F429342

General Info

Members Datasets Scaffolds Average Seq Length
382 225 764 154

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0582522|Ga0436365_0582522_1930_2478
Length 182
Sequence MPAAVQAGIRIGGDALPVDEGSTPSSKEDTMSTIHFHRSTVSTPEQFITGLTDFGPGRSELFPNSADGDLEVHHQGARDADVTEGSGGIWERLHYDWSDPNHVTLTTTDSNTWGGASGYVYTLSPRPDGTTNVDVVIVREGKNFKGRVLAAVLGTIGKGVLRKAFVHSVKAIETRSDAENRR

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
173 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
188 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
189 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
190 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
191 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
192 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
225 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.52
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0.79
Rhizoplane 5.24
Rhizosphere 89.01
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0582522 3300039437 Bacteria 3546
2 JGI24746J21847_1006402 3300001977 Bacteria 1826
3 JGI24737J22298_10083660 3300001990 Bacteria 949
4 JGI24743J22301_10046284 3300001991 Bacteria 880
5 JGI24745J21846_1017852 3300002073 Bacteria 826
6 JGI24738J21930_10014406 3300002075 Bacteria 1696
7 JGI24749J21850_1055553 3300002076 Bacteria 595
8 JGI24744J21845_10020567 3300002077 Bacteria 1301
9 JGI24744J21845_10043144 3300002077 Bacteria 841
10 JGI24034J26672_10076221 3300002239 Bacteria 607
11 Ga0058860_11344385 3300004801 Bacteria 1139
12 Ga0065715_10785607 3300005293 Bacteria 616
13 Ga0070676_10355669 3300005328 Bacteria 1008
14 Ga0070676_10444005 3300005328 Bacteria 911
15 Ga0070683_100298737 3300005329 Unclassified 1532
16 Ga0070690_100197905 3300005330 Bacteria 1397
17 Ga0070690_100599196 3300005330 Unclassified 836
18 Ga0068869_100018166 3300005334 Bacteria 4782
19 Ga0068869_100254058 3300005334 Bacteria 1405
20 Ga0070666_10218751 3300005335 Bacteria 1343
21 Ga0070666_10435330 3300005335 Bacteria 946
22 Ga0070680_100026704 3300005336 Bacteria 4618
23 Ga0070682_100018467 3300005337 Bacteria 4077
24 Ga0070682_100044194 3300005337 Bacteria 2758
25 Ga0068868_100000527 3300005338 Bacteria 25602
26 Ga0070660_100491368 3300005339 Bacteria 1021
27 Ga0070689_100119094 3300005340 Bacteria 2108
28 Ga0070689_100248936 3300005340 Bacteria 1466
29 Ga0070689_101240967 3300005340 Unclassified 670
30 Ga0070691_10008890 3300005341 Bacteria 4600
31 Ga0070691_10483939 3300005341 Bacteria 712
32 Ga0070661_100888404 3300005344 Bacteria 735
33 Ga0070692_10062453 3300005345 Bacteria 1966
34 Ga0070668_100000495 3300005347 Bacteria 26109
35 Ga0070669_100034065 3300005353 Bacteria 3687
36 Ga0070669_100506630 3300005353 Bacteria 1002
37 Ga0070675_100142008 3300005354 Bacteria 2053
38 Ga0070671_100080494 3300005355 Bacteria 2724
39 Ga0070671_100193061 3300005355 Bacteria 1726
40 Ga0070674_100002937 3300005356 Bacteria 9449
41 Ga0070674_101464981 3300005356 Unclassified 613
42 Ga0070688_100000061 3300005365 Bacteria 53388
43 Ga0070688_100038396 3300005365 Bacteria 2924
44 Ga0070659_100335781 3300005366 Bacteria 1265
45 Ga0070659_100907853 3300005366 Unclassified 770
46 Ga0070667_100028401 3300005367 Bacteria 4657
47 Ga0070667_100049829 3300005367 Bacteria 3529
48 Ga0070667_100247548 3300005367 Bacteria 1593
49 Ga0070667_100363395 3300005367 Unclassified 1312
50 Ga0070709_10013460 3300005434 Bacteria 4601
51 Ga0070714_100206786 3300005435 Bacteria 1798
52 Ga0070714_100324957 3300005435 Bacteria 1439
53 Ga0070714_100691603 3300005435 Bacteria 984
54 Ga0070710_10000318 3300005437 Bacteria 23026
55 Ga0070710_10147284 3300005437 Bacteria 1449
56 Ga0070701_10000689 3300005438 Bacteria 11967
57 Ga0070711_100013278 3300005439 Bacteria 5170
