F429576

General Info

Members Datasets Scaffolds Average Seq Length
383 225 766 135

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10258523|Ga0114129_102585232
Length 142
Sequence LKEGTHMASTLKLEIVTPEATVYSEDVEMVTLPGVVGQMGVYPQHVPLMTQMAPGEIIVRKDGRDQFIASGEGLIEITADRVAVLTDLALAAERIDEAKAEEARLRAEARLREKLSDEELATVNASLARSLAQLYVKRRQRK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028010 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 2.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 6.53
Rhizosphere 92.43
Stem 0
Stem Tuber 0
Unclassified 16.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10258523 3300009147 Bacteria 2335
2 Ga0058860_11959990 3300004801 Unclassified 605
3 Ga0058862_12764186 3300004803 Bacteria 1009
4 Ga0065712_10068644 3300005290 Bacteria 9541
5 Ga0065715_11127572 3300005293 Unclassified 514
6 Ga0065707_10091923 3300005295 Bacteria 3855
7 Ga0070683_100000005 3300005329 Bacteria 361724
8 Ga0070683_101628654 3300005329 Bacteria 621
9 Ga0070690_100497487 3300005330 Unclassified 911
10 Ga0070670_100409657 3300005331 Bacteria 1198
11 Ga0070670_100820644 3300005331 Bacteria 840
12 Ga0070677_10039325 3300005333 Bacteria 1856
13 Ga0068869_100235127 3300005334 Bacteria 1458
14 Ga0070666_10038262 3300005335 Bacteria 3191
15 Ga0070680_100119602 3300005336 Bacteria 2198
16 Ga0070680_101036453 3300005336 Unclassified 709
17 Ga0070682_100567222 3300005337 Bacteria 891
18 Ga0068868_100278744 3300005338 Unclassified 1414
19 Ga0068868_100491104 3300005338 Bacteria 1074
20 Ga0070660_100175972 3300005339 Bacteria 1730
21 Ga0070689_100022419 3300005340 Bacteria 4714
22 Ga0070689_100419509 3300005340 Bacteria 1134
23 Ga0070691_10045964 3300005341 Bacteria 2073
24 Ga0070687_100651898 3300005343 Unclassified 730
25 Ga0070661_100019626 3300005344 Bacteria 4817
26 Ga0070661_100746843 3300005344 Unclassified 800
27 Ga0070692_10078695 3300005345 Bacteria 1771
28 Ga0070668_101101437 3300005347 Bacteria 717
29 Ga0070669_100023542 3300005353 Bacteria 4409
30 Ga0070669_100219392 3300005353 Bacteria 1503
31 Ga0070669_100314837 3300005353 Unclassified 1262
32 Ga0070669_100649762 3300005353 Bacteria 887
33 Ga0070675_100770584 3300005354 Bacteria 878
34 Ga0070675_100794503 3300005354 Bacteria 865
35 Ga0070675_101300230 3300005354 Bacteria 670
36 Ga0070671_100139227 3300005355 Bacteria 2047
37 Ga0070673_100141495 3300005364 Bacteria 2029
38 Ga0070673_100344464 3300005364 Unclassified 1321
39 Ga0070673_101538754 3300005364 Bacteria 628
40 Ga0070688_100066880 3300005365 Bacteria 2288
41 Ga0070688_100143312 3300005365 Unclassified 1626
42 Ga0070688_100508028 3300005365 Bacteria 910
43 Ga0070659_100002654 3300005366 Bacteria 12732
44 Ga0070659_100199465 3300005366 Bacteria 1647
45 Ga0070659_100370865 3300005366 Unclassified 1204
46 Ga0070659_100891402 3300005366 Bacteria 777
47 Ga0070701_10098143 3300005438 Unclassified 1617
48 Ga0070711_100801828 3300005439 Unclassified 799
49 Ga0070700_100195653 3300005441 Bacteria 1417
50 Ga0070700_100273030 3300005441 Unclassified 1222
51 Ga0070700_101354012 3300005441 Bacteria 600
52 Ga0070700_101473872 3300005441 Unclassified 578
53 Ga0070663_100082926 3300005455 Bacteria 2360
54 Ga0070663_100438827 3300005455 Bacteria 1074
55 Ga0070678_100103585 3300005456 Bacteria 2211
56 Ga0070662_100129948 3300005457 Bacteria 1941
57 Ga0070662_100665657 3300005457 Bacteria 879
58 Ga0070662_101147346 3300005457 Unclassified 667
59 Ga0068867_100151568 3300005459 Bacteria 1821
60 Ga0068867_100797525 3300005459 Bacteria 842
61 Ga0070685_10379912 3300005466 Unclassified 973
62 Ga0070699_101756429 3300005518 Unclassified 568
63 Ga0070679_100316541 3300005530 Bacteria 1510
64 Ga0070684_100000019 3300005535 Bacteria 135518
