F429527

General Info

Members Datasets Scaffolds Average Seq Length
383 299 766 137

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100634780|Ga0068856_1006347802
Length 169
Sequence MSPAGRHGRAAHGDVASTARVPSTDPDNATKEHPVASRLNPYISFSDNARQAMEFYKEVFGGTLTLSTFGEFGASDSPDSDKIMHAMLETESGYTLMGADTPSGMQRTPGDTVTISISGDDGDQLREYFGRLSDGGTVAMPLEKQMWGDEFGMCVDRFGVSWMVDIVSS

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
93 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
179 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
295 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.04
Metatranscriptomes 4.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 3.13
Rhizosphere 95.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100634780 3300005614 Bacteria 1089
2 JGI24735J21928_10219680 3300002067 Bacteria 552
3 JGI25407J50210_10015283 3300003373 Bacteria 1982
4 Ga0058863_11946461 3300004799 Bacteria 646
5 Ga0058861_11777050 3300004800 Bacteria 572
6 Ga0070658_10115205 3300005327 Bacteria 2229
7 Ga0070676_10142807 3300005328 Bacteria 1526
8 Ga0070683_100140923 3300005329 Bacteria 2284
9 Ga0070690_100157269 3300005330 Bacteria 1555
10 Ga0068869_100095725 3300005334 Bacteria 2240
11 Ga0070666_10202286 3300005335 Bacteria 1397
12 Ga0070680_100052508 3300005336 Bacteria 3327
13 Ga0070680_100262334 3300005336 Bacteria 1461
14 Ga0070682_100224029 3300005337 Bacteria 1340
15 Ga0070660_100026382 3300005339 Bacteria 4325
16 Ga0070660_100345631 3300005339 Bacteria 1224
17 Ga0070689_100102169 3300005340 Bacteria 2270
18 Ga0070691_10029319 3300005341 Bacteria 2573
19 Ga0070687_100289395 3300005343 Bacteria 1035
20 Ga0070661_100044719 3300005344 Bacteria 3235
21 Ga0070675_100082911 3300005354 Bacteria 2675
22 Ga0070671_100036392 3300005355 Bacteria 4082
23 Ga0070674_100781423 3300005356 Bacteria 823
24 Ga0070674_101195065 3300005356 Bacteria 675
25 Ga0070673_100004651 3300005364 Bacteria 8709
26 Ga0070688_100764173 3300005365 Bacteria 753
27 Ga0070659_100258541 3300005366 Bacteria 1444
28 Ga0070667_100967755 3300005367 Bacteria 793
29 Ga0070703_10036735 3300005406 Bacteria 1507
30 Ga0070709_10010738 3300005434 Bacteria 5082
31 Ga0070709_10013308 3300005434 Bacteria 4621
32 Ga0070714_100000898 3300005435 Bacteria 21103
33 Ga0070714_100040164 3300005435 Bacteria 3943
34 Ga0070714_100583452 3300005435 Bacteria 1072
35 Ga0070714_101441083 3300005435 Bacteria 672
36 Ga0070713_100113826 3300005436 Bacteria 2362
37 Ga0070710_10010839 3300005437 Bacteria 4486
38 Ga0070710_10301187 3300005437 Bacteria 1046
39 Ga0070701_10101850 3300005438 Bacteria 1592
40 Ga0070711_100141359 3300005439 Bacteria 1805
41 Ga0070705_100116020 3300005440 Bacteria 1720
42 Ga0070700_101030483 3300005441 Bacteria 678
43 Ga0070708_100038971 3300005445 Bacteria 4155
44 Ga0070663_100007562 3300005455 Bacteria 6624
45 Ga0070663_100144335 3300005455 Bacteria 1820
46 Ga0070678_100109141 3300005456 Bacteria 2161
47 Ga0070662_100041150 3300005457 Bacteria 3295
48 Ga0070662_100168775 3300005457 Bacteria 1717
49 Ga0070681_10099348 3300005458 Bacteria 2856
50 Ga0070681_10337181 3300005458 Bacteria 1417
51 Ga0070685_10012229 3300005466 Bacteria 4505
52 Ga0070685_10190612 3300005466 Bacteria 1326
53 Ga0070706_100265654 3300005467 Bacteria 1601
54 Ga0070706_100980652 3300005467 Bacteria 779
55 Ga0070707_100824566 3300005468 Bacteria 891
56 Ga0070698_100064799 3300005471 Bacteria 3680
57 Ga0070699_100001238 3300005518 Bacteria 23538
58 Ga0070679_100190424 3300005530 Bacteria 2021
59 Ga0070679_100587798 3300005530 Bacteria 1057
60 Ga0070684_100045775 3300005535 Bacteria 3789
61 Ga0070684_100865360 3300005535 Bacteria 846