58 Ga0070711_100360721 3300005439 Bacteria 1170
59 Ga0070711_100590506 3300005439 Bacteria 925
60 Ga0070705_100010666 3300005440 Bacteria 4607
61 Ga0070705_100474714 3300005440 Bacteria 944
62 Ga0070700_100001221 3300005441 Bacteria 12748
63 Ga0070700_100002763 3300005441 Bacteria 8974
64 Ga0070700_100101560 3300005441 Bacteria 1895
65 Ga0070694_100046039 3300005444 Bacteria 2926
66 Ga0070694_100644659 3300005444 Bacteria 857
67 Ga0070708_100056157 3300005445 Bacteria 3501
68 Ga0070663_100068161 3300005455 Bacteria 2583
69 Ga0070678_100000221 3300005456 Bacteria 25731
70 Ga0070662_100017920 3300005457 Bacteria 4780
71 Ga0070662_100276992 3300005457 Bacteria 1356
72 Ga0070681_10002508 3300005458 Bacteria 16826
73 Ga0068867_100020337 3300005459 Bacteria 4730
74 Ga0068867_100796255 3300005459 Bacteria 842
75 Ga0070685_10000021 3300005466 Bacteria 103600
76 Ga0070685_10017200 3300005466 Bacteria 3867
77 Ga0070685_10046252 3300005466 Bacteria 2497
78 Ga0070685_10405193 3300005466 Bacteria 945
79 Ga0070706_100090942 3300005467 Bacteria 2830
80 Ga0070707_100327416 3300005468 Bacteria 1489
81 Ga0070698_100851055 3300005471 Bacteria 857
82 Ga0070699_100006452 3300005518 Bacteria 10217
83 Ga0070679_100000256 3300005530 Bacteria 44524
84 Ga0070697_100865978 3300005536 Bacteria 801
85 Ga0068853_100006959 3300005539 Bacteria 9032
86 Ga0068853_100062548 3300005539 Bacteria 3221
87 Ga0070672_100695895 3300005543 Bacteria 890
88 Ga0070695_100038732 3300005545 Bacteria 3011
89 Ga0070696_100095468 3300005546 Bacteria 2123
90 Ga0070696_100382153 3300005546 Bacteria 1098
91 Ga0070665_100021124 3300005548 Bacteria 6544
92 Ga0070665_100025599 3300005548 Bacteria 5943
93 Ga0070665_100610441 3300005548 Unclassified 1104
94 Ga0070704_100000788 3300005549 Bacteria 15681
95 Ga0070704_100905971 3300005549 Unclassified 793
96 Ga0068855_100622049 3300005563 Bacteria 1162
97 Ga0068854_100004899 3300005578 Bacteria 8445
98 Ga0068854_100010311 3300005578 Bacteria 6056
99 Ga0068856_100049083 3300005614 Bacteria 4160
100 Ga0068856_100521776 3300005614 Bacteria 1209
101 Ga0068856_100641114 3300005614 Bacteria 1083
102 Ga0070702_100001318 3300005615 Bacteria 10065
103 Ga0068852_100170275 3300005616 Bacteria 2041
104 Ga0068852_100905381 3300005616 Bacteria 899
105 Ga0068859_100053631 3300005617 Bacteria 4056
106 Ga0068859_100173762 3300005617 Bacteria 2236
107 Ga0068864_100190577 3300005618 Bacteria 1879
108 Ga0068866_10001769 3300005718 Bacteria 9092
109 Ga0068866_10007938 3300005718 Bacteria 4456
110 Ga0068861_100003386 3300005719 Bacteria 10577
111 Ga0068861_100075544 3300005719 Bacteria 2624
112 Ga0068861_100241850 3300005719 Bacteria 1535
113 Ga0068870_10322912 3300005840 Bacteria 981
114 Ga0068863_100119448 3300005841 Bacteria 2513
115 Ga0068863_101233112 3300005841 Bacteria 754
116 Ga0068863_101448456 3300005841 Unclassified 695
117 Ga0068858_100004754 3300005842 Bacteria 13298
118 Ga0068858_100073464 3300005842 Bacteria 3174
119 Ga0068860_100063625 3300005843 Bacteria 3503
120 Ga0068860_100584492 3300005843 Unclassified 1121
121 Ga0068860_100602029 3300005843 Bacteria 1104
122 Ga0068860_100863072 3300005843 Bacteria 920
123 Ga0068862_100017621 3300005844 Bacteria 5946
124 Ga0068862_100090320 3300005844 Bacteria 2666
125 Ga0068862_100265019 3300005844 Bacteria 1570
126 Ga0070717_10320754 3300006028 Bacteria 1380
127 Ga0075364_11197153 3300006051 Bacteria 515
128 Ga0070715_10042679 3300006163 Bacteria 1908
129 Ga0070715_10049216 3300006163 Bacteria 1805
130 Ga0070716_100391576 3300006173 Bacteria 996
131 Ga0070716_100417978 3300006173 Bacteria 969
132 Ga0070712_100020210 3300006175 Bacteria 4355
133 Ga0070712_100040855 3300006175 Bacteria 3182