65 Ga0070684_100500691 3300005535 Bacteria 1125
66 Ga0070672_100005820 3300005543 Bacteria 8226
67 Ga0070672_101756922 3300005543 Unclassified 557
68 Ga0070695_100013198 3300005545 Bacteria 4963
69 Ga0070695_100050186 3300005545 Bacteria 2673
70 Ga0070693_100023495 3300005547 Bacteria 3296
71 Ga0070693_100254889 3300005547 Bacteria 1165
72 Ga0070665_100142712 3300005548 Bacteria 2398
73 Ga0070665_100338988 3300005548 Bacteria 1508
74 Ga0070704_100034733 3300005549 Bacteria 3422
75 Ga0068855_100066512 3300005563 Bacteria 4202
76 Ga0070664_100012201 3300005564 Bacteria 6982
77 Ga0070664_100013245 3300005564 Bacteria 6718
78 Ga0068857_100069734 3300005577 Bacteria 3130
79 Ga0068854_100060786 3300005578 Bacteria 2734
80 Ga0068854_100442501 3300005578 Unclassified 1084
81 Ga0068852_100099356 3300005616 Bacteria 2623
82 Ga0068859_100250410 3300005617 Bacteria 1862
83 Ga0068859_102170270 3300005617 Unclassified 613
84 Ga0068864_100151350 3300005618 Bacteria 2102
85 Ga0068864_100186135 3300005618 Bacteria 1901
86 Ga0068864_100833442 3300005618 Bacteria 908
87 Ga0068866_10137817 3300005718 Bacteria 1397
88 Ga0068861_100117292 3300005719 Bacteria 2142
89 Ga0068861_100202151 3300005719 Bacteria 1668
90 Ga0068861_100337987 3300005719 Bacteria 1317
91 Ga0068861_102123029 3300005719 Bacteria 562
92 Ga0068851_10049956 3300005834 Bacteria 2123
93 Ga0068851_10075075 3300005834 Bacteria 1756
94 Ga0068851_10346024 3300005834 Bacteria 864
95 Ga0068870_10637099 3300005840 Bacteria 729
96 Ga0068863_100345542 3300005841 Bacteria 1448
97 Ga0068863_100475111 3300005841 Unclassified 1229
98 Ga0068863_100966856 3300005841 Bacteria 853
99 Ga0068858_100362890 3300005842 Bacteria 1388
100 Ga0068858_101777504 3300005842 Bacteria 609
101 Ga0068862_100026572 3300005844 Bacteria 4866
102 Ga0068862_100072869 3300005844 Bacteria 2967
103 Ga0068862_100949423 3300005844 Bacteria 848
104 Ga0070717_10712350 3300006028 Bacteria 912
105 Ga0075363_100251624 3300006048 Bacteria 1017
106 Ga0070712_100108129 3300006175 Bacteria 2070
107 Ga0070712_100437960 3300006175 Bacteria 1086
108 Ga0075367_10021009 3300006178 Bacteria 3643
109 Ga0097621_101718909 3300006237 Unclassified 597
110 Ga0068871_100413205 3300006358 Unclassified 1204
111 Ga0075428_100034393 3300006844 Bacteria 5590
112 Ga0075428_100213639 3300006844 Bacteria 2084
113 Ga0075428_101145704 3300006844 Bacteria 821
114 Ga0075431_100006250 3300006847 Bacteria 11833
115 Ga0075431_100516652 3300006847 Bacteria 1184
116 Ga0075433_10010274 3300006852 Bacteria 7510
117 Ga0075433_11024279 3300006852 Bacteria 719
118 Ga0075434_100013985 3300006871 Bacteria 7659
119 Ga0075434_100060775 3300006871 Bacteria 3759
120 Ga0075434_100582718 3300006871 Bacteria 1138
121 Ga0075434_101194361 3300006871 Unclassified 773
122 Ga0068865_100254372 3300006881 Bacteria 1388
123 Ga0068865_100728323 3300006881 Unclassified 850
124 Ga0075436_101057775 3300006914 Bacteria 610
125 Ga0097620_100250435 3300006931 Bacteria 1862
126 Ga0097620_102170153 3300006931 Unclassified 613
127 Ga0075435_100001279 3300007076 Bacteria 16161
128 Ga0075435_100011605 3300007076 Bacteria 6492
129 Ga0075435_100061891 3300007076 Bacteria 3037
130 Ga0111539_10002858 3300009094 Bacteria 22935
131 Ga0111539_10016832 3300009094 Bacteria 9055
132 Ga0111539_10166014 3300009094 Bacteria 2581
133 Ga0111539_11481624 3300009094 Unclassified 787
134 Ga0114129_10013549 3300009147 Bacteria 11618
135 Ga0114129_10131407 3300009147 Bacteria 3438
136 Ga0114129_10916837 3300009147 Bacteria 1109
137 Ga0114129_12562513 3300009147 Bacteria 609
138 Ga0105243_10707976 3300009148 Bacteria 982
139 Ga0105243_11283146 3300009148 Bacteria 749
140 Ga0105242_10056437 3300009176 Bacteria 3213
141 Ga0105248_10040641 3300009177 Bacteria 5213