62 Ga0070697_100692817 3300005536 Bacteria 899
63 Ga0068853_100097078 3300005539 Bacteria 2600
64 Ga0070695_100549719 3300005545 Bacteria 900
65 Ga0070696_100014293 3300005546 Bacteria 5325
66 Ga0070693_100017483 3300005547 Bacteria 3728
67 Ga0070665_100536921 3300005548 Bacteria 1181
68 Ga0070704_101527519 3300005549 Bacteria 614
69 Ga0070664_100030669 3300005564 Bacteria 4487
70 Ga0070664_100293834 3300005564 Bacteria 1467
71 Ga0068857_100142158 3300005577 Bacteria 2169
72 Ga0068854_100085935 3300005578 Bacteria 2330
73 Ga0070702_100057592 3300005615 Bacteria 2248
74 Ga0068852_100733865 3300005616 Bacteria 999
75 Ga0068859_100282195 3300005617 Bacteria 1754
76 Ga0068861_101797776 3300005719 Bacteria 608
77 Ga0068851_10426151 3300005834 Bacteria 784
78 Ga0068870_10243408 3300005840 Bacteria 1111
79 Ga0068858_100173491 3300005842 Bacteria 2034
80 Ga0068860_100107736 3300005843 Bacteria 2663
81 Ga0068860_100711541 3300005843 Bacteria 1014
82 Ga0068862_100241401 3300005844 Bacteria 1643
83 Ga0081455_10047991 3300005937 Bacteria 3693
84 Ga0081455_10732715 3300005937 Bacteria 627
85 Ga0081538_10005432 3300005981 Bacteria 11444
86 Ga0081538_10027861 3300005981 Bacteria 3902
87 Ga0081538_10030757 3300005981 Bacteria 3638
88 Ga0081538_10078696 3300005981 Bacteria 1768
89 Ga0081538_10164473 3300005981 Bacteria 980
90 Ga0070717_10083752 3300006028 Bacteria 2682
91 Ga0070717_10169904 3300006028 Bacteria 1896
92 Ga0070717_10299559 3300006028 Bacteria 1429
93 Ga0070712_100364828 3300006175 Bacteria 1185
94 Ga0097621_100077273 3300006237 Bacteria 2763
95 Ga0068871_100055649 3300006358 Bacteria 3212
96 Ga0075428_100030667 3300006844 Bacteria 5945
97 Ga0075430_100016455 3300006846 Bacteria 6297
98 Ga0075431_100047367 3300006847 Bacteria 4432
99 Ga0075431_100121541 3300006847 Bacteria 2695
100 Ga0075434_101008310 3300006871 Bacteria 846
101 Ga0075429_100016462 3300006880 Bacteria 6407
102 Ga0068865_100094260 3300006881 Bacteria 2178
103 Ga0068865_100377524 3300006881 Bacteria 1155
104 Ga0075436_100498592 3300006914 Bacteria 890
105 Ga0097620_100282194 3300006931 Bacteria 1754
106 Ga0075435_100088728 3300007076 Bacteria 2549
107 Ga0105244_10328693 3300009036 Bacteria 705
108 Ga0105245_11227468 3300009098 Bacteria 798
109 Ga0105247_10035654 3300009101 Bacteria 3033
110 Ga0105243_10048748 3300009148 Bacteria 3340
111 Ga0105241_10055655 3300009174 Bacteria 3031
112 Ga0105242_10069153 3300009176 Bacteria 2924
113 Ga0105248_10085074 3300009177 Bacteria 3559
114 Ga0105237_11813464 3300009545 Bacteria 618
115 Ga0105249_10091675 3300009553 Bacteria 2843
116 Ga0105249_12174064 3300009553 Bacteria 628
117 Ga0105239_11599100 3300010375 Bacteria 754
118 Ga0105246_10011205 3300011119 Bacteria 5558
119 Ga0157345_1021196 3300012498 Bacteria 664
120 Ga0157338_1002234 3300012515 Bacteria 1503
121 Ga0157373_10043517 3300013100 Bacteria 3208
122 Ga0157371_10219836 3300013102 Bacteria 1364
123 Ga0157370_10125298 3300013104 Bacteria 2398
124 Ga0157374_10118862 3300013296 Bacteria 2549
125 Ga0157378_10242190 3300013297 Bacteria 1723
126 Ga0163162_10080841 3300013306 Bacteria 3319
127 Ga0157372_10269918 3300013307 Bacteria 1976
128 Ga0157372_10408278 3300013307 Bacteria 1583
129 Ga0157372_10423030 3300013307 Bacteria 1552
130 Ga0157372_11399205 3300013307 Bacteria 806
131 Ga0157372_12426930 3300013307 Bacteria 602
132 Ga0163163_10099830 3300014325 Bacteria 2924
133 Ga0157380_10410891 3300014326 Bacteria 1287
134 Ga0157380_10506001 3300014326 Bacteria 1174
135 Ga0182008_10280652 3300014497 Bacteria 867
136 Ga0157377_10186395 3300014745 Bacteria 1308
137 Ga0157379_10277518 3300014968 Bacteria 1525