134 Ga0070712_100545572 3300006175 Bacteria 976
135 Ga0075369_10156598 3300006186 Bacteria 1043
136 Ga0097621_100036225 3300006237 Bacteria 3947
137 Ga0068871_100630375 3300006358 Bacteria 977
138 Ga0075428_100782367 3300006844 Bacteria 1015
139 Ga0075430_100128793 3300006846 Bacteria 2110
140 Ga0075431_100047564 3300006847 Bacteria 4422
141 Ga0075431_100444408 3300006847 Bacteria 1293
142 Ga0075433_10171154 3300006852 Bacteria 1933
143 Ga0075433_10175754 3300006852 Bacteria 1905
144 Ga0075433_10233816 3300006852 Bacteria 1632
145 Ga0075433_11279816 3300006852 Bacteria 636
146 Ga0075434_100368732 3300006871 Bacteria 1457
147 Ga0075434_100467790 3300006871 Bacteria 1282
148 Ga0075434_100738162 3300006871 Bacteria 1002
149 Ga0075429_100210933 3300006880 Bacteria 1702
150 Ga0075429_100268949 3300006880 Bacteria 1493
151 Ga0075429_100931406 3300006880 Bacteria 760
152 Ga0068865_100000941 3300006881 Bacteria 16546
153 Ga0068865_100008710 3300006881 Bacteria 6274
154 Ga0097620_100053627 3300006931 Bacteria 4056
155 Ga0097620_100173762 3300006931 Bacteria 2236
156 Ga0099824_1016463 3300006942 Bacteria 6694
157 Ga0075435_100742399 3300007076 Bacteria 854
158 Ga0105250_10091806 3300009092 Bacteria 1235
159 Ga0105240_10677667 3300009093 Bacteria 1128
160 Ga0111539_10432003 3300009094 Bacteria 1533
161 Ga0111539_10591091 3300009094 Bacteria 1293
162 Ga0105245_10004906 3300009098 Bacteria 11768
163 Ga0105245_10058090 3300009098 Unclassified 3481
164 Ga0105245_10225306 3300009098 Bacteria 1811
165 Ga0105245_10431084 3300009098 Bacteria 1323
166 Ga0105247_10000690 3300009101 Bacteria 26538
167 Ga0105247_10547313 3300009101 Bacteria 850
168 Ga0114129_10237159 3300009147 Bacteria 2453
169 Ga0114129_10680945 3300009147 Bacteria 1324
170 Ga0105243_10002798 3300009148 Bacteria 14479
171 Ga0105243_10171493 3300009148 Unclassified 1879
172 Ga0105243_10452550 3300009148 Bacteria 1205
173 Ga0105241_10104776 3300009174 Bacteria 2254
174 Ga0105241_10187977 3300009174 Bacteria 1718
175 Ga0105242_10002207 3300009176 Bacteria 15356
176 Ga0105242_10491997 3300009176 Bacteria 1165
177 Ga0105242_12743588 3300009176 Bacteria 543
178 Ga0105248_10181627 3300009177 Unclassified 2370
179 Ga0105237_10047980 3300009545 Bacteria 4293
180 Ga0105237_10056033 3300009545 Bacteria 3947
181 Ga0105237_10636912 3300009545 Bacteria 1073
182 Ga0105237_10756519 3300009545 Bacteria 978
183 Ga0105249_10010775 3300009553 Bacteria 8033
184 Ga0105249_10411711 3300009553 Bacteria 1384
185 Ga0105239_10087784 3300010375 Bacteria 3429
186 Ga0105239_10187757 3300010375 Bacteria 2313
187 Ga0105246_10100358 3300011119 Bacteria 2106
188 Ga0105246_10164065 3300011119 Bacteria 1695
189 Ga0105246_10212922 3300011119 Unclassified 1509
190 Ga0105246_10220147 3300011119 Bacteria 1487
191 Ga0105246_12208431 3300011119 Bacteria 536
192 Ga0157369_10984477 3300013105 Bacteria 864
193 Ga0157374_10032443 3300013296 Bacteria 4755
194 Ga0157374_10374191 3300013296 Bacteria 1418
195 Ga0157378_10027122 3300013297 Bacteria 5054
196 Ga0163162_10009732 3300013306 Bacteria 9357
197 Ga0163162_10034907 3300013306 Bacteria 5007
198 Ga0163162_10116946 3300013306 Bacteria 2767
199 Ga0163162_10184120 3300013306 Bacteria 2215
200 Ga0163162_11911225 3300013306 Bacteria 679
201 Ga0157372_10006637 3300013307 Bacteria 12316
202 Ga0157372_10196263 3300013307 Bacteria 2338
203 Ga0157372_10963260 3300013307 Unclassified 989
204 Ga0157375_10018959 3300013308 Bacteria 6246
205 Ga0157375_10036898 3300013308 Bacteria 4679
206 Ga0157380_10054896 3300014326 Bacteria 3163
207 Ga0157380_10586037 3300014326 Bacteria 1101
208 Ga0157380_10698373 3300014326 Unclassified 1019
209 Ga0157377_10029605 3300014745 Bacteria 2958
210 Ga0157377_10030887 3300014745 Bacteria 2906