142 Ga0105248_10345317 3300009177 Bacteria 1676
143 Ga0105248_10545269 3300009177 Bacteria 1308
144 Ga0105248_11682615 3300009177 Bacteria 719
145 Ga0105248_12561718 3300009177 Bacteria 581
146 Ga0105237_10007710 3300009545 Bacteria 11757
147 Ga0105238_10019358 3300009551 Bacteria 6932
148 Ga0105249_10011300 3300009553 Bacteria 7838
149 Ga0105249_10498639 3300009553 Bacteria 1262
150 Ga0105249_10836558 3300009553 Bacteria 985
151 Ga0105239_10760364 3300010375 Bacteria 1109
152 Ga0105246_10163269 3300011119 Bacteria 1699
153 Ga0157370_10453680 3300013104 Unclassified 1179
154 Ga0157369_10054242 3300013105 Unclassified 4329
155 Ga0157374_10013083 3300013296 Bacteria 7237
156 Ga0157374_10025975 3300013296 Bacteria 5265
157 Ga0157378_10024666 3300013297 Bacteria 5295
158 Ga0157378_10185282 3300013297 Bacteria 1960
159 Ga0157378_10474531 3300013297 Unclassified 1245
160 Ga0163162_10146617 3300013306 Bacteria 2477
161 Ga0163162_10512491 3300013306 Bacteria 1329
162 Ga0157372_10092353 3300013307 Bacteria 3443
163 Ga0157372_10895915 3300013307 Bacteria 1029
164 Ga0157372_11155979 3300013307 Unclassified 895
165 Ga0157375_10180937 3300013308 Bacteria 2259
166 Ga0157375_11635034 3300013308 Unclassified 762
167 Ga0157375_11741624 3300013308 Bacteria 738
168 Ga0163163_10000098 3300014325 Bacteria 91630
169 Ga0163163_10134484 3300014325 Bacteria 2513
170 Ga0163163_10849171 3300014325 Bacteria 976
171 Ga0182008_10007852 3300014497 Bacteria 5862
172 Ga0157377_10578501 3300014745 Bacteria 798
173 Ga0182006_1012026 3300015261 Bacteria 3791
174 Ga0182007_10002114 3300015262 Bacteria 10162
175 Ga0182005_1031667 3300015265 Bacteria 1441
176 Ga0163161_10822706 3300017792 Bacteria 782
177 Ga0206352_10624549 3300020078 Bacteria 1151
178 Ga0228598_1050925 3300024227 Unclassified 821
179 Ga0207697_10032764 3300025315 Bacteria 2127
180 Ga0207697_10119670 3300025315 Bacteria 1132
181 Ga0207682_10095675 3300025893 Bacteria 1293
182 Ga0207688_10009189 3300025901 Bacteria 5384
183 Ga0207647_10038474 3300025904 Bacteria 3024
184 Ga0207645_10256170 3300025907 Bacteria 1158
185 Ga0207684_10780863 3300025910 Unclassified 808
186 Ga0207707_10145528 3300025912 Bacteria 2072
187 Ga0207695_10300534 3300025913 Bacteria 1496
188 Ga0207671_10033844 3300025914 Bacteria 3800
189 Ga0207693_10160670 3300025915 Bacteria 1767
190 Ga0207693_10222233 3300025915 Bacteria 1484
191 Ga0207663_10123889 3300025916 Bacteria 1774
192 Ga0207663_10996659 3300025916 Unclassified 672
193 Ga0207660_10704875 3300025917 Unclassified 823
194 Ga0207662_10036014 3300025918 Bacteria 2892
195 Ga0207662_10534168 3300025918 Bacteria 811
196 Ga0207657_10079302 3300025919 Bacteria 2763
197 Ga0207649_10079845 3300025920 Bacteria 2114
198 Ga0207652_10378540 3300025921 Bacteria 1278
199 Ga0207681_10016953 3300025923 Bacteria 4568
200 Ga0207694_10085094 3300025924 Bacteria 2488
201 Ga0207650_10314438 3300025925 Bacteria 1282
202 Ga0207659_10307605 3300025926 Bacteria 1304
203 Ga0207644_10048399 3300025931 Bacteria 3039
204 Ga0207644_10183729 3300025931 Bacteria 1640
205 Ga0207706_10096517 3300025933 Bacteria 2599
206 Ga0207706_10254264 3300025933 Bacteria 1534
207 Ga0207686_10017931 3300025934 Bacteria 3999
208 Ga0207709_10313275 3300025935 Bacteria 1172
209 Ga0207709_10759099 3300025935 Bacteria 780
210 Ga0207670_10314419 3300025936 Bacteria 1231
211 Ga0207670_11107253 3300025936 Bacteria 669
212 Ga0207669_10339076 3300025937 Unclassified 1157
213 Ga0207704_10127384 3300025938 Bacteria 1756
214 Ga0207704_10162909 3300025938 Bacteria 1589
215 Ga0207691_10033388 3300025940 Bacteria 4791
216 Ga0207691_10095654 3300025940 Bacteria 2656
217 Ga0207711_10082039 3300025941 Bacteria 2818
218 Ga0207711_11205030 3300025941 Bacteria 699