138 Ga0157376_10122089 3300014969 Bacteria 2311
139 Ga0182005_1228832 3300015265 Bacteria 568
140 Ga0163161_10096355 3300017792 Bacteria 2196
141 Ga0197907_10110571 3300020069 Bacteria 711
142 Ga0197907_10656419 3300020069 Bacteria 779
143 Ga0206356_10208721 3300020070 Bacteria 1614
144 Ga0206356_10913475 3300020070 Bacteria 825
145 Ga0206356_10914712 3300020070 Bacteria 807
146 Ga0206356_11235709 3300020070 Bacteria 785
147 Ga0206351_10036065 3300020077 Bacteria 1048
148 Ga0206352_10369402 3300020078 Bacteria 920
149 Ga0206350_10283801 3300020080 Bacteria 507
150 Ga0206350_10704256 3300020080 Bacteria 917
151 Ga0206354_10149515 3300020081 Bacteria 1220
152 Ga0206354_10848727 3300020081 Bacteria 649
153 Ga0206353_11328355 3300020082 Bacteria 1273
154 Ga0206353_11387060 3300020082 Bacteria 1917
155 Ga0206353_11774490 3300020082 Bacteria 536
156 Ga0224712_10136969 3300022467 Bacteria 1074
157 Ga0207653_10017508 3300025885 Bacteria 2256
158 Ga0207692_10026187 3300025898 Bacteria 2734
159 Ga0207692_10034618 3300025898 Bacteria 2447
160 Ga0207710_10029666 3300025900 Bacteria 2382
161 Ga0207688_10243104 3300025901 Bacteria 1089
162 Ga0207680_10842787 3300025903 Bacteria 657
163 Ga0207647_10372780 3300025904 Bacteria 806
164 Ga0207699_10023060 3300025906 Bacteria 3383
165 Ga0207699_10322132 3300025906 Bacteria 1084
166 Ga0207699_10355938 3300025906 Bacteria 1034
167 Ga0207645_10440169 3300025907 Bacteria 879
168 Ga0207643_10006301 3300025908 Bacteria 6352
169 Ga0207705_10215765 3300025909 Bacteria 1456
170 Ga0207684_10047116 3300025910 Bacteria 3657
171 Ga0207654_11040868 3300025911 Bacteria 596
172 Ga0207707_10185753 3300025912 Bacteria 1814
173 Ga0207707_10473975 3300025912 Bacteria 1070
174 Ga0207671_10030558 3300025914 Bacteria 4017
175 Ga0207663_10007913 3300025916 Bacteria 5545
176 Ga0207663_10459492 3300025916 Bacteria 983
177 Ga0207660_10041952 3300025917 Bacteria 3209
178 Ga0207660_10473802 3300025917 Bacteria 1014
179 Ga0207662_10037567 3300025918 Bacteria 2834
180 Ga0207657_10018549 3300025919 Bacteria 6634
181 Ga0207649_10679578 3300025920 Bacteria 797
182 Ga0207652_10177625 3300025921 Bacteria 1912
183 Ga0207646_10004759 3300025922 Bacteria 14612
184 Ga0207659_10940842 3300025926 Bacteria 743
185 Ga0207687_10467149 3300025927 Bacteria 1049
186 Ga0207700_10063332 3300025928 Bacteria 2812
187 Ga0207700_10119789 3300025928 Bacteria 2132
188 Ga0207700_10878875 3300025928 Bacteria 802
189 Ga0207700_11017957 3300025928 Bacteria 741
190 Ga0207664_10004300 3300025929 Bacteria 9641
191 Ga0207664_10878984 3300025929 Bacteria 805
192 Ga0207690_10064304 3300025932 Bacteria 2505
193 Ga0207690_10708783 3300025932 Bacteria 828
194 Ga0207706_10019231 3300025933 Bacteria 6141
195 Ga0207706_10102127 3300025933 Bacteria 2523
196 Ga0207670_10062850 3300025936 Bacteria 2538
197 Ga0207665_10024511 3300025939 Bacteria 3978
198 Ga0207665_10186781 3300025939 Bacteria 1504
199 Ga0207689_10021457 3300025942 Bacteria 5429
200 Ga0207661_11046879 3300025944 Bacteria 751
201 Ga0207679_10036023 3300025945 Bacteria 3506
202 Ga0207679_10113891 3300025945 Bacteria 2140
203 Ga0207640_10049636 3300025981 Bacteria 2718
204 Ga0207658_11305391 3300025986 Bacteria 664
205 Ga0207703_10434152 3300026035 Bacteria 1224
206 Ga0207678_10024134 3300026067 Bacteria 5313
207 Ga0207678_10103289 3300026067 Bacteria 2433
208 Ga0207708_11135409 3300026075 Bacteria 682
209 Ga0207702_10147689 3300026078 Bacteria 2135
210 Ga0207676_10535935 3300026095 Bacteria 1116
211 Ga0207674_10005304 3300026116 Bacteria 15337
212 Ga0207675_100073809 3300026118 Bacteria 3192
213 Ga0207683_10004816 3300026121 Bacteria 11623
214 Ga0207698_10630186 3300026142 Bacteria 1060
