F429333
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 382 | 198 | 764 | 223 |
Family's Representative Sequence
| Representative Sequence | 3300035725|Ga0373947_0112635|Ga0373947_0112635_191_916 |
| Length | 241 |
| Sequence | MRPKAAAKKRSEFDPKTFLSTIDGGRKIAAFSKKQTIFVQGDPSDAVFYIQKGRVKLVLVQREMEKRRSPGRVKLTVVSKIGKEATIGILNEGDFFGEGCLTGQPVRLCSAIAMTDCSVMRIDKKSMMEVLHQEHAFSDMFVAYLLTRNIRYEEDLVDQLFNSSEKRLARILLLLAHFGKEGVPETVIPKISQEMLAEMIGTTRSRVSFFMNRFRKLGFIDYDGGSGFQVHSSLLNIVLHD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 82 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 83 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 84 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 85 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 141 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 145 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 146 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 190 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 191 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 192 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.38 |
| Metatranscriptomes | 2.62 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.88 |
| Rhizosphere | 96.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 36.91 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373947_0112635 | 3300035725 | Bacteria | 1721 |
| 2 | Ga0065704_10036268 | 3300005289 | Unclassified | 993 |
| 3 | Ga0065715_10195936 | 3300005293 | Unclassified | 1388 |
| 4 | Ga0070658_10687100 | 3300005327 | Unclassified | 888 |
| 5 | Ga0070690_100107830 | 3300005330 | Bacteria | 1854 |
| 6 | Ga0070670_100206174 | 3300005331 | Bacteria | 1709 |
| 7 | Ga0068869_100044433 | 3300005334 | Bacteria | 3195 |
| 8 | Ga0068869_100261637 | 3300005334 | Unclassified | 1385 |
| 9 | Ga0068868_100018866 | 3300005338 | Bacteria | 5162 |
| 10 | Ga0068868_100082333 | 3300005338 | Bacteria | 2581 |
| 11 | Ga0070660_100089728 | 3300005339 | Unclassified | 2422 |
| 12 | Ga0070660_100159147 | 3300005339 | Bacteria | 1819 |
| 13 | Ga0070660_100207353 | 3300005339 | Bacteria | 1591 |
| 14 | Ga0070689_100155134 | 3300005340 | Bacteria | 1848 |
| 15 | Ga0070661_100002374 | 3300005344 | Bacteria | 12918 |
| 16 | Ga0070671_100235241 | 3300005355 | Unclassified | 1555 |
| 17 | Ga0070673_100135168 | 3300005364 | Unclassified | 2074 |
| 18 | Ga0070709_10101710 | 3300005434 | Bacteria | 1916 |
| 19 | Ga0070709_10150743 | 3300005434 | Bacteria | 1607 |
| 20 | Ga0070709_10375414 | 3300005434 | Unclassified | 1056 |
| 21 | Ga0070714_100164824 | 3300005435 | Bacteria | 2008 |
| 22 | Ga0070714_100299432 | 3300005435 | Unclassified | 1499 |
| 23 | Ga0070714_100854349 | 3300005435 | Unclassified | 883 |
| 24 | Ga0070713_100018413 | 3300005436 | Bacteria | 5308 |
| 25 | Ga0070713_100147961 | 3300005436 | Unclassified | 2086 |
| 26 | Ga0070713_100240448 | 3300005436 | Bacteria | 1648 |
| 27 | Ga0070713_100834200 | 3300005436 | Unclassified | 885 |
| 28 | Ga0070710_10244627 | 3300005437 | Bacteria | 1150 |
| 29 | Ga0070711_100041700 | 3300005439 | Bacteria | 3101 |
| 30 | Ga0070711_100147569 | 3300005439 | Bacteria | 1770 |
| 31 | Ga0070711_100276570 | 3300005439 | Bacteria | 1327 |
| 32 | Ga0070708_100001221 | 3300005445 | Bacteria | 19765 |
| 33 | Ga0070708_100003962 | 3300005445 | Bacteria | 11622 |
| 34 | Ga0070708_100018534 | 3300005445 | Bacteria | 5826 |
| 35 | Ga0070708_100021702 | 3300005445 | Bacteria | 5436 |
| 36 | Ga0070708_100030068 | 3300005445 | Bacteria | 4691 |
| 37 | Ga0070708_100139977 | 3300005445 | Unclassified | 2244 |
| 38 | Ga0070678_100042985 | 3300005456 | Bacteria | 3216 |
| 39 | Ga0070678_100304523 | 3300005456 | Unclassified | 1355 |
| 40 | Ga0070662_100232067 | 3300005457 | Unclassified | 1476 |