219 Ga0207689_10020725 3300025942 Bacteria 5527
220 Ga0207661_10000024 3300025944 Bacteria 197376
221 Ga0207661_10754036 3300025944 Bacteria 896
222 Ga0207651_10219752 3300025960 Bacteria 1535
223 Ga0207712_10004466 3300025961 Bacteria 8832
224 Ga0207712_10270718 3300025961 Bacteria 1381
225 Ga0207712_10328633 3300025961 Unclassified 1264
226 Ga0207668_10978677 3300025972 Bacteria 755
227 Ga0207640_10081178 3300025981 Bacteria 2216
228 Ga0207640_10595062 3300025981 Unclassified 935
229 Ga0207677_10128400 3300026023 Bacteria 1920
230 Ga0207677_11557583 3300026023 Bacteria 611
231 Ga0207639_10328745 3300026041 Bacteria 1359
232 Ga0207678_10253301 3300026067 Bacteria 1508
233 Ga0207708_10008960 3300026075 Bacteria 7404
234 Ga0207708_10353166 3300026075 Bacteria 1207
235 Ga0207708_11968345 3300026075 Unclassified 512
236 Ga0207702_10251768 3300026078 Bacteria 1659
237 Ga0207641_10298888 3300026088 Bacteria 1520
238 Ga0207641_10557460 3300026088 Bacteria 1118
239 Ga0207641_11649515 3300026088 Unclassified 643
240 Ga0207648_10172297 3300026089 Bacteria 1913
241 Ga0207676_10135248 3300026095 Bacteria 2102
242 Ga0207676_10320934 3300026095 Unclassified 1422
243 Ga0207676_10466025 3300026095 Bacteria 1194
244 Ga0207676_10807058 3300026095 Bacteria 916
245 Ga0207674_10190209 3300026116 Bacteria 2002
246 Ga0207675_100084942 3300026118 Bacteria 2970
247 Ga0207675_101845378 3300026118 Unclassified 623
248 Ga0207683_10047268 3300026121 Bacteria 3769
249 Ga0207683_10057282 3300026121 Bacteria 3421
250 Ga0207428_10001884 3300027907 Bacteria 21336
251 Ga0207428_10050599 3300027907 Bacteria 3324
252 Ga0265358_104305 3300028010 Unclassified 538
253 Ga0268266_10072553 3300028379 Bacteria 2986
254 Ga0268266_10455172 3300028379 Bacteria 1217
255 Ga0268265_10055811 3300028380 Bacteria 3003
256 Ga0268265_10419388 3300028380 Bacteria 1242
257 Ga0307408_100481455 3300031548 Bacteria 1083
258 Ga0373951_0047865 3300035091 Bacteria 1046
259 Ga0373952_0069983 3300035092 Bacteria 876
260 Ga0373941_0065823 3300035115 Unclassified 1191
261 Ga0373962_0033967 3300035242 Bacteria 1410
262 Ga0373947_0530526 3300035725 Bacteria 801
263 Ga0373937_0453351 3300036401 Bacteria 1218
264 Ga0373937_0531756 3300036401 Unclassified 1117
265 Ga0451576_0422707 3300045051 Bacteria 1398
266 Ga0451576_1430553 3300045051 Unclassified 719
267 Ga0451576_2320621 3300045051 Unclassified 550
268 Ga0495603_0123489 3300046455 Bacteria 1509
269 Ga0495629_0394838 3300046459 Unclassified 940
270 Ga0495641_0045782 3300046461 Bacteria 2013
271 Ga0495580_0078684 3300046472 Bacteria 2300
272 Ga0495580_0259099 3300046472 Bacteria 1189
273 Ga0495582_0010969 3300046473 Bacteria 4987
274 Ga0495582_0113047 3300046473 Bacteria 1526
275 Ga0495582_0352464 3300046473 Bacteria 848
276 Ga0495662_0208015 3300046476 Bacteria 964
277 Ga0495664_0035214 3300046477 Bacteria 2947
278 Ga0495594_0063175 3300046499 Bacteria 2051
279 Ga0495594_0086610 3300046499 Bacteria 1753
280 Ga0495608_0243538 3300046511 Bacteria 1123
281 Ga0495618_0112954 3300046514 Bacteria 1739
282 Ga0495628_0085006 3300046516 Bacteria 2455
283 Ga0495630_0000041 3300046517 Bacteria 104947
284 Ga0495630_0619850 3300046517 Bacteria 829
285 Ga0495663_0187799 3300046525 Bacteria 718
286 Ga0495666_0000977 3300046526 Bacteria 13498
287 Ga0495666_0564180 3300046526 Bacteria 507
288 Ga0495642_0192687 3300046528 Bacteria 888
289 Ga0495665_0135481 3300046531 Bacteria 1288
290 Ga0495640_0004958 3300046533 Bacteria 10573
291 Ga0495586_0000063 3300046535 Bacteria 65704
292 Ga0495645_0171972 3300046543 Bacteria 1491
293 Ga0495645_0547943 3300046543 Bacteria 717
294 Ga0495645_0655600 3300046543 Bacteria 641
295 Ga0495622_0032983 3300046557 Bacteria 2418
296 Ga0495667_0300900 3300046559 Bacteria 1016