215 Ga0207698_11326923 3300026142 Bacteria 734
216 Ga0268266_10537576 3300028379 Bacteria 1119
217 Ga0268265_11724452 3300028380 Bacteria 632
218 Ga0268264_10490664 3300028381 Bacteria 1196
219 Ga0307408_100301150 3300031548 Bacteria 1343
220 Ga0307408_100738694 3300031548 Bacteria 888
221 Ga0307516_10257669 3300031730 Bacteria 1436
222 Ga0307405_10002145 3300031731 Bacteria 8608
223 Ga0307405_10385020 3300031731 Bacteria 1093
224 Ga0307410_10079891 3300031852 Bacteria 2293
225 Ga0307406_10560977 3300031901 Bacteria 936
226 Ga0307407_10047188 3300031903 Bacteria 2443
227 Ga0307407_10100706 3300031903 Bacteria 1792
228 Ga0307412_10331715 3300031911 Bacteria 1214
229 Ga0307412_10921137 3300031911 Bacteria 767
230 Ga0307409_100001447 3300031995 Bacteria 11662
231 Ga0307409_100011319 3300031995 Bacteria 5615
232 Ga0307409_100174138 3300031995 Bacteria 1897
233 Ga0307416_100003917 3300032002 Bacteria 8862
234 Ga0307416_100187742 3300032002 Bacteria 1945
235 Ga0307416_103266963 3300032002 Bacteria 543
236 Ga0307414_10089431 3300032004 Bacteria 2282
237 Ga0307414_11428459 3300032004 Bacteria 643
238 Ga0307415_100065959 3300032126 Bacteria 2524
239 Ga0307507_10010792 3300033179 Bacteria 11690
240 Ga0373930_0048276 3300034816 Bacteria 923
241 Ga0373958_0221952 3300034819 Bacteria 503
242 Ga0373959_0090489 3300034820 Bacteria 717
243 Ga0373926_0007852 3300035083 Bacteria 3555
244 Ga0373928_0037894 3300035084 Bacteria 1096
245 Ga0373934_0012845 3300035086 Bacteria 3164
246 Ga0373944_0001124 3300035089 Bacteria 6659
247 Ga0373951_0069657 3300035091 Bacteria 894
248 Ga0373923_0003554 3300035111 Bacteria 5016
249 Ga0373936_0009445 3300035113 Bacteria 3677
250 Ga0373939_0083760 3300035114 Bacteria 1064
251 Ga0373941_0426994 3300035115 Bacteria 552
252 Ga0373945_0005643 3300035116 Bacteria 4011
253 Ga0373953_0000335 3300035117 Bacteria 12687
254 Ga0373956_0100775 3300035119 Bacteria 1339
255 Ga0373957_0026721 3300035120 Bacteria 2090
256 Ga0373943_0003885 3300035170 Bacteria 6800
257 Ga0373946_0000135 3300035171 Bacteria 22104
258 Ga0373955_0009852 3300035172 Bacteria 4494
259 Ga0373961_0030241 3300035241 Bacteria 1505
260 Ga0373924_0003047 3300035410 Bacteria 5715
261 Ga0373931_0053189 3300035691 Bacteria 2160
262 Ga0373935_0001181 3300035692 Bacteria 14350
263 Ga0373927_0003759 3300035695 Bacteria 10780
264 Ga0373933_0037803 3300035724 Bacteria 2833
265 Ga0373947_0011195 3300035725 Bacteria 5149
266 Ga0373937_0131581 3300036401 Bacteria 2336
267 Ga0373937_1665332 3300036401 Bacteria 585
268 Ga0373925_0007836 3300037068 Bacteria 7777
269 Ga0395899_0110894 3300037312 Bacteria 1973
270 Ga0395899_0148439 3300037312 Bacteria 1663
271 Ga0395900_0043711 3300037418 Bacteria 4618
272 Ga0395898_0013221 3300037466 Bacteria 8503
273 Ga0395898_0089264 3300037466 Bacteria 2966
274 Ga0395898_0497270 3300037466 Bacteria 1160
275 Ga0395905_0053038 3300037471 Bacteria 3796
276 Ga0395905_0129309 3300037471 Bacteria 2375
277 Ga0436364_0014815 3300037853 Bacteria 638
278 Ga0395901_0020481 3300038443 Bacteria 6769
279 Ga0395901_0107372 3300038443 Bacteria 2930
280 Ga0395901_1412123 3300038443 Bacteria 654
281 Ga0451839_1252067 3300041496 Bacteria 695
282 Ga0451853_0954942 3300041512 Bacteria 914
283 Ga0439460_0203234 3300042461 Bacteria 675
284 Ga0466967_0051833 3300045976 Bacteria 3599
285 Ga0466967_0952087 3300045976 Bacteria 854
286 Ga0466967_2242012 3300045976 Bacteria 542
287 Ga0495603_0013428 3300046455 Bacteria 4954
288 Ga0495629_0001769 3300046459 Bacteria 16944
289 Ga0495641_0005465 3300046461 Bacteria 8580
290 Ga0495653_0027151 3300046463 Bacteria 4582