| 41 | Ga0070681_10023083 | 3300005458 | Bacteria | 6256 |
| 42 | Ga0070681_10555485 | 3300005458 | Unclassified | 1062 |
| 43 | Ga0070681_10565075 | 3300005458 | Unclassified | 1051 |
| 44 | Ga0068867_100030361 | 3300005459 | Unclassified | 3899 |
| 45 | Ga0068867_100336969 | 3300005459 | Unclassified | 1255 |
| 46 | Ga0068867_100622033 | 3300005459 | Unclassified | 944 |
| 47 | Ga0070685_10031683 | 3300005466 | Unclassified | 2956 |
| 48 | Ga0070706_100002274 | 3300005467 | Bacteria | 19455 |
| 49 | Ga0070706_100019120 | 3300005467 | Bacteria | 6320 |
| 50 | Ga0070706_100467505 | 3300005467 | Bacteria | 1173 |
| 51 | Ga0070707_100025190 | 3300005468 | Bacteria | 5642 |
| 52 | Ga0070707_100026214 | 3300005468 | Bacteria | 5533 |
| 53 | Ga0070707_100036167 | 3300005468 | Bacteria | 4712 |
| 54 | Ga0070707_100110670 | 3300005468 | Bacteria | 2664 |
| 55 | Ga0070707_100224373 | 3300005468 | Unclassified | 1830 |
| 56 | Ga0070707_100275466 | 3300005468 | Bacteria | 1636 |
| 57 | Ga0070707_100607107 | 3300005468 | Bacteria | 1056 |
| 58 | Ga0070707_100995053 | 3300005468 | Bacteria | 804 |
| 59 | Ga0070698_100004288 | 3300005471 | Bacteria | 15679 |
| 60 | Ga0070698_100054737 | 3300005471 | Bacteria | 4050 |
| 61 | Ga0070699_100002162 | 3300005518 | Bacteria | 17781 |
| 62 | Ga0070699_100029898 | 3300005518 | Unclassified | 4699 |
| 63 | Ga0070699_100041207 | 3300005518 | Bacteria | 3998 |
| 64 | Ga0070679_100093767 | 3300005530 | Bacteria | 2989 |
| 65 | Ga0070697_100000488 | 3300005536 | Bacteria | 30188 |
| 66 | Ga0070697_100005380 | 3300005536 | Bacteria | 9852 |
| 67 | Ga0070697_100006673 | 3300005536 | Bacteria | 8955 |
| 68 | Ga0070697_100037255 | 3300005536 | Bacteria | 3929 |
| 69 | Ga0070697_100112494 | 3300005536 | Unclassified | 2270 |
| 70 | Ga0070697_100311081 | 3300005536 | Unclassified | 1355 |
| 71 | Ga0068853_100147720 | 3300005539 | Unclassified | 2114 |
| 72 | Ga0068853_100228165 | 3300005539 | Unclassified | 1703 |
| 73 | Ga0070672_100220865 | 3300005543 | Unclassified | 1589 |
| 74 | Ga0068855_100040458 | 3300005563 | Bacteria | 5533 |
| 75 | Ga0068855_100044774 | 3300005563 | Bacteria | 5237 |
| 76 | Ga0068855_100099376 | 3300005563 | Bacteria | 3352 |
| 77 | Ga0070664_100037583 | 3300005564 | Bacteria | 4071 |
| 78 | Ga0068857_100003152 | 3300005577 | Unclassified | 13663 |
| 79 | Ga0068857_100006131 | 3300005577 | Bacteria | 10272 |
| 80 | Ga0068854_100028243 | 3300005578 | Unclassified | 3875 |
| 81 | Ga0068854_100215347 | 3300005578 | Unclassified | 1517 |
| 82 | Ga0068856_100001765 | 3300005614 | Bacteria | 22633 |
| 83 | Ga0068856_100040619 | 3300005614 | Unclassified | 4570 |
| 84 | Ga0068856_100108323 | 3300005614 | Unclassified | 2775 |
| 85 | Ga0068856_100109210 | 3300005614 | Unclassified | 2762 |
| 86 | Ga0068856_100388100 | 3300005614 | Bacteria | 1416 |
| 87 | Ga0070702_100045857 | 3300005615 | Bacteria | 2475 |
| 88 | Ga0068859_100252349 | 3300005617 | Bacteria | 1854 |
| 89 | Ga0068859_101284629 | 3300005617 | Unclassified | 806 |
| 90 | Ga0068864_100025145 | 3300005618 | Bacteria | 5013 |
| 91 | Ga0068864_100077956 | 3300005618 | Bacteria | 2899 |
| 92 | Ga0068866_10059515 | 3300005718 | Bacteria | 1977 |
| 93 | Ga0068851_10088132 | 3300005834 | Unclassified | 1630 |
| 94 | Ga0068870_10281061 | 3300005840 | Unclassified | 1043 |
| 95 | Ga0068863_100032524 | 3300005841 | Unclassified | 4972 |
| 96 | Ga0068863_100329298 | 3300005841 | Bacteria | 1485 |
| 97 | Ga0068863_100540259 | 3300005841 | Unclassified | 1150 |
| 98 | Ga0068858_100026917 | 3300005842 | Bacteria | 5341 |
| 99 | Ga0068858_100089192 | 3300005842 | Unclassified | 2869 |
| 100 | Ga0068860_100199158 | 3300005843 | Bacteria | 1940 |
| 101 | Ga0068860_100276348 | 3300005843 | Bacteria | 1640 |