211 Ga0157377_10259955 3300014745 Unclassified 1129
212 Ga0157379_10018756 3300014968 Bacteria 6101
213 Ga0157379_10847824 3300014968 Bacteria 864
214 Ga0157376_10169117 3300014969 Bacteria 1989
215 Ga0163161_10011969 3300017792 Bacteria 6018
216 Ga0163161_10037224 3300017792 Bacteria 3487
217 Ga0163161_10544822 3300017792 Bacteria 950
218 Ga0197907_10190925 3300020069 Bacteria 1172
219 Ga0213876_10012294 3300021384 Bacteria 4558
220 Ga0213876_10016070 3300021384 Bacteria 3958
221 Ga0213876_10035109 3300021384 Bacteria 2645
222 Ga0213876_10095730 3300021384 Bacteria 1573
223 Ga0213875_10010789 3300021388 Bacteria 4568
224 Ga0207656_10374849 3300025321 Bacteria 713
225 Ga0207692_10022557 3300025898 Bacteria 2898
226 Ga0207692_10081534 3300025898 Bacteria 1731
227 Ga0207642_10006326 3300025899 Bacteria 3928
228 Ga0207710_10018121 3300025900 Bacteria 2993
229 Ga0207710_10282420 3300025900 Bacteria 836
230 Ga0207688_10001980 3300025901 Bacteria 10980
231 Ga0207688_10008006 3300025901 Bacteria 5751
232 Ga0207680_10252120 3300025903 Bacteria 1219
233 Ga0207680_10465178 3300025903 Bacteria 898
234 Ga0207647_10027554 3300025904 Bacteria 3703
235 Ga0207647_10146709 3300025904 Bacteria 1380
236 Ga0207685_10032416 3300025905 Bacteria 1880
237 Ga0207685_10072081 3300025905 Bacteria 1403
238 Ga0207645_10533622 3300025907 Bacteria 795
239 Ga0207654_10116194 3300025911 Bacteria 1673
240 Ga0207707_10000190 3300025912 Bacteria 64802
241 Ga0207695_10679888 3300025913 Bacteria 910
242 Ga0207671_10586724 3300025914 Bacteria 888
243 Ga0207693_10000952 3300025915 Bacteria 25952
244 Ga0207693_10029050 3300025915 Bacteria 4370
245 Ga0207693_10198609 3300025915 Bacteria 1577
246 Ga0207663_10018836 3300025916 Bacteria 3877
247 Ga0207663_10764762 3300025916 Bacteria 768
248 Ga0207660_10007364 3300025917 Bacteria 7121
249 Ga0207657_10570095 3300025919 Bacteria 884
250 Ga0207652_10000028 3300025921 Bacteria 150429
251 Ga0207646_10841844 3300025922 Unclassified 816
252 Ga0207681_10223299 3300025923 Bacteria 1459
253 Ga0207659_10096595 3300025926 Bacteria 2218
254 Ga0207659_10435159 3300025926 Bacteria 1102
255 Ga0207687_10005178 3300025927 Bacteria 8646
256 Ga0207687_10018593 3300025927 Bacteria 4591
257 Ga0207687_10032529 3300025927 Unclassified 3532
258 Ga0207687_10670654 3300025927 Bacteria 878
259 Ga0207687_10743953 3300025927 Bacteria 834
260 Ga0207664_10114303 3300025929 Bacteria 2249
261 Ga0207644_10083166 3300025931 Bacteria 2370
262 Ga0207644_11048873 3300025931 Bacteria 685
263 Ga0207690_10046705 3300025932 Bacteria 2869
264 Ga0207690_10379807 3300025932 Bacteria 1123
265 Ga0207706_10008762 3300025933 Bacteria 9311
266 Ga0207706_10201097 3300025933 Bacteria 1747
267 Ga0207706_10421228 3300025933 Bacteria 1157
268 Ga0207706_10599924 3300025933 Bacteria 946
269 Ga0207686_10030672 3300025934 Bacteria 3186
270 Ga0207686_10337466 3300025934 Bacteria 1131
271 Ga0207686_10471717 3300025934 Bacteria 969
272 Ga0207709_10107586 3300025935 Unclassified 1857
273 Ga0207709_10479641 3300025935 Bacteria 967
274 Ga0207670_10192527 3300025936 Bacteria 1544
275 Ga0207670_10319016 3300025936 Bacteria 1222
276 Ga0207670_10436519 3300025936 Bacteria 1053
277 Ga0207669_10157537 3300025937 Bacteria 1599
278 Ga0207704_10016414 3300025938 Bacteria 3805
279 Ga0207704_10380364 3300025938 Bacteria 1108
280 Ga0207665_10004415 3300025939 Bacteria 9348
281 Ga0207691_10364448 3300025940 Bacteria 1235
282 Ga0207711_10100050 3300025941 Unclassified 2564
283 Ga0207711_10791900 3300025941 Bacteria 883
284 Ga0207689_10003422 3300025942 Bacteria 14486
285 Ga0207689_10208858 3300025942 Bacteria 1613
286 Ga0207661_10645987 3300025944 Unclassified 972
287 Ga0207651_10160038 3300025960 Bacteria 1764