291 Ga0495580_0032433 3300046472 Bacteria 3770
292 Ga0495582_0002260 3300046473 Bacteria 10773
293 Ga0495639_0002891 3300046475 Bacteria 7476
294 Ga0495662_0001734 3300046476 Bacteria 10890
295 Ga0495664_0005189 3300046477 Bacteria 7148
296 Ga0495664_0112996 3300046477 Bacteria 1640
297 Ga0495594_0005557 3300046499 Bacteria 6477
298 Ga0495608_0003360 3300046511 Bacteria 11438
299 Ga0495618_0010724 3300046514 Bacteria 5549
300 Ga0495618_0354503 3300046514 Bacteria 904
301 Ga0495628_0041135 3300046516 Bacteria 3690
302 Ga0495628_0259876 3300046516 Bacteria 1294
303 Ga0495630_0002935 3300046517 Bacteria 11851
304 Ga0495632_0374832 3300046519 Bacteria 624
305 Ga0495666_0002222 3300046526 Bacteria 9674
306 Ga0495652_0027712 3300046529 Bacteria 4990
307 Ga0495665_0000793 3300046531 Bacteria 16530
308 Ga0495640_0028012 3300046533 Bacteria 4058
309 Ga0495640_0155870 3300046533 Bacteria 1466
310 Ga0495586_0010554 3300046535 Bacteria 4914
311 Ga0495587_0013210 3300046536 Bacteria 5191
312 Ga0495634_0002285 3300046642 Bacteria 16036
313 Ga0495635_0006948 3300046663 Bacteria 7906
314 Ga0495588_0039825 3300046674 Bacteria 2395
315 Ga0495657_0022076 3300046675 Bacteria 4563
316 Ga0495599_0014380 3300046678 Bacteria 4900
317 Ga0495646_0014440 3300046680 Bacteria 5021
318 Ga0495647_0014038 3300046681 Bacteria 2786
319 Ga0495658_0002640 3300046683 Bacteria 9011
320 Ga0495613_0001028 3300046689 Bacteria 21269
321 Ga0495624_0002551 3300046690 Bacteria 13792
322 Ga0495600_0009229 3300046809 Bacteria 6085
323 Ga0495600_0291015 3300046809 Bacteria 1032
324 Ga0495581_0000259 3300047315 Bacteria 25347
325 Ga0495604_0010784 3300047317 Bacteria 7256
326 Ga0495674_0007527 3300047319 Bacteria 10399
327 Ga0495674_0244652 3300047319 Bacteria 1477
328 Ga0495676_0011546 3300047321 Bacteria 7967
329 Ga0495680_0004382 3300047322 Bacteria 13516
330 Ga0495675_0018113 3300047444 Bacteria 4466
331 Ga0495684_0039127 3300047471 Bacteria 3635
332 Ga0495684_0501445 3300047471 Bacteria 834
333 Ga0495593_0000939 3300047673 Bacteria 16979
334 Ga0495602_0130478 3300048088 Bacteria 2005
335 Ga0495614_0021575 3300048089 Bacteria 2780
336 Ga0496100_0984115 3300048903 Bacteria 663
337 Ga0496104_0151164 3300048907 Bacteria 2228
338 Ga0496105_0035048 3300048908 Bacteria 4129
339 Ga0496106_0123855 3300048909 Bacteria 2022
340 Ga0496107_0079475 3300048910 Bacteria 2390
341 Ga0496108_0435931 3300048911 Bacteria 1145
342 Ga0496108_1709734 3300048911 Bacteria 518
343 Ga0496110_0141464 3300048913 Bacteria 2175
344 Ga0496110_0975296 3300048913 Bacteria 755
345 Ga0496111_0177630 3300048914 Bacteria 1582
346 Ga0496114_0157226 3300048917 Bacteria 1974
347 Ga0496115_0022871 3300048918 Bacteria 4848
348 Ga0501031_0004538 3300049568 Bacteria 8999
349 Ga0501032_0679127 3300049569 Bacteria 653
350 Ga0501033_0042512 3300049570 Bacteria 3388
351 Ga0501036_0007429 3300049572 Bacteria 8928
352 Ga0501038_0040198 3300049574 Bacteria 4087
353 Ga0501039_0007968 3300049575 Bacteria 8070
354 Ga0501040_0006978 3300049576 Bacteria 7318
355 Ga0501041_0212403 3300049577 Bacteria 1213
356 Ga0501042_0041695 3300049578 Bacteria 3265
357 Ga0501043_0057640 3300049579 Bacteria 3050
358 Ga0501046_0019006 3300049580 Bacteria 5704
359 Ga0501048_0191672 3300049582 Bacteria 1448
360 Ga0501068_0655312 3300049584 Bacteria 685
361 Ga0501071_0001620 3300049587 Bacteria 13218
362 Ga0501072_0031547 3300049588 Bacteria 4149
363 Ga0501075_0840288 3300049591 Bacteria 698
364 Ga0501076_0029897 3300049592 Bacteria 4240
365 Ga0501077_0003118 3300049593 Bacteria 9961
366 Ga0501079_0040733 3300049741 Bacteria 3584
367 Ga0501081_0042772 3300049743 Bacteria 3105
368 Ga0501044_0181972 3300049823 Bacteria 2068