| 102 | Ga0070717_10009905 | 3300006028 | Bacteria | 7176 |
| 103 | Ga0070717_10011899 | 3300006028 | Bacteria | 6621 |
| 104 | Ga0070717_10016286 | 3300006028 | Bacteria | 5762 |
| 105 | Ga0070717_10022426 | 3300006028 | Bacteria | 4988 |
| 106 | Ga0070717_10059344 | 3300006028 | Bacteria | 3165 |
| 107 | Ga0070717_10297764 | 3300006028 | Unclassified | 1434 |
| 108 | Ga0070717_10311719 | 3300006028 | Unclassified | 1401 |
| 109 | Ga0070717_10322913 | 3300006028 | Unclassified | 1376 |
| 110 | Ga0070716_100000263 | 3300006173 | Bacteria | 21048 |
| 111 | Ga0070716_100011035 | 3300006173 | Unclassified | 4544 |
| 112 | Ga0070716_100084326 | 3300006173 | Bacteria | 1905 |
| 113 | Ga0070712_100008128 | 3300006175 | Bacteria | 6588 |
| 114 | Ga0070712_100047230 | 3300006175 | Bacteria | 2979 |
| 115 | Ga0070712_100244240 | 3300006175 | Unclassified | 1431 |
| 116 | Ga0070712_100750541 | 3300006175 | Unclassified | 835 |
| 117 | Ga0070712_100752817 | 3300006175 | Bacteria | 834 |
| 118 | Ga0070712_100814124 | 3300006175 | Unclassified | 802 |
| 119 | Ga0097621_100014609 | 3300006237 | Bacteria | 5883 |
| 120 | Ga0068871_100000703 | 3300006358 | Bacteria | 22748 |
| 121 | Ga0068871_100012980 | 3300006358 | Bacteria | 6169 |
| 122 | Ga0075433_10024736 | 3300006852 | Bacteria | 5071 |
| 123 | Ga0075434_100020468 | 3300006871 | Bacteria | 6418 |
| 124 | Ga0068865_100060497 | 3300006881 | Unclassified | 2652 |
| 125 | Ga0075436_100002999 | 3300006914 | Bacteria | 11561 |
| 126 | Ga0075436_100018779 | 3300006914 | Unclassified | 4735 |
| 127 | Ga0097620_100252343 | 3300006931 | Bacteria | 1854 |
| 128 | Ga0097620_101284556 | 3300006931 | Unclassified | 806 |
| 129 | Ga0075435_100004776 | 3300007076 | Bacteria | 9361 |
| 130 | Ga0105240_10006540 | 3300009093 | Bacteria | 17111 |
| 131 | Ga0105245_10094488 | 3300009098 | Bacteria | 2756 |
| 132 | Ga0105245_10669900 | 3300009098 | Unclassified | 1069 |
| 133 | Ga0105245_10902507 | 3300009098 | Unclassified | 925 |
| 134 | Ga0105247_10162046 | 3300009101 | Unclassified | 1481 |
| 135 | Ga0105247_10276568 | 3300009101 | Unclassified | 1157 |
| 136 | Ga0105243_10166806 | 3300009148 | Bacteria | 1904 |
| 137 | Ga0105241_10028917 | 3300009174 | Unclassified | 4130 |
| 138 | Ga0105241_10077233 | 3300009174 | Unclassified | 2599 |
| 139 | Ga0105241_10125569 | 3300009174 | Unclassified | 2071 |
| 140 | Ga0105242_10039763 | 3300009176 | Bacteria | 3786 |
| 141 | Ga0105248_10019916 | 3300009177 | Bacteria | 7426 |
| 142 | Ga0105248_10054895 | 3300009177 | Bacteria | 4469 |
| 143 | Ga0105248_11315446 | 3300009177 | Unclassified | 818 |
| 144 | Ga0105249_10128230 | 3300009553 | Unclassified | 2419 |
| 145 | Ga0105239_10264650 | 3300010375 | Unclassified | 1933 |
| 146 | Ga0105246_10192975 | 3300011119 | Bacteria | 1578 |
| 147 | Ga0157373_10560163 | 3300013100 | Unclassified | 829 |
| 148 | Ga0157369_10018318 | 3300013105 | Bacteria | 7852 |
| 149 | Ga0157369_10083545 | 3300013105 | Bacteria | 3415 |
| 150 | Ga0157369_10100810 | 3300013105 | Unclassified | 3078 |
| 151 | Ga0157369_10235273 | 3300013105 | Bacteria | 1914 |
| 152 | Ga0157374_10000394 | 3300013296 | Bacteria | 39643 |
| 153 | Ga0157374_10000651 | 3300013296 | Bacteria | 30638 |
| 154 | Ga0157374_10042088 | 3300013296 | Unclassified | 4213 |
| 155 | Ga0157378_10000523 | 3300013297 | Bacteria | 36450 |
| 156 | Ga0157378_10005113 | 3300013297 | Bacteria | 11517 |
| 157 | Ga0157378_10036744 | 3300013297 | Bacteria | 4335 |
| 158 | Ga0157378_10072465 | 3300013297 | Bacteria | 3095 |
| 159 | Ga0163162_10033035 | 3300013306 | Bacteria | 5140 |
| 160 | Ga0163162_10085498 | 3300013306 | Bacteria | 3231 |
| 161 | Ga0163162_10489221 | 3300013306 | Bacteria | 1361 |
| 162 | Ga0157372_10001945 | 3300013307 | Bacteria | 22420 |