297 Ga0495634_0010481 3300046642 Bacteria 6788
298 Ga0495634_0013403 3300046642 Bacteria 5923
299 Ga0495635_0024475 3300046663 Bacteria 4208
300 Ga0495659_0079012 3300046664 Unclassified 1246
301 Ga0495599_0051725 3300046678 Bacteria 2574
302 Ga0495599_0496937 3300046678 Bacteria 718
303 Ga0495646_0002870 3300046680 Bacteria 10669
304 Ga0495613_0094476 3300046689 Bacteria 2163
305 Ga0495624_0336574 3300046690 Bacteria 908
306 Ga0495581_0044569 3300047315 Bacteria 2565
307 Ga0495581_0062975 3300047315 Bacteria 2143
308 Ga0495604_0207386 3300047317 Bacteria 1356
309 Ga0495674_0028146 3300047319 Bacteria 5129
310 Ga0495674_0029186 3300047319 Bacteria 5025
311 Ga0495674_0164211 3300047319 Bacteria 1857
312 Ga0495676_0009848 3300047321 Bacteria 8683
313 Ga0495676_0267772 3300047321 Bacteria 1160
314 Ga0495675_0094054 3300047444 Bacteria 1880
315 Ga0495684_0092553 3300047471 Bacteria 2290
316 Ga0495684_0421991 3300047471 Bacteria 932
317 Ga0495684_0428584 3300047471 Bacteria 923
318 Ga0495684_0545895 3300047471 Bacteria 790
319 Ga0495684_0673080 3300047471 Unclassified 689
320 Ga0495614_0036530 3300048089 Bacteria 2109
321 Ga0496100_0057096 3300048903 Bacteria 2556
322 Ga0496100_0128454 3300048903 Bacteria 1782
323 Ga0496100_0714591 3300048903 Bacteria 782
324 Ga0496102_0032110 3300048905 Bacteria 4716
325 Ga0496102_0109459 3300048905 Bacteria 2574
326 Ga0496103_0137744 3300048906 Bacteria 1560
327 Ga0496103_0197752 3300048906 Bacteria 1293
328 Ga0496104_0012693 3300048907 Bacteria 7587
329 Ga0496104_0209530 3300048907 Bacteria 1861
330 Ga0496104_0660718 3300048907 Bacteria 954
331 Ga0496106_0247034 3300048909 Unclassified 1426
332 Ga0496107_0102501 3300048910 Bacteria 2099
333 Ga0496108_0461205 3300048911 Bacteria 1110
334 Ga0496109_0156435 3300048912 Bacteria 2135
335 Ga0496110_0027638 3300048913 Bacteria 4864
336 Ga0496110_0219623 3300048913 Bacteria 1728
337 Ga0496110_0320789 3300048913 Bacteria 1411
338 Ga0496110_1130468 3300048913 Bacteria 692
339 Ga0496111_0002693 3300048914 Bacteria 10790
340 Ga0496111_0312635 3300048914 Bacteria 1164
341 Ga0496112_1144859 3300048915 Unclassified 695
342 Ga0496113_0088872 3300048916 Bacteria 2377
343 Ga0496113_0240229 3300048916 Bacteria 1445
344 Ga0496113_0735880 3300048916 Bacteria 786
345 Ga0496113_1133834 3300048916 Unclassified 612
346 Ga0501041_0279342 3300049577 Bacteria 1051
347 Ga0501048_1391582 3300049582 Unclassified 504
348 Ga0501072_0754757 3300049588 Bacteria 763
349 Ga0501075_1035358 3300049591 Bacteria 623
350 Ga0501045_0419644 3300049824 Bacteria 995
351 nmdc:mga06z11_12327_c1 3300050494 Bacteria 3716
352 nmdc:mga05p37_124756_c1 3300050507 Bacteria 3162
353 nmdc:mga05p37_1712133_c1 3300050507 Bacteria 612
354 nmdc:mga05p37_189857_c1 3300050507 Unclassified 2495
355 nmdc:mga05p37_231872_c1 3300050507 Bacteria 2224
356 nmdc:mga05p37_9522_c1 3300050507 Bacteria 11501
357 nmdc:mga09592_162370_c1 3300050508 Bacteria 1930
358 nmdc:mga09592_333956_c1 3300050508 Bacteria 1312
359 nmdc:mga0qj67_55946_c1 3300050509 Bacteria 3126
360 nmdc:mga06r32_58180_c1 3300050510 Bacteria 3715
361 nmdc:mga06r32_96424_c1 3300050510 Bacteria 2896
362 nmdc:mga08y16_2448_c1 3300050511 Bacteria 19064
363 nmdc:mga08y16_25006_c1 3300050511 Bacteria 6300
364 nmdc:mga0n895_56055_c1 3300050512 Bacteria 3881
365 nmdc:mga0n895_61589_c1 3300050512 Bacteria 3705
366 nmdc:mga0n895_61894_c1 3300050512 Bacteria 3697
367 nmdc:mga0rr50_1781787_c1 3300050513 Archaea 518
368 nmdc:mga0rr50_18532_c1 3300050513 Bacteria 4678
369 nmdc:mga0rr50_45421_c1 3300050513 Bacteria 3228
370 nmdc:mga0rr50_54823_c1 3300050513 Bacteria 2972
371 nmdc:mga08x19_1133892_c1 3300050514 Unclassified 555
372 nmdc:mga0a205_22056_c1 3300050515 Bacteria 6027
