018472
556 Ga0495644_0026950
557 Ga0495644_0029756
558 Ga0495644_0054043
559 Ga0495648_0002589
560 Ga0495648_0004156
561 Ga0495648_0012044
562 Ga0495648_0023313
563 Ga0495648_0031115
564 Ga0495666_0005906
565 Ga0495642_0000125
566 Ga0495642_0004287
567 Ga0495642_0006553
568 Ga0495642_0018975
569 Ga0495642_0021274
570 Ga0495642_0026352
571 Ga0495642_0049211
572 Ga0495642_0087282
573 Ga0495642_0108606
574 Ga0495652_0011535
575 Ga0495654_0061810
576 Ga0495654_0207178
577 Ga0495665_0004078
578 Ga0495586_0001441
579 Ga0495586_0085922
580 Ga0495587_0046760
581 Ga0495587_0078622
582 Ga0495609_0000030
583 Ga0495609_0008896
584 Ga0495609_0012666
585 Ga0495609_0017054
586 Ga0495609_0035486
587 Ga0495609_0039473
588 Ga0495597_0008475
589 Ga0495597_0017234
590 Ga0495597_0045331
591 Ga0495622_0004220
592 Ga0495622_0035208
593 Ga0495622_0129608
594 Ga0495622_0166065
595 Ga0495633_0005089
596 Ga0495633_0016430
597 Ga0495633_0048624
598 Ga0495633_0049143
599 Ga0495656_0004221
600 Ga0495656_0033273
601 Ga0495668_0003950
602 Ga0495668_0004289
603 Ga0495668_0023216
604 Ga0495668_0128303
605 Ga0495668_0165591
606 Ga0495634_0003011
607 Ga0495611_0000631
608 Ga0495611_0005715
609 Ga0495611_0006412
610 Ga0495611_0048581
611 Ga0495611_0107534
612 Ga0495625_0048755
613 Ga0495625_0076874
614 Ga0495635_0001560
615 Ga0495661_0000754
616 Ga0495661_0001856
617 Ga0495661_0003100
618 Ga0495661_0003593
619 Ga0495661_0018558
620 Ga0495661_0019955
621 Ga0495661_0035425
622 Ga0495661_0052101
623 Ga0495661_0053796
624 Ga0495661_0098732
625 Ga0495661_0265063
626 Ga0495588_0000062
627 Ga0495588_0012421
628 Ga0495588_0015336
629 Ga0495588_0074600
630 Ga0495588_0114439
631 Ga0495588_0144712
632 Ga0495588_0171470
633 Ga0495623_0009279
634 Ga0495623_0013940
635 Ga0495669_0000035
636 Ga0495669_0005196
637 Ga0495669_0012362
638 Ga0495669_0024659
639 Ga0495669_0057847
640 Ga0495613_0057332
641 Ga0495613_0072531
642 Ga0495670_0034072
643 Ga0495670_0040399
644 Ga0495670_0051507
645 Ga0495670_0102681
646 Ga0495671_0001431
647 Ga0495671_0061672
648 Ga0495649_0000028
649 Ga0495649_0005510
650 Ga0495589_0000021
651 Ga0495589_0002782
652 Ga0495589_0004510
653 Ga0495589_0007001
654 Ga0495589_0007526
655 Ga0495589_0026169
656 Ga0495589_0066289
657 Ga0495600_0020308
658 Ga0495660_0000077
659 Ga0495660_0003463
660 Ga0495660_0032018
661 Ga0495660_0033303
662 Ga0495660_0073400
663 Ga0495660_0197803
664 Ga0495581_0009977
665 Ga0495604_0005207
666 Ga0495604_0312073
667 Ga0495672_0000055
668 Ga0495672_0003998
669 Ga0495672_0013123
670 Ga0495672_0038076
671 Ga0495676_0000017
672 Ga0495676_0145832
673 Ga0495680_0001614
674 Ga0495680_0021326
675 Ga0495683_0003271
676 Ga0495683_0003359
677 Ga0495683_0007591
678 Ga0495683_0019851
679 Ga0495687_000036
680 Ga0495687_000360
681 Ga0495687_004931
682 Ga0495675_0001986
683 Ga0495677_0000450
684 Ga0495677_0001772
685 Ga0495677_0001957
686 Ga0495677_0003530
687 Ga0495677_0010112
688 Ga0495677_0010700
689 Ga0495677_0017784
690 Ga0495677_0019372
691 Ga0495677_0055261
692 Ga0495679_004982
693 Ga0495679_008881
694 Ga0495679_009440