| 163 | Ga0157372_10007172 | 3300013307 | Bacteria | 11863 |
| 164 | Ga0157372_10040835 | 3300013307 | Bacteria | 5127 |
| 165 | Ga0157372_10246107 | 3300013307 | Bacteria | 2075 |
| 166 | Ga0157372_10450320 | 3300013307 | Unclassified | 1500 |
| 167 | Ga0157372_10501533 | 3300013307 | Bacteria | 1415 |
| 168 | Ga0157372_10621611 | 3300013307 | Unclassified | 1259 |
| 169 | Ga0157375_10691707 | 3300013308 | Unclassified | 1174 |
| 170 | Ga0163163_10000945 | 3300014325 | Bacteria | 24672 |
| 171 | Ga0163163_10066160 | 3300014325 | Unclassified | 3589 |
| 172 | Ga0157377_10177304 | 3300014745 | Unclassified | 1337 |
| 173 | Ga0157376_10001308 | 3300014969 | Bacteria | 16411 |
| 174 | Ga0163161_10112223 | 3300017792 | Unclassified | 2039 |
| 175 | Ga0184594_104785 | 3300019181 | Unclassified | 890 |
| 176 | Ga0184598_131339 | 3300019182 | Bacteria | 1195 |
| 177 | Ga0224570_100643 | 3300022730 | Unclassified | 2772 |
| 178 | Ga0224571_100389 | 3300022734 | Bacteria | 2380 |
| 179 | Ga0224572_1002026 | 3300024225 | Unclassified | 3182 |
| 180 | Ga0224572_1018872 | 3300024225 | Unclassified | 1325 |
| 181 | Ga0228598_1006268 | 3300024227 | Unclassified | 2465 |
| 182 | Ga0228598_1015538 | 3300024227 | Bacteria | 1502 |
| 183 | Ga0207696_1058473 | 3300025711 | Unclassified | 1088 |
| 184 | Ga0207682_10131209 | 3300025893 | Unclassified | 1119 |
| 185 | Ga0207692_10012414 | 3300025898 | Bacteria | 3658 |
| 186 | Ga0207642_10069317 | 3300025899 | Bacteria | 1672 |
| 187 | Ga0207647_10015305 | 3300025904 | Bacteria | 5262 |
| 188 | Ga0207647_10096948 | 3300025904 | Unclassified | 1754 |
| 189 | Ga0207699_10089650 | 3300025906 | Bacteria | 1928 |
| 190 | Ga0207699_10311629 | 3300025906 | Bacteria | 1101 |
| 191 | Ga0207645_10074641 | 3300025907 | Unclassified | 2171 |
| 192 | Ga0207643_10049994 | 3300025908 | Unclassified | 2370 |
| 193 | Ga0207643_10171589 | 3300025908 | Bacteria | 1309 |
| 194 | Ga0207684_10001251 | 3300025910 | Bacteria | 28180 |
| 195 | Ga0207684_10002315 | 3300025910 | Bacteria | 19334 |
| 196 | Ga0207684_10031943 | 3300025910 | Bacteria | 4479 |
| 197 | Ga0207684_10034505 | 3300025910 | Bacteria | 4298 |
| 198 | Ga0207654_10030496 | 3300025911 | Bacteria | 2960 |
| 199 | Ga0207654_10058774 | 3300025911 | Unclassified | 2240 |
| 200 | Ga0207695_10129004 | 3300025913 | Unclassified | 2487 |
| 201 | Ga0207671_10350748 | 3300025914 | Unclassified | 1170 |
| 202 | Ga0207693_10009275 | 3300025915 | Bacteria | 8032 |
| 203 | Ga0207693_10064431 | 3300025915 | Unclassified | 2871 |
| 204 | Ga0207693_10070690 | 3300025915 | Bacteria | 2731 |
| 205 | Ga0207693_10219428 | 3300025915 | Unclassified | 1494 |
| 206 | Ga0207693_10752605 | 3300025915 | Bacteria | 753 |
| 207 | Ga0207663_10009477 | 3300025916 | Bacteria | 5144 |
| 208 | Ga0207663_10015173 | 3300025916 | Bacteria | 4243 |
| 209 | Ga0207663_10073040 | 3300025916 | Bacteria | 2219 |
| 210 | Ga0207663_10304419 | 3300025916 | Unclassified | 1192 |
| 211 | Ga0207660_10108755 | 3300025917 | Bacteria | 2083 |
| 212 | Ga0207657_10046009 | 3300025919 | Bacteria | 3824 |
| 213 | Ga0207649_10003300 | 3300025920 | Bacteria | 8833 |
| 214 | Ga0207646_10003151 | 3300025922 | Bacteria | 18896 |
| 215 | Ga0207646_10122228 | 3300025922 | Unclassified | 2339 |
| 216 | Ga0207646_10207963 | 3300025922 | Bacteria | 1767 |
| 217 | Ga0207646_10220682 | 3300025922 | Unclassified | 1713 |
| 218 | Ga0207646_10561596 | 3300025922 | Bacteria | 1026 |
| 219 | Ga0207646_10701736 | 3300025922 | Bacteria | 905 |
| 220 | Ga0207650_10000090 | 3300025925 | Bacteria | 118973 |
| 221 | Ga0207659_10014386 | 3300025926 | Bacteria | 5101 |
| 222 | Ga0207687_10149308 | 3300025927 | Bacteria | 1781 |
| 223 | Ga0207700_10010898 | 3300025928 | Bacteria | 5770 |
| 224 | Ga0207700_10175311 | 3300025928 | Bacteria | 1792 |