288 Ga0207712_10218329 3300025961 Bacteria 1523
289 Ga0207712_10218659 3300025961 Bacteria 1522
290 Ga0207668_10002638 3300025972 Bacteria 10490
291 Ga0207640_10002341 3300025981 Bacteria 10180
292 Ga0207658_10043626 3300025986 Bacteria 3261
293 Ga0207677_10053375 3300026023 Bacteria 2751
294 Ga0207703_10005974 3300026035 Bacteria 9754
295 Ga0207703_10144527 3300026035 Bacteria 2067
296 Ga0207639_10496294 3300026041 Bacteria 1114
297 Ga0207639_10593044 3300026041 Bacteria 1021
298 Ga0207678_10007823 3300026067 Bacteria 9435
299 Ga0207708_10002572 3300026075 Bacteria 13355
300 Ga0207708_10009486 3300026075 Bacteria 7209
301 Ga0207702_10412346 3300026078 Bacteria 1305
302 Ga0207702_10612756 3300026078 Bacteria 1069
303 Ga0207641_10055914 3300026088 Bacteria 3352
304 Ga0207641_11057646 3300026088 Bacteria 809
305 Ga0207641_11334982 3300026088 Bacteria 718
306 Ga0207648_10011113 3300026089 Bacteria 8494
307 Ga0207648_10301544 3300026089 Bacteria 1437
308 Ga0207675_100001405 3300026118 Bacteria 24077
309 Ga0207675_100456796 3300026118 Bacteria 1266
310 Ga0207683_10001006 3300026121 Bacteria 25752
311 Ga0207698_10121788 3300026142 Bacteria 2210
312 Ga0209389_1000075 3300027296 Bacteria 92887
313 Ga0209489_100062 3300027361 Bacteria 145478
314 Ga0207428_10539992 3300027907 Unclassified 844
315 Ga0268266_10089019 3300028379 Bacteria 2702
316 Ga0268266_10631513 3300028379 Unclassified 1030
317 Ga0268265_10070995 3300028380 Bacteria 2710
318 Ga0268264_10007776 3300028381 Bacteria 8926
319 Ga0268264_10076969 3300028381 Bacteria 2840
320 Ga0373931_0129562 3300035691 Bacteria 1450
321 Ga0373931_0292820 3300035691 Bacteria 1003
322 Ga0395900_0234110 3300037418 Bacteria 1846
323 Ga0395898_0127031 3300037466 Bacteria 2443
324 Ga0395905_0453795 3300037471 Bacteria 1180
325 Ga0436364_0972096 3300037853 Bacteria 7510
326 Ga0436364_1372527 3300037853 Bacteria 17144
327 Ga0395901_0287145 3300038443 Bacteria 1708
328 Ga0436365_0212845 3300039437 Bacteria 1623
329 Ga0436365_0576747 3300039437 Bacteria 7557
330 Ga0436365_1335160 3300039437 Bacteria 8598
331 Ga0436365_1823845 3300039437 Bacteria 75216
332 Ga0436363_1569582 3300039450 Bacteria 1455
333 Ga0436362_0443446 3300039453 Bacteria 1468
334 Ga0439448_0201730 3300042005 Bacteria 697
335 Ga0439450_001630 3300042008 Bacteria 3337
336 Ga0439451_101758 3300042009 Bacteria 581
337 Ga0439454_033207 3300042011 Bacteria 818
338 Ga0439463_002948 3300042016 Bacteria 4322
339 Ga0439460_0005080 3300042461 Bacteria 3218
340 Ga0439440_0001203 3300042993 Bacteria 4650
341 Ga0439440_0017617 3300042993 Bacteria 1575
342 Ga0453683_0010899 3300044673 Bacteria 6011
343 Ga0466963_0931510 3300044694 Bacteria 612
344 Ga0451576_2125274 3300045051 Unclassified 577
345 Ga0466967_0133033 3300045976 Bacteria 2311
346 Ga0495625_0673518 3300046660 Unclassified 614
347 Ga0495672_0403430 3300047320 Bacteria 625
348 Ga0496100_0000389 3300048903 Bacteria 21349
349 Ga0496101_0004523 3300048904 Bacteria 8777
350 Ga0496102_0019844 3300048905 Bacteria 5926
351 Ga0496102_0050875 3300048905 Bacteria 3773
352 Ga0496102_0058130 3300048905 Bacteria 3533
353 Ga0496102_0058331 3300048905 Bacteria 3527
354 Ga0496102_0367706 3300048905 Bacteria 1354
355 Ga0496102_0692197 3300048905 Bacteria 942
356 Ga0496103_0001833 3300048906 Bacteria 13819
357 Ga0496104_0049225 3300048907 Bacteria 3975
358 Ga0496106_0006575 3300048909 Bacteria 8607
359 Ga0496107_0042188 3300048910 Bacteria 3276
360 Ga0496107_0096994 3300048910 Bacteria 2158
361 Ga0496108_0002215 3300048911 Bacteria 15559
362 Ga0496109_0032074 3300048912 Bacteria 4719
363 Ga0496110_0491324 3300048913 Bacteria 1118
364 Ga0496112_0025079 3300048915 Bacteria 5721
365 Ga0496114_0018662 3300048917 Bacteria 5611
366 Ga0496114_0125513 3300048917 Bacteria 2212