369 Ga0501045_0007207 3300049824 Bacteria 7716
370 nmdc:mga0n895_520571_c1 3300050512 Bacteria 1197
371 nmdc:mga0rr50_372799_c1 3300050513 Bacteria 1203
372 Ga0495601_0006367 3300053077 Bacteria 6902
373 Ga0495612_0008756 3300053078 Bacteria 4104
374 Ga0495655_0097852 3300053083 Bacteria 865
375 Ga0495595_0008697 3300053084 Bacteria 4178
376 Ga0495619_0003062 3300053085 Bacteria 10854
377 Ga0500650_0110953 3300053098 Bacteria 1280
378 Ga0500600_0207450 3300053149 Bacteria 917
379 Ga0501084_0049980 3300054114 Bacteria 3500
380 Ga0587079_057878 3300059647 Bacteria 832
381 Ga0501082_0519381 3300060353 Bacteria 1041
382 Ga0501082_0788113 3300060353 Bacteria 831
383 Ga0530510_0000566 3300061734 Bacteria 23851
384 Ga0068856_100634780
385 JGI24735J21928_10219680
386 JGI25407J50210_10015283
387 Ga0058863_11946461
388 Ga0058861_11777050
389 Ga0070658_10115205
390 Ga0070676_10142807
391 Ga0070683_100140923
392 Ga0070690_100157269
393 Ga0068869_100095725
394 Ga0070666_10202286
395 Ga0070680_100052508
396 Ga0070680_100262334
397 Ga0070682_100224029
398 Ga0070660_100026382
399 Ga0070660_100345631
400 Ga0070689_100102169
401 Ga0070691_10029319
402 Ga0070687_100289395
403 Ga0070661_100044719
404 Ga0070675_100082911
405 Ga0070671_100036392
406 Ga0070674_100781423
407 Ga0070674_101195065
408 Ga0070673_100004651
409 Ga0070688_100764173
410 Ga0070659_100258541
411 Ga0070667_100967755
412 Ga0070703_10036735
413 Ga0070709_10010738
414 Ga0070709_10013308
415 Ga0070714_100000898
416 Ga0070714_100040164
417 Ga0070714_100583452
418 Ga0070714_101441083
419 Ga0070713_100113826
420 Ga0070710_10010839
421 Ga0070710_10301187
422 Ga0070701_10101850
423 Ga0070711_100141359
424 Ga0070705_100116020
425 Ga0070700_101030483
426 Ga0070708_100038971
427 Ga0070663_100007562
428 Ga0070663_100144335
429 Ga0070678_100109141
430 Ga0070662_100041150
431 Ga0070662_100168775
432 Ga0070681_10099348
433 Ga0070681_10337181
434 Ga0070685_10012229
435 Ga0070685_10190612
436 Ga0070706_100265654
437 Ga0070706_100980652
438 Ga0070707_100824566
439 Ga0070698_100064799
440 Ga0070699_100001238
441 Ga0070679_100190424
442 Ga0070679_100587798
443 Ga0070684_100045775
444 Ga0070684_100865360
445 Ga0070697_100692817
446 Ga0068853_100097078
447 Ga0070695_100549719
448 Ga0070696_100014293
449 Ga0070693_100017483
450 Ga0070665_100536921
451 Ga0070704_101527519
452 Ga0070664_100030669
453 Ga0070664_100293834
454 Ga0068857_100142158
455 Ga0068854_100085935
456 Ga0070702_100057592
457 Ga0068852_100733865
458 Ga0068859_100282195
459 Ga0068861_101797776
460 Ga0068851_10426151
461 Ga0068870_10243408
462 Ga0068858_100173491
463 Ga0068860_100107736
464 Ga0068860_100711541
465 Ga0068862_100241401
466 Ga0081455_10047991
467 Ga0081455_10732715
468 Ga0081538_10005432
469 Ga0081538_10027861
470 Ga0081538_10030757
471 Ga0081538_10078696
472 Ga0081538_10164473
473 Ga0070717_10083752
474 Ga0070717_10169904
475 Ga0070717_10299559
476 Ga0070712_100364828
477 Ga0097621_100077273
478 Ga0068871_100055649
479 Ga0075428_100030667
480 Ga0075430_100016455
481 Ga0075431_100047367
482 Ga0075431_100121541
483 Ga0075434_101008310
484 Ga0075429_100016462
485 Ga0068865_100094260
486 Ga0068865_100377524
487 Ga0075436_100498592
488 Ga0097620_100282194
489 Ga0075435_100088728
490 Ga0105244_10328693
491 Ga0105245_11227468
492 Ga0105247_10035654
493 Ga0105243_10048748
494 Ga0105241_10055655
495 Ga0105242_10069153
496 Ga0105248_10085074
497 Ga0105237_11813464
498 Ga0105249_10091675
499 Ga0105249_12174064
500 Ga0105239_11599100
501 Ga0105246_10011205
502 Ga0157345_1021196
503 Ga0157338_1002234
504 Ga0157373_10043517
505 Ga0157371_10219836
506 Ga0157370_10125298