| 225 | Ga0207700_10236651 | 3300025928 | Bacteria | 1555 |
| 226 | Ga0207664_10190034 | 3300025929 | Bacteria | 1767 |
| 227 | Ga0207664_10191673 | 3300025929 | Unclassified | 1760 |
| 228 | Ga0207664_10992832 | 3300025929 | Bacteria | 752 |
| 229 | Ga0207644_10072186 | 3300025931 | Unclassified | 2527 |
| 230 | Ga0207709_10162575 | 3300025935 | Bacteria | 1558 |
| 231 | Ga0207670_10074609 | 3300025936 | Unclassified | 2355 |
| 232 | Ga0207704_10098013 | 3300025938 | Unclassified | 1946 |
| 233 | Ga0207704_10392441 | 3300025938 | Unclassified | 1093 |
| 234 | Ga0207665_10002589 | 3300025939 | Bacteria | 12159 |
| 235 | Ga0207665_10010003 | 3300025939 | Bacteria | 6227 |
| 236 | Ga0207665_10037292 | 3300025939 | Unclassified | 3235 |
| 237 | Ga0207665_10171161 | 3300025939 | Bacteria | 1569 |
| 238 | Ga0207665_10179235 | 3300025939 | Unclassified | 1534 |
| 239 | Ga0207691_10276684 | 3300025940 | Unclassified | 1445 |
| 240 | Ga0207711_10043019 | 3300025941 | Bacteria | 3851 |
| 241 | Ga0207689_10030677 | 3300025942 | Unclassified | 4480 |
| 242 | Ga0207689_10083777 | 3300025942 | Bacteria | 2621 |
| 243 | Ga0207689_10398433 | 3300025942 | Unclassified | 1147 |
| 244 | Ga0207661_10037397 | 3300025944 | Unclassified | 3796 |
| 245 | Ga0207679_10020124 | 3300025945 | Bacteria | 4499 |
| 246 | Ga0207679_10396388 | 3300025945 | Unclassified | 1213 |
| 247 | Ga0207667_10003430 | 3300025949 | Bacteria | 19570 |
| 248 | Ga0207667_10035572 | 3300025949 | Bacteria | 5342 |
| 249 | Ga0207667_10676956 | 3300025949 | Unclassified | 1035 |
| 250 | Ga0207712_10113905 | 3300025961 | Bacteria | 2033 |
| 251 | Ga0207712_10180904 | 3300025961 | Unclassified | 1656 |
| 252 | Ga0207640_10254805 | 3300025981 | Bacteria | 1364 |
| 253 | Ga0207677_10107556 | 3300026023 | Unclassified | 2069 |
| 254 | Ga0207677_10110735 | 3300026023 | Bacteria | 2044 |
| 255 | Ga0207677_10542447 | 3300026023 | Unclassified | 1012 |
| 256 | Ga0207639_10468024 | 3300026041 | Bacteria | 1147 |
| 257 | Ga0207639_10484711 | 3300026041 | Unclassified | 1127 |
| 258 | Ga0207708_10149828 | 3300026075 | Unclassified | 1835 |
| 259 | Ga0207702_10004513 | 3300026078 | Bacteria | 12344 |
| 260 | Ga0207702_10038005 | 3300026078 | Bacteria | 4032 |
| 261 | Ga0207702_10308854 | 3300026078 | Bacteria | 1503 |
| 262 | Ga0207702_10550297 | 3300026078 | Unclassified | 1129 |
| 263 | Ga0207641_10001842 | 3300026088 | Bacteria | 20372 |
| 264 | Ga0207641_10174958 | 3300026088 | Unclassified | 1962 |
| 265 | Ga0207641_10923815 | 3300026088 | Unclassified | 867 |
| 266 | Ga0207648_10036003 | 3300026089 | Bacteria | 4361 |
| 267 | Ga0207648_10043729 | 3300026089 | Unclassified | 3932 |
| 268 | Ga0207648_10223147 | 3300026089 | Unclassified | 1675 |
| 269 | Ga0207676_10014579 | 3300026095 | Bacteria | 5659 |
| 270 | Ga0207676_10015126 | 3300026095 | Bacteria | 5565 |
| 271 | Ga0207674_10005128 | 3300026116 | Bacteria | 15632 |
| 272 | Ga0207674_10006859 | 3300026116 | Bacteria | 13355 |
| 273 | Ga0207675_100082245 | 3300026118 | Unclassified | 3020 |
| 274 | Ga0207675_100238944 | 3300026118 | Bacteria | 1755 |
| 275 | Ga0207683_10064946 | 3300026121 | Bacteria | 3217 |
| 276 | Ga0207683_10527347 | 3300026121 | Bacteria | 1091 |
| 277 | Ga0207698_10366322 | 3300026142 | Unclassified | 1366 |
| 278 | Ga0209588_1104179 | 3300027671 | Unclassified | 912 |
| 279 | Ga0265356_1000038 | 3300028017 | Bacteria | 21148 |
| 280 | Ga0265356_1001709 | 3300028017 | Bacteria | 3145 |
| 281 | Ga0265356_1006669 | 3300028017 | Bacteria | 1344 |
| 282 | Ga0268266_10481124 | 3300028379 | Unclassified | 1183 |
| 283 | Ga0268264_10132213 | 3300028381 | Bacteria | 2214 |
| 284 | Ga0268264_10856985 | 3300028381 | Unclassified | 910 |
| 285 | Ga0265336_10037850 | 3300028666 | Unclassified | 1482 |