373 nmdc:mga0a205_50750_c1 3300050515 Bacteria 4005
374 Ga0495601_0928352 3300053077 Bacteria 549
375 Ga0501084_0323176 3300054114 Bacteria 1303
376 Ga0587091_036825 3300059511 Unclassified 946
377 Ga0587069_015944 3300059642 Bacteria 1068
378 Ga0587075_063619 3300059644 Unclassified 671
379 Ga0587078_013239 3300059646 Bacteria 975
380 Ga0587071_017989 3300060344 Unclassified 1266
381 Ga0530510_0060453 3300061734 Bacteria 2742
382 Ga0530510_0196199 3300061734 Bacteria 1499
383 Ga0530510_1313621 3300061734 Unclassified 555
384 Ga0114129_10258523
385 Ga0058860_11959990
386 Ga0058862_12764186
387 Ga0065712_10068644
388 Ga0065715_11127572
389 Ga0065707_10091923
390 Ga0070683_100000005
391 Ga0070683_101628654
392 Ga0070690_100497487
393 Ga0070670_100409657
394 Ga0070670_100820644
395 Ga0070677_10039325
396 Ga0068869_100235127
397 Ga0070666_10038262
398 Ga0070680_100119602
399 Ga0070680_101036453
400 Ga0070682_100567222
401 Ga0068868_100278744
402 Ga0068868_100491104
403 Ga0070660_100175972
404 Ga0070689_100022419
405 Ga0070689_100419509
406 Ga0070691_10045964
407 Ga0070687_100651898
408 Ga0070661_100019626
409 Ga0070661_100746843
410 Ga0070692_10078695
411 Ga0070668_101101437
412 Ga0070669_100023542
413 Ga0070669_100219392
414 Ga0070669_100314837
415 Ga0070669_100649762
416 Ga0070675_100770584
417 Ga0070675_100794503
418 Ga0070675_101300230
419 Ga0070671_100139227
420 Ga0070673_100141495
421 Ga0070673_100344464
422 Ga0070673_101538754
423 Ga0070688_100066880
424 Ga0070688_100143312
425 Ga0070688_100508028
426 Ga0070659_100002654
427 Ga0070659_100199465
428 Ga0070659_100370865
429 Ga0070659_100891402
430 Ga0070701_10098143
431 Ga0070711_100801828
432 Ga0070700_100195653
433 Ga0070700_100273030
434 Ga0070700_101354012
435 Ga0070700_101473872
436 Ga0070663_100082926
437 Ga0070663_100438827
438 Ga0070678_100103585
439 Ga0070662_100129948
440 Ga0070662_100665657
441 Ga0070662_101147346
442 Ga0068867_100151568
443 Ga0068867_100797525
444 Ga0070685_10379912
445 Ga0070699_101756429
446 Ga0070679_100316541
447 Ga0070684_100000019
448 Ga0070684_100500691
449 Ga0070672_100005820
450 Ga0070672_101756922
451 Ga0070695_100013198
452 Ga0070695_100050186
453 Ga0070693_100023495
454 Ga0070693_100254889
455 Ga0070665_100142712
456 Ga0070665_100338988
457 Ga0070704_100034733
458 Ga0068855_100066512
459 Ga0070664_100012201
460 Ga0070664_100013245
461 Ga0068857_100069734
462 Ga0068854_100060786
463 Ga0068854_100442501
464 Ga0068852_100099356
465 Ga0068859_100250410
466 Ga0068859_102170270
467 Ga0068864_100151350
468 Ga0068864_100186135
469 Ga0068864_100833442
470 Ga0068866_10137817
471 Ga0068861_100117292
472 Ga0068861_100202151
473 Ga0068861_100337987
474 Ga0068861_102123029
475 Ga0068851_10049956
476 Ga0068851_10075075
477 Ga0068851_10346024
478 Ga0068870_10637099
479 Ga0068863_100345542
480 Ga0068863_100475111
481 Ga0068863_100966856
482 Ga0068858_100362890
483 Ga0068858_101777504
484 Ga0068862_100026572
485 Ga0068862_100072869
486 Ga0068862_100949423
487 Ga0070717_10712350
488 Ga0075363_100251624
489 Ga0070712_100108129
490 Ga0070712_100437960
491 Ga0075367_10021009
492 Ga0097621_101718909
493 Ga0068871_100413205
494 Ga0075428_100034393
495 Ga0075428_100213639
496 Ga0075428_101145704
497 Ga0075431_100006250
498 Ga0075431_100516652
499 Ga0075433_10010274
500 Ga0075433_11024279
501 Ga0075434_100013985
502 Ga0075434_100060775
503 Ga0075434_100582718
504 Ga0075434_101194361
505 Ga0068865_100254372
506 Ga0068865_100728323
507 Ga0075436_101057775
508 Ga0097620_100250435
509 Ga0097620_102170153
510 Ga0075435_100001279
511 Ga0075435_100011605
512 Ga0075435_100061891
513 Ga0111539_10002858
514 Ga0111539_10016832
515 Ga0111539_10166014
516 Ga0111539_11481624
517 Ga0114129_10013549
518 Ga0114129_10131407