507 Ga0157374_10118862
508 Ga0157378_10242190
509 Ga0163162_10080841
510 Ga0157372_10269918
511 Ga0157372_10408278
512 Ga0157372_10423030
513 Ga0157372_11399205
514 Ga0157372_12426930
515 Ga0163163_10099830
516 Ga0157380_10410891
517 Ga0157380_10506001
518 Ga0182008_10280652
519 Ga0157377_10186395
520 Ga0157379_10277518
521 Ga0157376_10122089
522 Ga0182005_1228832
523 Ga0163161_10096355
524 Ga0197907_10110571
525 Ga0197907_10656419
526 Ga0206356_10208721
527 Ga0206356_10913475
528 Ga0206356_10914712
529 Ga0206356_11235709
530 Ga0206351_10036065
531 Ga0206352_10369402
532 Ga0206350_10283801
533 Ga0206350_10704256
534 Ga0206354_10149515
535 Ga0206354_10848727
536 Ga0206353_11328355
537 Ga0206353_11387060
538 Ga0206353_11774490
539 Ga0224712_10136969
540 Ga0207653_10017508
541 Ga0207692_10026187
542 Ga0207692_10034618
543 Ga0207710_10029666
544 Ga0207688_10243104
545 Ga0207680_10842787
546 Ga0207647_10372780
547 Ga0207699_10023060
548 Ga0207699_10322132
549 Ga0207699_10355938
550 Ga0207645_10440169
551 Ga0207643_10006301
552 Ga0207705_10215765
553 Ga0207684_10047116
554 Ga0207654_11040868
555 Ga0207707_10185753
556 Ga0207707_10473975
557 Ga0207671_10030558
558 Ga0207663_10007913
559 Ga0207663_10459492
560 Ga0207660_10041952
561 Ga0207660_10473802
562 Ga0207662_10037567
563 Ga0207657_10018549
564 Ga0207649_10679578
565 Ga0207652_10177625
566 Ga0207646_10004759
567 Ga0207659_10940842
568 Ga0207687_10467149
569 Ga0207700_10063332
570 Ga0207700_10119789
571 Ga0207700_10878875
572 Ga0207700_11017957
573 Ga0207664_10004300
574 Ga0207664_10878984
575 Ga0207690_10064304
576 Ga0207690_10708783
577 Ga0207706_10019231
578 Ga0207706_10102127
579 Ga0207670_10062850
580 Ga0207665_10024511
581 Ga0207665_10186781
582 Ga0207689_10021457
583 Ga0207661_11046879
584 Ga0207679_10036023
585 Ga0207679_10113891
586 Ga0207640_10049636
587 Ga0207658_11305391
588 Ga0207703_10434152
589 Ga0207678_10024134
590 Ga0207678_10103289
591 Ga0207708_11135409
592 Ga0207702_10147689
593 Ga0207676_10535935
594 Ga0207674_10005304
595 Ga0207675_100073809
596 Ga0207683_10004816
597 Ga0207698_10630186
598 Ga0207698_11326923
599 Ga0268266_10537576
600 Ga0268265_11724452
601 Ga0268264_10490664
602 Ga0307408_100301150
603 Ga0307408_100738694
604 Ga0307516_10257669
605 Ga0307405_10002145
606 Ga0307405_10385020
607 Ga0307410_10079891
608 Ga0307406_10560977
609 Ga0307407_10047188
610 Ga0307407_10100706
611 Ga0307412_10331715
612 Ga0307412_10921137
613 Ga0307409_100001447
614 Ga0307409_100011319
615 Ga0307409_100174138
616 Ga0307416_100003917
617 Ga0307416_100187742
618 Ga0307416_103266963
619 Ga0307414_10089431
620 Ga0307414_11428459
621 Ga0307415_100065959
622 Ga0307507_10010792
623 Ga0373930_0048276
624 Ga0373958_0221952
625 Ga0373959_0090489
626 Ga0373926_0007852
627 Ga0373928_0037894
628 Ga0373934_0012845
629 Ga0373944_0001124
630 Ga0373951_0069657
631 Ga0373923_0003554
632 Ga0373936_0009445
633 Ga0373939_0083760
634 Ga0373941_0426994
635 Ga0373945_0005643
636 Ga0373953_0000335
637 Ga0373956_0100775
638 Ga0373957_0026721
639 Ga0373943_0003885
640 Ga0373946_0000135
641 Ga0373955_0009852
642 Ga0373961_0030241
643 Ga0373924_0003047
644 Ga0373931_0053189
645 Ga0373935_0001181
646 Ga0373927_0003759
647 Ga0373933_0037803
648 Ga0373947_0011195
649 Ga0373937_0131581
650 Ga0373937_1665332
651 Ga0373925_0007836
652 Ga0395899_0110894
653 Ga0395899_0148439
654 Ga0395900_0043711
655 Ga0395898_0013221
656 Ga0395898_0089264
657 Ga0395898_0497270
658 Ga0395905_0053038
659 Ga0395905_0129309
660 Ga0436364_0014815
661 Ga0395901_0020481
662 Ga0395901_0107372
663 Ga0395901_1412123
664 Ga0451839_1252067
665 Ga0451853_0954942