| 286 | Ga0265338_10023798 | 3300028800 | Bacteria | 6281 |
| 287 | Ga0265338_10028521 | 3300028800 | Bacteria | 5564 |
| 288 | Ga0265338_10031367 | 3300028800 | Bacteria | 5212 |
| 289 | Ga0265338_10039557 | 3300028800 | Unclassified | 4446 |
| 290 | Ga0265338_10045518 | 3300028800 | Bacteria | 4033 |
| 291 | Ga0265338_10047321 | 3300028800 | Bacteria | 3929 |
| 292 | Ga0265338_10058006 | 3300028800 | Bacteria | 3421 |
| 293 | Ga0265338_10237959 | 3300028800 | Unclassified | 1350 |
| 294 | Ga0265338_10258119 | 3300028800 | Bacteria | 1282 |
| 295 | Ga0265762_1000529 | 3300030760 | Bacteria | 6693 |
| 296 | Ga0265762_1001167 | 3300030760 | Bacteria | 4748 |
| 297 | Ga0265762_1046623 | 3300030760 | Bacteria | 861 |
| 298 | Ga0265762_1053529 | 3300030760 | Unclassified | 816 |
| 299 | Ga0265760_10000366 | 3300031090 | Bacteria | 12614 |
| 300 | Ga0265760_10000604 | 3300031090 | Bacteria | 10223 |
| 301 | Ga0265760_10005098 | 3300031090 | Bacteria | 3761 |
| 302 | Ga0265760_10009879 | 3300031090 | Bacteria | 2723 |
| 303 | Ga0265340_10114251 | 3300031247 | Bacteria | 1246 |
| 304 | Ga0265339_10057362 | 3300031249 | Unclassified | 2106 |
| 305 | Ga0265339_10059035 | 3300031249 | Unclassified | 2069 |
| 306 | Ga0265316_10006355 | 3300031344 | Bacteria | 11301 |
| 307 | Ga0265316_10010717 | 3300031344 | Bacteria | 8329 |
| 308 | Ga0265316_10021042 | 3300031344 | Bacteria | 5534 |
| 309 | Ga0265316_10024171 | 3300031344 | Bacteria | 5098 |
| 310 | Ga0265314_10005940 | 3300031711 | Bacteria | 10912 |
| 311 | Ga0265314_10026030 | 3300031711 | Bacteria | 4402 |
| 312 | Ga0265314_10046701 | 3300031711 | Bacteria | 3053 |
| 313 | Ga0316212_1010698 | 3300033547 | Bacteria | 1314 |
| 314 | Ga0373926_0057064 | 3300035083 | Bacteria | 1418 |
| 315 | Ga0373944_0087707 | 3300035089 | Bacteria | 1036 |
| 316 | Ga0373943_0116233 | 3300035170 | Unclassified | 1417 |
| 317 | Ga0373935_0071396 | 3300035692 | Bacteria | 2240 |
| 318 | Ga0373927_0191196 | 3300035695 | Bacteria | 1343 |
| 319 | Ga0373927_0326308 | 3300035695 | Bacteria | 1011 |
| 320 | Ga0373927_0435553 | 3300035695 | Unclassified | 866 |
| 321 | Ga0373947_0014690 | 3300035725 | Bacteria | 4492 |
| 322 | Ga0373937_0171126 | 3300036401 | Bacteria | 2038 |
| 323 | Ga0373925_0039806 | 3300037068 | Bacteria | 3478 |
| 324 | Ga0373925_0340981 | 3300037068 | Bacteria | 1216 |
| 325 | Ga0373925_0483830 | 3300037068 | Unclassified | 1015 |
| 326 | Ga0451576_0382249 | 3300045051 | Bacteria | 1476 |
| 327 | Ga0451576_1150028 | 3300045051 | Unclassified | 811 |
| 328 | Ga0495629_0252218 | 3300046459 | Bacteria | 1214 |
| 329 | Ga0495651_0012155 | 3300046462 | Bacteria | 6628 |
| 330 | Ga0495653_0026033 | 3300046463 | Bacteria | 4695 |
| 331 | Ga0495580_0035807 | 3300046472 | Bacteria | 3568 |
| 332 | Ga0495580_0142142 | 3300046472 | Bacteria | 1663 |
| 333 | Ga0495580_0174211 | 3300046472 | Bacteria | 1486 |
| 334 | Ga0495580_0315305 | 3300046472 | Bacteria | 1063 |
| 335 | Ga0495662_0028613 | 3300046476 | Bacteria | 2690 |
| 336 | Ga0495664_0099360 | 3300046477 | Bacteria | 1752 |
| 337 | Ga0495608_0043978 | 3300046511 | Bacteria | 2983 |
| 338 | Ga0495618_0177682 | 3300046514 | Bacteria | 1353 |
| 339 | Ga0495628_0093413 | 3300046516 | Bacteria | 2326 |
| 340 | Ga0495630_0283575 | 3300046517 | Bacteria | 1265 |
| 341 | Ga0495630_0316555 | 3300046517 | Unclassified | 1193 |
| 342 | Ga0495642_0164977 | 3300046528 | Unclassified | 961 |
| 343 | Ga0495652_0057120 | 3300046529 | Bacteria | 3311 |
| 344 | Ga0495665_0107045 | 3300046531 | Bacteria | 1467 |
| 345 | Ga0495640_0021904 | 3300046533 | Bacteria | 4681 |
| 346 | Ga0495586_0173274 | 3300046535 | Bacteria | 1219 |
| 347 | Ga0495587_0018617 | 3300046536 | Bacteria | 4306 |
| 348 | Ga0495667_0075545 | 3300046559 | Bacteria | 2192 |