367 Ga0496115_0022296 3300048918 Bacteria 4904
368 Ga0496118_0003661 3300048921 Bacteria 19087
369 Ga0501072_0646131 3300049588 Bacteria 833
370 Ga0501075_0130621 3300049591 Bacteria 1914
371 Ga0501077_0191771 3300049593 Bacteria 1298
372 nmdc:mga00v17_1014281_c1 3300050491 Bacteria 522
373 nmdc:mga05p37_195430_c1 3300050507 Bacteria 2453
374 nmdc:mga09592_333908_c1 3300050508 Bacteria 1312
375 nmdc:mga06r32_639467_c1 3300050510 Bacteria 1033
376 nmdc:mga08y16_549672_c1 3300050511 Bacteria 1169
377 nmdc:mga0n895_26374_c1 3300050512 Bacteria 5502
378 nmdc:mga0rr50_683832_c1 3300050513 Bacteria 876
379 nmdc:mga0a205_1432722_c1 3300050515 Unclassified 539
380 nmdc:mga0a205_214364_c1 3300050515 Bacteria 1813
381 2881670626 2881665667 Bacteria 8175609
382 2939588415 2939582691 Bacteria 7088898
383 Ga0436365_0582522
384 JGI24746J21847_1006402
385 JGI24737J22298_10083660
386 JGI24743J22301_10046284
387 JGI24745J21846_1017852
388 JGI24738J21930_10014406
389 JGI24749J21850_1055553
390 JGI24744J21845_10020567
391 JGI24744J21845_10043144
392 JGI24034J26672_10076221
393 Ga0058860_11344385
394 Ga0065715_10785607
395 Ga0070676_10355669
396 Ga0070676_10444005
397 Ga0070683_100298737
398 Ga0070690_100197905
399 Ga0070690_100599196
400 Ga0068869_100018166
401 Ga0068869_100254058
402 Ga0070666_10218751
403 Ga0070666_10435330
404 Ga0070680_100026704
405 Ga0070682_100018467
406 Ga0070682_100044194
407 Ga0068868_100000527
408 Ga0070660_100491368
409 Ga0070689_100119094
410 Ga0070689_100248936
411 Ga0070689_101240967
412 Ga0070691_10008890
413 Ga0070691_10483939
414 Ga0070661_100888404
415 Ga0070692_10062453
416 Ga0070668_100000495
417 Ga0070669_100034065
418 Ga0070669_100506630
419 Ga0070675_100142008
420 Ga0070671_100080494
421 Ga0070671_100193061
422 Ga0070674_100002937
423 Ga0070674_101464981
424 Ga0070688_100000061
425 Ga0070688_100038396
426 Ga0070659_100335781
427 Ga0070659_100907853
428 Ga0070667_100028401
429 Ga0070667_100049829
430 Ga0070667_100247548
431 Ga0070667_100363395
432 Ga0070709_10013460
433 Ga0070714_100206786
434 Ga0070714_100324957
435 Ga0070714_100691603
436 Ga0070710_10000318
437 Ga0070710_10147284
438 Ga0070701_10000689
439 Ga0070711_100013278
440 Ga0070711_100360721
441 Ga0070711_100590506
442 Ga0070705_100010666
443 Ga0070705_100474714
444 Ga0070700_100001221
445 Ga0070700_100002763
446 Ga0070700_100101560
447 Ga0070694_100046039
448 Ga0070694_100644659
449 Ga0070708_100056157
450 Ga0070663_100068161
451 Ga0070678_100000221
452 Ga0070662_100017920
453 Ga0070662_100276992
454 Ga0070681_10002508
455 Ga0068867_100020337
456 Ga0068867_100796255
457 Ga0070685_10000021
458 Ga0070685_10017200
459 Ga0070685_10046252
460 Ga0070685_10405193
461 Ga0070706_100090942
462 Ga0070707_100327416
463 Ga0070698_100851055
464 Ga0070699_100006452
465 Ga0070679_100000256
466 Ga0070697_100865978
467 Ga0068853_100006959
468 Ga0068853_100062548
469 Ga0070672_100695895
470 Ga0070695_100038732
471 Ga0070696_100095468
472 Ga0070696_100382153
473 Ga0070665_100021124
474 Ga0070665_100025599
475 Ga0070665_100610441
476 Ga0070704_100000788
477 Ga0070704_100905971
478 Ga0068855_100622049
479 Ga0068854_100004899
480 Ga0068854_100010311
481 Ga0068856_100049083
482 Ga0068856_100521776
483 Ga0068856_100641114
484 Ga0070702_100001318
485 Ga0068852_100170275
486 Ga0068852_100905381
487 Ga0068859_100053631
488 Ga0068859_100173762
489 Ga0068864_100190577
490 Ga0068866_10001769
491 Ga0068866_10007938
492 Ga0068861_100003386
493 Ga0068861_100075544
494 Ga0068861_100241850
495 Ga0068870_10322912
496 Ga0068863_100119448
497 Ga0068863_101233112
498 Ga0068863_101448456
499 Ga0068858_100004754
500 Ga0068858_100073464
501 Ga0068860_100063625
502 Ga0068860_100584492