666 Ga0439460_0203234
667 Ga0466967_0051833
668 Ga0466967_0952087
669 Ga0466967_2242012
670 Ga0495603_0013428
671 Ga0495629_0001769
672 Ga0495641_0005465
673 Ga0495653_0027151
674 Ga0495580_0032433
675 Ga0495582_0002260
676 Ga0495639_0002891
677 Ga0495662_0001734
678 Ga0495664_0005189
679 Ga0495664_0112996
680 Ga0495594_0005557
681 Ga0495608_0003360
682 Ga0495618_0010724
683 Ga0495618_0354503
684 Ga0495628_0041135
685 Ga0495628_0259876
686 Ga0495630_0002935
687 Ga0495632_0374832
688 Ga0495666_0002222
689 Ga0495652_0027712
690 Ga0495665_0000793
691 Ga0495640_0028012
692 Ga0495640_0155870
693 Ga0495586_0010554
694 Ga0495587_0013210
695 Ga0495634_0002285
696 Ga0495635_0006948
697 Ga0495588_0039825
698 Ga0495657_0022076
699 Ga0495599_0014380
700 Ga0495646_0014440
701 Ga0495647_0014038
702 Ga0495658_0002640
703 Ga0495613_0001028
704 Ga0495624_0002551
705 Ga0495600_0009229
706 Ga0495600_0291015
707 Ga0495581_0000259
708 Ga0495604_0010784
709 Ga0495674_0007527
710 Ga0495674_0244652
711 Ga0495676_0011546
712 Ga0495680_0004382
713 Ga0495675_0018113
714 Ga0495684_0039127
715 Ga0495684_0501445
716 Ga0495593_0000939
717 Ga0495602_0130478
718 Ga0495614_0021575
719 Ga0496100_0984115
720 Ga0496104_0151164
721 Ga0496105_0035048
722 Ga0496106_0123855
723 Ga0496107_0079475
724 Ga0496108_0435931
725 Ga0496108_1709734
726 Ga0496110_0141464
727 Ga0496110_0975296
728 Ga0496111_0177630
729 Ga0496114_0157226
730 Ga0496115_0022871
731 Ga0501031_0004538
732 Ga0501032_0679127
733 Ga0501033_0042512
734 Ga0501036_0007429
735 Ga0501038_0040198
736 Ga0501039_0007968
737 Ga0501040_0006978
738 Ga0501041_0212403
739 Ga0501042_0041695
740 Ga0501043_0057640
741 Ga0501046_0019006
742 Ga0501048_0191672
743 Ga0501068_0655312
744 Ga0501071_0001620
745 Ga0501072_0031547
746 Ga0501075_0840288
747 Ga0501076_0029897
748 Ga0501077_0003118
749 Ga0501079_0040733
750 Ga0501081_0042772
751 Ga0501044_0181972
752 Ga0501045_0007207
753 nmdc:mga0n895_520571_c1
754 nmdc:mga0rr50_372799_c1
755 Ga0495601_0006367
756 Ga0495612_0008756
757 Ga0495655_0097852
758 Ga0495595_0008697
759 Ga0495619_0003062
760 Ga0500650_0110953
761 Ga0500600_0207450
762 Ga0501084_0049980
763 Ga0587079_057878
764 Ga0501082_0519381
765 Ga0501082_0788113
766 Ga0530510_0000566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

38

164

0.95

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

37

165

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8649 2 132
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8407 2 132
3l20-assembly1.cif.gz_A crystal structure of a hypothetical protein from staphylococcus aureus 0.8254 1 133
3l20-assembly1.cif.gz_B crystal structure of a hypothetical protein from staphylococcus aureus 0.8136 1 135
3l20-assembly1.cif.gz_A crystal structure of a hypothetical protein from staphylococcus aureus 0.809 1 133
ID Description Score Start End Superfamily
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9266 80 133 3.30.720.110
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8844 78 133 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.849 9 132 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8377 80 133 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8229 9 132 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A5N0UW44-F1-model_v4 VOC family protein 0.9805 1 134
AF-A0A6J4NGG0-F1-model_v4 PhnB protein putative DNA binding 3-demethylubiquinone-9 3-methyltransferase domain protein 0.9786 1 133 GO:0008168
GO:0032259
AF-A0A3G9IIH2-F1-model_v4 VOC family protein 0.9772 3 133
AF-A0A1R0KGC5-F1-model_v4 PhnB-like domain-containing protein 0.9767 1 135
AF-A0A1G9UPN7-F1-model_v4 PhnB protein 0.9766 1 133

Map