| 349 | Ga0495634_0119948 | 3300046642 | Bacteria | 1684 |
| 350 | Ga0495657_0036491 | 3300046675 | Bacteria | 3397 |
| 351 | Ga0495599_0000592 | 3300046678 | Bacteria | 20701 |
| 352 | Ga0495623_0077405 | 3300046679 | Bacteria | 2062 |
| 353 | Ga0495613_0516551 | 3300046689 | Unclassified | 803 |
| 354 | Ga0495670_0248586 | 3300046691 | Bacteria | 948 |
| 355 | Ga0495600_0041808 | 3300046809 | Bacteria | 2988 |
| 356 | Ga0495604_0157840 | 3300047317 | Bacteria | 1605 |
| 357 | Ga0495674_0077901 | 3300047319 | Bacteria | 2849 |
| 358 | Ga0495674_0284324 | 3300047319 | Unclassified | 1354 |
| 359 | Ga0495674_0447784 | 3300047319 | Bacteria | 1038 |
| 360 | Ga0495680_0017489 | 3300047322 | Bacteria | 6120 |
| 361 | Ga0495675_0027949 | 3300047444 | Unclassified | 3595 |
| 362 | Ga0495684_0007863 | 3300047471 | Bacteria | 8251 |
| 363 | Ga0495602_0093660 | 3300048088 | Bacteria | 2485 |
| 364 | Ga0496102_0114134 | 3300048905 | Plasmid | 2520 |
| 365 | Ga0496102_0346052 | 3300048905 | Unclassified | 1400 |
| 366 | Ga0496102_0360518 | 3300048905 | Unclassified | 1369 |
| 367 | Ga0496103_0109365 | 3300048906 | Unclassified | 1755 |
| 368 | Ga0496106_0037811 | 3300048909 | Plasmid | 3611 |
| 369 | Ga0496108_0050410 | 3300048911 | Unclassified | 3485 |
| 370 | Ga0496109_0047103 | 3300048912 | Unclassified | 3918 |
| 371 | Ga0496110_0044363 | 3300048913 | Unclassified | 3883 |
| 372 | Ga0496112_0000506 | 3300048915 | Bacteria | 26406 |
| 373 | Ga0496113_0045568 | 3300048916 | Unclassified | 3253 |
| 374 | Ga0496115_0749260 | 3300048918 | Unclassified | 764 |
| 375 | nmdc:mga05p37_418500_c1 | 3300050507 | Unclassified | 1560 |
| 376 | nmdc:mga09592_149677_c1 | 3300050508 | Unclassified | 2013 |
| 377 | nmdc:mga08y16_19410_c1 | 3300050511 | Bacteria | 7167 |
| 378 | nmdc:mga0n895_484_c1 | 3300050512 | Bacteria | 26835 |
| 379 | nmdc:mga0rr50_1774_c1 | 3300050513 | Bacteria | 11916 |
| 380 | nmdc:mga08x19_1846_c1 | 3300050514 | Bacteria | 12979 |
| 381 | nmdc:mga08x19_24090_c1 | 3300050514 | Unclassified | 3779 |
| 382 | nmdc:mga0a205_2913_c1 | 3300050515 | Bacteria | 13157 |
| 383 | Ga0373947_0112635 | |||
| 384 | Ga0065704_10036268 | |||
| 385 | Ga0065715_10195936 | |||
| 386 | Ga0070658_10687100 | |||
| 387 | Ga0070690_100107830 | |||
| 388 | Ga0070670_100206174 | |||
| 389 | Ga0068869_100044433 | |||
| 390 | Ga0068869_100261637 | |||
| 391 | Ga0068868_100018866 | |||
| 392 | Ga0068868_100082333 | |||
| 393 | Ga0070660_100089728 | |||
| 394 | Ga0070660_100159147 | |||
| 395 | Ga0070660_100207353 | |||
| 396 | Ga0070689_100155134 | |||
| 397 | Ga0070661_100002374 | |||
| 398 | Ga0070671_100235241 | |||
| 399 | Ga0070673_100135168 | |||
| 400 | Ga0070709_10101710 | |||
| 401 | Ga0070709_10150743 | |||
| 402 | Ga0070709_10375414 | |||
| 403 | Ga0070714_100164824 | |||
| 404 | Ga0070714_100299432 | |||
| 405 | Ga0070714_100854349 | |||
| 406 | Ga0070713_100018413 | |||
| 407 | Ga0070713_100147961 | |||
| 408 | Ga0070713_100240448 | |||
| 409 | Ga0070713_100834200 | |||
| 410 | Ga0070710_10244627 | |||
| 411 | Ga0070711_100041700 | |||
| 412 | Ga0070711_100147569 | |||
| 413 | Ga0070711_100276570 | |||
| 414 | Ga0070708_100001221 | |||
| 415 | Ga0070708_100003962 | |||
| 416 | Ga0070708_100018534 | |||
| 417 | Ga0070708_100021702 | |||
| 418 | Ga0070708_100030068 | |||
| 419 | Ga0070708_100139977 | |||
| 420 | Ga0070678_100042985 | |||
| 421 | Ga0070678_100304523 | |||
| 422 | Ga0070662_100232067 | |||
| 423 | Ga0070681_10023083 | |||
| 424 | Ga0070681_10555485 | |||
| 425 | Ga0070681_10565075 | |||
| 426 | Ga0068867_100030361 | |||
| 427 | Ga0068867_100336969 | |||
| 428 | Ga0068867_100622033 | |||
| 429 | Ga0070685_10031683 | |||
| 430 | Ga0070706_100002274 | |||
| 431 | Ga0070706_100019120 | |||