503 Ga0068860_100602029
504 Ga0068860_100863072
505 Ga0068862_100017621
506 Ga0068862_100090320
507 Ga0068862_100265019
508 Ga0070717_10320754
509 Ga0075364_11197153
510 Ga0070715_10042679
511 Ga0070715_10049216
512 Ga0070716_100391576
513 Ga0070716_100417978
514 Ga0070712_100020210
515 Ga0070712_100040855
516 Ga0070712_100545572
517 Ga0075369_10156598
518 Ga0097621_100036225
519 Ga0068871_100630375
520 Ga0075428_100782367
521 Ga0075430_100128793
522 Ga0075431_100047564
523 Ga0075431_100444408
524 Ga0075433_10171154
525 Ga0075433_10175754
526 Ga0075433_10233816
527 Ga0075433_11279816
528 Ga0075434_100368732
529 Ga0075434_100467790
530 Ga0075434_100738162
531 Ga0075429_100210933
532 Ga0075429_100268949
533 Ga0075429_100931406
534 Ga0068865_100000941
535 Ga0068865_100008710
536 Ga0097620_100053627
537 Ga0097620_100173762
538 Ga0099824_1016463
539 Ga0075435_100742399
540 Ga0105250_10091806
541 Ga0105240_10677667
542 Ga0111539_10432003
543 Ga0111539_10591091
544 Ga0105245_10004906
545 Ga0105245_10058090
546 Ga0105245_10225306
547 Ga0105245_10431084
548 Ga0105247_10000690
549 Ga0105247_10547313
550 Ga0114129_10237159
551 Ga0114129_10680945
552 Ga0105243_10002798
553 Ga0105243_10171493
554 Ga0105243_10452550
555 Ga0105241_10104776
556 Ga0105241_10187977
557 Ga0105242_10002207
558 Ga0105242_10491997
559 Ga0105242_12743588
560 Ga0105248_10181627
561 Ga0105237_10047980
562 Ga0105237_10056033
563 Ga0105237_10636912
564 Ga0105237_10756519
565 Ga0105249_10010775
566 Ga0105249_10411711
567 Ga0105239_10087784
568 Ga0105239_10187757
569 Ga0105246_10100358
570 Ga0105246_10164065
571 Ga0105246_10212922
572 Ga0105246_10220147
573 Ga0105246_12208431
574 Ga0157369_10984477
575 Ga0157374_10032443
576 Ga0157374_10374191
577 Ga0157378_10027122
578 Ga0163162_10009732
579 Ga0163162_10034907
580 Ga0163162_10116946
581 Ga0163162_10184120
582 Ga0163162_11911225
583 Ga0157372_10006637
584 Ga0157372_10196263
585 Ga0157372_10963260
586 Ga0157375_10018959
587 Ga0157375_10036898
588 Ga0157380_10054896
589 Ga0157380_10586037
590 Ga0157380_10698373
591 Ga0157377_10029605
592 Ga0157377_10030887
593 Ga0157377_10259955
594 Ga0157379_10018756
595 Ga0157379_10847824
596 Ga0157376_10169117
597 Ga0163161_10011969
598 Ga0163161_10037224
599 Ga0163161_10544822
600 Ga0197907_10190925
601 Ga0213876_10012294
602 Ga0213876_10016070
603 Ga0213876_10035109
604 Ga0213876_10095730
605 Ga0213875_10010789
606 Ga0207656_10374849
607 Ga0207692_10022557
608 Ga0207692_10081534
609 Ga0207642_10006326
610 Ga0207710_10018121
611 Ga0207710_10282420
612 Ga0207688_10001980
613 Ga0207688_10008006
614 Ga0207680_10252120
615 Ga0207680_10465178
616 Ga0207647_10027554
617 Ga0207647_10146709
618 Ga0207685_10032416
619 Ga0207685_10072081
620 Ga0207645_10533622
621 Ga0207654_10116194
622 Ga0207707_10000190
623 Ga0207695_10679888
624 Ga0207671_10586724
625 Ga0207693_10000952
626 Ga0207693_10029050
627 Ga0207693_10198609
628 Ga0207663_10018836
629 Ga0207663_10764762
630 Ga0207660_10007364
631 Ga0207657_10570095
632 Ga0207652_10000028
633 Ga0207646_10841844
634 Ga0207681_10223299
635 Ga0207659_10096595
636 Ga0207659_10435159
637 Ga0207687_10005178
638 Ga0207687_10018593
639 Ga0207687_10032529
640 Ga0207687_10670654
641 Ga0207687_10743953
642 Ga0207664_10114303
643 Ga0207644_10083166
644 Ga0207644_11048873
645 Ga0207690_10046705
646 Ga0207690_10379807
647 Ga0207706_10008762
648 Ga0207706_10201097
649 Ga0207706_10421228
650 Ga0207706_10599924
651 Ga0207686_10030672
652 Ga0207686_10337466
653 Ga0207686_10471717
654 Ga0207709_10107586
655 Ga0207709_10479641
656 Ga0207670_10192527
657 Ga0207670_10319016
658 Ga0207670_10436519
659 Ga0207669_10157537
660 Ga0207704_10016414
661 Ga0207704_10380364
662 Ga0207665_10004415
663 Ga0207691_10364448