519 Ga0114129_10916837
520 Ga0114129_12562513
521 Ga0105243_10707976
522 Ga0105243_11283146
523 Ga0105242_10056437
524 Ga0105248_10040641
525 Ga0105248_10345317
526 Ga0105248_10545269
527 Ga0105248_11682615
528 Ga0105248_12561718
529 Ga0105237_10007710
530 Ga0105238_10019358
531 Ga0105249_10011300
532 Ga0105249_10498639
533 Ga0105249_10836558
534 Ga0105239_10760364
535 Ga0105246_10163269
536 Ga0157370_10453680
537 Ga0157369_10054242
538 Ga0157374_10013083
539 Ga0157374_10025975
540 Ga0157378_10024666
541 Ga0157378_10185282
542 Ga0157378_10474531
543 Ga0163162_10146617
544 Ga0163162_10512491
545 Ga0157372_10092353
546 Ga0157372_10895915
547 Ga0157372_11155979
548 Ga0157375_10180937
549 Ga0157375_11635034
550 Ga0157375_11741624
551 Ga0163163_10000098
552 Ga0163163_10134484
553 Ga0163163_10849171
554 Ga0182008_10007852
555 Ga0157377_10578501
556 Ga0182006_1012026
557 Ga0182007_10002114
558 Ga0182005_1031667
559 Ga0163161_10822706
560 Ga0206352_10624549
561 Ga0228598_1050925
562 Ga0207697_10032764
563 Ga0207697_10119670
564 Ga0207682_10095675
565 Ga0207688_10009189
566 Ga0207647_10038474
567 Ga0207645_10256170
568 Ga0207684_10780863
569 Ga0207707_10145528
570 Ga0207695_10300534
571 Ga0207671_10033844
572 Ga0207693_10160670
573 Ga0207693_10222233
574 Ga0207663_10123889
575 Ga0207663_10996659
576 Ga0207660_10704875
577 Ga0207662_10036014
578 Ga0207662_10534168
579 Ga0207657_10079302
580 Ga0207649_10079845
581 Ga0207652_10378540
582 Ga0207681_10016953
583 Ga0207694_10085094
584 Ga0207650_10314438
585 Ga0207659_10307605
586 Ga0207644_10048399
587 Ga0207644_10183729
588 Ga0207706_10096517
589 Ga0207706_10254264
590 Ga0207686_10017931
591 Ga0207709_10313275
592 Ga0207709_10759099
593 Ga0207670_10314419
594 Ga0207670_11107253
595 Ga0207669_10339076
596 Ga0207704_10127384
597 Ga0207704_10162909
598 Ga0207691_10033388
599 Ga0207691_10095654
600 Ga0207711_10082039
601 Ga0207711_11205030
602 Ga0207689_10020725
603 Ga0207661_10000024
604 Ga0207661_10754036
605 Ga0207651_10219752
606 Ga0207712_10004466
607 Ga0207712_10270718
608 Ga0207712_10328633
609 Ga0207668_10978677
610 Ga0207640_10081178
611 Ga0207640_10595062
612 Ga0207677_10128400
613 Ga0207677_11557583
614 Ga0207639_10328745
615 Ga0207678_10253301
616 Ga0207708_10008960
617 Ga0207708_10353166
618 Ga0207708_11968345
619 Ga0207702_10251768
620 Ga0207641_10298888
621 Ga0207641_10557460
622 Ga0207641_11649515
623 Ga0207648_10172297
624 Ga0207676_10135248
625 Ga0207676_10320934
626 Ga0207676_10466025
627 Ga0207676_10807058
628 Ga0207674_10190209
629 Ga0207675_100084942
630 Ga0207675_101845378
631 Ga0207683_10047268
632 Ga0207683_10057282
633 Ga0207428_10001884
634 Ga0207428_10050599
635 Ga0265358_104305
636 Ga0268266_10072553
637 Ga0268266_10455172
638 Ga0268265_10055811
639 Ga0268265_10419388
640 Ga0307408_100481455
641 Ga0373951_0047865
642 Ga0373952_0069983
643 Ga0373941_0065823
644 Ga0373962_0033967
645 Ga0373947_0530526
646 Ga0373937_0453351
647 Ga0373937_0531756
648 Ga0451576_0422707
649 Ga0451576_1430553
650 Ga0451576_2320621
651 Ga0495603_0123489
652 Ga0495629_0394838
653 Ga0495641_0045782
654 Ga0495580_0078684
655 Ga0495580_0259099
656 Ga0495582_0010969
657 Ga0495582_0113047
658 Ga0495582_0352464
659 Ga0495662_0208015
660 Ga0495664_0035214
661 Ga0495594_0063175
662 Ga0495594_0086610
663 Ga0495608_0243538
664 Ga0495618_0112954
665 Ga0495628_0085006
666 Ga0495630_0000041
667 Ga0495630_0619850
668 Ga0495663_0187799
669 Ga0495666_0000977
670 Ga0495666_0564180
671 Ga0495642_0192687
672 Ga0495665_0135481
673 Ga0495640_0004958
674 Ga0495586_0000063
675 Ga0495645_0171972
676 Ga0495645_0547943
677 Ga0495645_0655600
678 Ga0495622_0032983
679 Ga0495667_0300900
680 Ga0495634_0010481
681 Ga0495634_0013403
682 Ga0495635_0024475