695 Ga0495679_046907
696 Ga0495685_005744
697 Ga0495685_014058
698 Ga0495681_0003087
699 Ga0495681_0003477
700 Ga0495681_0042713
701 Ga0495681_0064267
702 Ga0495681_0136815
703 Ga0495686_0003067
704 Ga0495686_0021634
705 Ga0495686_0083413
706 Ga0495593_0005623
707 Ga0495602_0029146
708 Ga0495614_0042104
709 Ga0495626_0000017
710 Ga0495626_0000624
711 Ga0495626_0002763
712 Ga0495626_0005310
713 Ga0495626_0029679
714 Ga0495626_0033471
715 Ga0495626_0035104
716 Ga0495626_0070697
717 Ga0495626_0075140
718 Ga0495626_0103755
719 Ga0496100_0061303
720 Ga0496102_0002955
721 Ga0496102_0234200
722 Ga0496102_0497966
723 Ga0496103_0181644
724 Ga0496106_0359039
725 Ga0496107_0047030
726 Ga0496108_0193731
727 Ga0496109_0039130
728 Ga0496110_0219952
729 Ga0496110_0244016
730 Ga0496112_0165554
731 Ga0496112_0359452
732 Ga0496113_0037914
733 Ga0496115_0057767
734 Ga0496121_0156914
735 Ga0496122_0000452
736 Ga0496122_0012683
737 Ga0496122_0069841
738 Ga0496123_0004472
739 Ga0496123_0004664
740 Ga0496123_0082086
741 Ga0496124_0014324
742 Ga0496124_0072535
743 Ga0496124_0083764
744 Ga0496124_0114613
745 Ga0496124_0115414
746 Ga0496124_0260954
747 Ga0496125_0005373
748 Ga0496125_0290657
749 Ga0495678_000025
750 Ga0495678_000041
751 Ga0495678_016777
752 Ga0495678_096310
753 Ga0495682_0031009
754 Ga0495682_0111357
755 Ga0466962_0058183
756 2643802865
757 2644472374
758 8047678528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k8h-assembly1.cif.gz_A crystal structure of an omega-transaminase from sphaerobacter thermophilus 0.5856 50 75
4amx-assembly2.cif.gz_B crystal structure of the gracilariopsis lemaneiformis alpha-1,4- glucan lyase covalent intermediate complex with 5-fluoro-glucosyl- fluoride 0.555 197 245
3vgd-assembly1.cif.gz_A ctystal structure of glycosyltrehalose trehalohydrolase (d252e) 0.5477 197 229
7kgz-assembly1.cif.gz_A fmn-binding beta-glucuronidase from roseburia hominis 0.5165 197 248
5occ-assembly1.cif.gz_A crystal structure of cd32b (fc gamma receptor iib) in complex with human igg1 fab fragment (6g08) 0.5161 197 247
ID Description Score Start End Superfamily
af_A0A1D6GU33_1_92_2.60.120.340 Mainly Beta;Sandwich;Jelly Rolls;Nucleoplasmin core domain 0.6364 73 139 2.60.120.340
af_A0A1D6K801_135_230_2.60.40.760 Mainly Beta;Sandwich;Immunoglobulin-like;Expansin, cellulose-binding-like domain 0.6189 197 246 2.60.40.760
af_Q7KMM4_789_923_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.5809 197 246 2.60.40.1180
af_Q55G98_168_314_3.30.1330.20 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Tubulin/FtsZ, C-terminal domain 0.5792 197 248 3.30.1330.20
af_A0A2R8QPJ6_526_662_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.564 199 228 2.60.40.10
ID Description Score Start End GO Terms
AF-B9TIC8-F1-model_v4 Uncharacterized protein 0.9419 46 260
AF-B9TIC8-F1-model_v4 Uncharacterized protein 0.9376 46 260
AF-A0A2U2HNF2-F1-model_v4 Uncharacterized protein 0.9022 53 246
AF-A0A7U5XYY7-F1-model_v4 Uncharacterized protein 0.8624 41 248
AF-A0A7X3G032-F1-model_v4 Uncharacterized protein 0.8544 24 260

Map