664 Ga0207711_10100050
665 Ga0207711_10791900
666 Ga0207689_10003422
667 Ga0207689_10208858
668 Ga0207661_10645987
669 Ga0207651_10160038
670 Ga0207712_10218329
671 Ga0207712_10218659
672 Ga0207668_10002638
673 Ga0207640_10002341
674 Ga0207658_10043626
675 Ga0207677_10053375
676 Ga0207703_10005974
677 Ga0207703_10144527
678 Ga0207639_10496294
679 Ga0207639_10593044
680 Ga0207678_10007823
681 Ga0207708_10002572
682 Ga0207708_10009486
683 Ga0207702_10412346
684 Ga0207702_10612756
685 Ga0207641_10055914
686 Ga0207641_11057646
687 Ga0207641_11334982
688 Ga0207648_10011113
689 Ga0207648_10301544
690 Ga0207675_100001405
691 Ga0207675_100456796
692 Ga0207683_10001006
693 Ga0207698_10121788
694 Ga0209389_1000075
695 Ga0209489_100062
696 Ga0207428_10539992
697 Ga0268266_10089019
698 Ga0268266_10631513
699 Ga0268265_10070995
700 Ga0268264_10007776
701 Ga0268264_10076969
702 Ga0373931_0129562
703 Ga0373931_0292820
704 Ga0395900_0234110
705 Ga0395898_0127031
706 Ga0395905_0453795
707 Ga0436364_0972096
708 Ga0436364_1372527
709 Ga0395901_0287145
710 Ga0436365_0212845
711 Ga0436365_0576747
712 Ga0436365_1335160
713 Ga0436365_1823845
714 Ga0436363_1569582
715 Ga0436362_0443446
716 Ga0439448_0201730
717 Ga0439450_001630
718 Ga0439451_101758
719 Ga0439454_033207
720 Ga0439463_002948
721 Ga0439460_0005080
722 Ga0439440_0001203
723 Ga0439440_0017617
724 Ga0453683_0010899
725 Ga0466963_0931510
726 Ga0451576_2125274
727 Ga0466967_0133033
728 Ga0495625_0673518
729 Ga0495672_0403430
730 Ga0496100_0000389
731 Ga0496101_0004523
732 Ga0496102_0019844
733 Ga0496102_0050875
734 Ga0496102_0058130
735 Ga0496102_0058331
736 Ga0496102_0367706
737 Ga0496102_0692197
738 Ga0496103_0001833
739 Ga0496104_0049225
740 Ga0496106_0006575
741 Ga0496107_0042188
742 Ga0496107_0096994
743 Ga0496108_0002215
744 Ga0496109_0032074
745 Ga0496110_0491324
746 Ga0496112_0025079
747 Ga0496114_0018662
748 Ga0496114_0125513
749 Ga0496115_0022296
750 Ga0496118_0003661
751 Ga0501072_0646131
752 Ga0501075_0130621
753 Ga0501077_0191771
754 nmdc:mga00v17_1014281_c1
755 nmdc:mga05p37_195430_c1
756 nmdc:mga09592_333908_c1
757 nmdc:mga06r32_639467_c1
758 nmdc:mga08y16_549672_c1
759 nmdc:mga0n895_26374_c1
760 nmdc:mga0rr50_683832_c1
761 nmdc:mga0a205_1432722_c1
762 nmdc:mga0a205_214364_c1
763 2881670626
764 2939588415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tmu-assembly4.cif.gz_D crystal structure of the protein of unknown function ypo0625 from yersinia pestis 0.7439 2 141
3tvr-assembly1.cif.gz_A crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi 0.7332 3 151
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.7309 1 143
7tmu-assembly4.cif.gz_D crystal structure of the protein of unknown function ypo0625 from yersinia pestis 0.7174 2 141
3tvr-assembly1.cif.gz_A crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi 0.7168 3 151
ID Description Score Start End Superfamily
af_Q8MLL3_83_228_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7428 2 140 3.30.530.20
af_I1JXW9_329_493_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.741 2 152 3.30.530.20
af_P9WL87_17_165_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7381 2 151 3.30.530.20
af_C0H4S7_40_178_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7368 2 146 3.30.530.20
af_A0A1D6NAC7_96_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7349 2 141 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A317JBE4-F1-model_v4 Uncharacterized protein 0.989 2 119
AF-A0A1M7ATN6-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9766 1 146
AF-T5I2Z1-F1-model_v4 deleted 0.9765 3 149
AF-A0A2A3HDU7-F1-model_v4 deleted 0.9764 3 149
AF-A0A4R8CM91-F1-model_v4 Polyketide cyclase/dehydrase/lipid transport protein 0.9762 1 144

Map