683 Ga0495659_0079012
684 Ga0495599_0051725
685 Ga0495599_0496937
686 Ga0495646_0002870
687 Ga0495613_0094476
688 Ga0495624_0336574
689 Ga0495581_0044569
690 Ga0495581_0062975
691 Ga0495604_0207386
692 Ga0495674_0028146
693 Ga0495674_0029186
694 Ga0495674_0164211
695 Ga0495676_0009848
696 Ga0495676_0267772
697 Ga0495675_0094054
698 Ga0495684_0092553
699 Ga0495684_0421991
700 Ga0495684_0428584
701 Ga0495684_0545895
702 Ga0495684_0673080
703 Ga0495614_0036530
704 Ga0496100_0057096
705 Ga0496100_0128454
706 Ga0496100_0714591
707 Ga0496102_0032110
708 Ga0496102_0109459
709 Ga0496103_0137744
710 Ga0496103_0197752
711 Ga0496104_0012693
712 Ga0496104_0209530
713 Ga0496104_0660718
714 Ga0496106_0247034
715 Ga0496107_0102501
716 Ga0496108_0461205
717 Ga0496109_0156435
718 Ga0496110_0027638
719 Ga0496110_0219623
720 Ga0496110_0320789
721 Ga0496110_1130468
722 Ga0496111_0002693
723 Ga0496111_0312635
724 Ga0496112_1144859
725 Ga0496113_0088872
726 Ga0496113_0240229
727 Ga0496113_0735880
728 Ga0496113_1133834
729 Ga0501041_0279342
730 Ga0501048_1391582
731 Ga0501072_0754757
732 Ga0501075_1035358
733 Ga0501045_0419644
734 nmdc:mga06z11_12327_c1
735 nmdc:mga05p37_124756_c1
736 nmdc:mga05p37_1712133_c1
737 nmdc:mga05p37_189857_c1
738 nmdc:mga05p37_231872_c1
739 nmdc:mga05p37_9522_c1
740 nmdc:mga09592_162370_c1
741 nmdc:mga09592_333956_c1
742 nmdc:mga0qj67_55946_c1
743 nmdc:mga06r32_58180_c1
744 nmdc:mga06r32_96424_c1
745 nmdc:mga08y16_2448_c1
746 nmdc:mga08y16_25006_c1
747 nmdc:mga0n895_56055_c1
748 nmdc:mga0n895_61589_c1
749 nmdc:mga0n895_61894_c1
750 nmdc:mga0rr50_1781787_c1
751 nmdc:mga0rr50_18532_c1
752 nmdc:mga0rr50_45421_c1
753 nmdc:mga0rr50_54823_c1
754 nmdc:mga08x19_1133892_c1
755 nmdc:mga0a205_22056_c1
756 nmdc:mga0a205_50750_c1
757 Ga0495601_0928352
758 Ga0501084_0323176
759 Ga0587091_036825
760 Ga0587069_015944
761 Ga0587075_063619
762 Ga0587078_013239
763 Ga0587071_017989
764 Ga0530510_0060453
765 Ga0530510_0196199
766 Ga0530510_1313621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

11

89

0.98

PF00401

ATP-synt_DE

ATP synthase, Delta/Epsilon chain, long alpha-helix domain

93

138

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mtx-assembly2.cif.gz_C structure of the ers1 dimerization and histidine phosphotransfer domain from arabidopsis thaliana 0.9421 91 132
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9357 10 80
7y6c-assembly2.cif.gz_D crystal structure of the esce/esag/esah complex 0.9244 91 133
5hkk-assembly2.cif.gz_P caldalaklibacillus thermarum f1-atpase (wild type) 0.9215 4 133
5ik2-assembly1.cif.gz_H caldalaklibacillus thermarum f1-atpase (epsilon mutant) 0.9186 4 133
ID Description Score Start End Superfamily
af_Q2FWF1_1_89_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.974 3 89 2.60.15.10
2e5yB01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9689 3 89 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9652 4 89 2.60.15.10
af_A0A0R0KXY9_13_77_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9618 26 89 2.60.15.10
2v7qH02 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.9569 90 129 1.20.5.440
ID Description Score Start End GO Terms
AF-A0A521ZZ40-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9953 3 136 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-A0A2D9MY76-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9898 1 134 GO:0005524
GO:0005886
GO:0012505
GO:0045261
GO:0046933
AF-A0A4Y6GTC7-F1-model_v4 ATP synthase CF1 epsilon subunit 0.9884 4 90 GO:0009536
GO:0045261
GO:0046933
AF-A0A6L7WQJ0-F1-model_v4 F0F1 ATP synthase subunit epsilon 0.9875 3 75 GO:0012505
GO:0045261
GO:0046933
AF-A0A7W0NUT7-F1-model_v4 ATP synthase F1 subunit epsilon 0.9854 5 81 GO:0012505
GO:0045261
GO:0046933

Map