| 432 | Ga0070706_100467505 | |||
| 433 | Ga0070707_100025190 | |||
| 434 | Ga0070707_100026214 | |||
| 435 | Ga0070707_100036167 | |||
| 436 | Ga0070707_100110670 | |||
| 437 | Ga0070707_100224373 | |||
| 438 | Ga0070707_100275466 | |||
| 439 | Ga0070707_100607107 | |||
| 440 | Ga0070707_100995053 | |||
| 441 | Ga0070698_100004288 | |||
| 442 | Ga0070698_100054737 | |||
| 443 | Ga0070699_100002162 | |||
| 444 | Ga0070699_100029898 | |||
| 445 | Ga0070699_100041207 | |||
| 446 | Ga0070679_100093767 | |||
| 447 | Ga0070697_100000488 | |||
| 448 | Ga0070697_100005380 | |||
| 449 | Ga0070697_100006673 | |||
| 450 | Ga0070697_100037255 | |||
| 451 | Ga0070697_100112494 | |||
| 452 | Ga0070697_100311081 | |||
| 453 | Ga0068853_100147720 | |||
| 454 | Ga0068853_100228165 | |||
| 455 | Ga0070672_100220865 | |||
| 456 | Ga0068855_100040458 | |||
| 457 | Ga0068855_100044774 | |||
| 458 | Ga0068855_100099376 | |||
| 459 | Ga0070664_100037583 | |||
| 460 | Ga0068857_100003152 | |||
| 461 | Ga0068857_100006131 | |||
| 462 | Ga0068854_100028243 | |||
| 463 | Ga0068854_100215347 | |||
| 464 | Ga0068856_100001765 | |||
| 465 | Ga0068856_100040619 | |||
| 466 | Ga0068856_100108323 | |||
| 467 | Ga0068856_100109210 | |||
| 468 | Ga0068856_100388100 | |||
| 469 | Ga0070702_100045857 | |||
| 470 | Ga0068859_100252349 | |||
| 471 | Ga0068859_101284629 | |||
| 472 | Ga0068864_100025145 | |||
| 473 | Ga0068864_100077956 | |||
| 474 | Ga0068866_10059515 | |||
| 475 | Ga0068851_10088132 | |||
| 476 | Ga0068870_10281061 | |||
| 477 | Ga0068863_100032524 | |||
| 478 | Ga0068863_100329298 | |||
| 479 | Ga0068863_100540259 | |||
| 480 | Ga0068858_100026917 | |||
| 481 | Ga0068858_100089192 | |||
| 482 | Ga0068860_100199158 | |||
| 483 | Ga0068860_100276348 | |||
| 484 | Ga0070717_10009905 | |||
| 485 | Ga0070717_10011899 | |||
| 486 | Ga0070717_10016286 | |||
| 487 | Ga0070717_10022426 | |||
| 488 | Ga0070717_10059344 | |||
| 489 | Ga0070717_10297764 | |||
| 490 | Ga0070717_10311719 | |||
| 491 | Ga0070717_10322913 | |||
| 492 | Ga0070716_100000263 | |||
| 493 | Ga0070716_100011035 | |||
| 494 | Ga0070716_100084326 | |||
| 495 | Ga0070712_100008128 | |||
| 496 | Ga0070712_100047230 | |||
| 497 | Ga0070712_100244240 | |||
| 498 | Ga0070712_100750541 | |||
| 499 | Ga0070712_100752817 | |||
| 500 | Ga0070712_100814124 | |||
| 501 | Ga0097621_100014609 | |||
| 502 | Ga0068871_100000703 | |||
| 503 | Ga0068871_100012980 | |||
| 504 | Ga0075433_10024736 | |||
| 505 | Ga0075434_100020468 | |||
| 506 | Ga0068865_100060497 | |||
| 507 | Ga0075436_100002999 | |||
| 508 | Ga0075436_100018779 | |||
| 509 | Ga0097620_100252343 | |||
| 510 | Ga0097620_101284556 | |||
| 511 | Ga0075435_100004776 | |||
| 512 | Ga0105240_10006540 | |||
| 513 | Ga0105245_10094488 | |||
| 514 | Ga0105245_10669900 | |||
| 515 | Ga0105245_10902507 | |||
| 516 | Ga0105247_10162046 | |||
| 517 | Ga0105247_10276568 | |||
| 518 | Ga0105243_10166806 | |||
| 519 | Ga0105241_10028917 | |||
| 520 | Ga0105241_10077233 | |||
| 521 | Ga0105241_10125569 | |||
| 522 | Ga0105242_10039763 | |||
| 523 | Ga0105248_10019916 | |||
| 524 | Ga0105248_10054895 | |||
| 525 | Ga0105248_11315446 | |||
| 526 | Ga0105249_10128230 | |||
| 527 | Ga0105239_10264650 | |||
| 528 | Ga0105246_10192975 | |||
| 529 | Ga0157373_10560163 | |||
| 530 | Ga0157369_10018318 | |||
| 531 | Ga0157369_10083545 | |||
| 532 | Ga0157369_10100810 | |||
| 533 | Ga0157369_10235273 | |||
| 534 | Ga0157374_10000394 | |||
| 535 | Ga0157374_10000651 | |||
| 536 | Ga0157374_10042088 | |||
| 537 | Ga0157378_10000523 | |||
| 538 | Ga0157378_10005113 | |||
| 539 | Ga0157378_10036744 | |||
| 540 | Ga0157378_10072465 | |||
| 541 | Ga0163162_10033035 | |||
| 542 | Ga0163162_10085498 | |||
| 543 | Ga0163162_10489221 | |||
| 544 | Ga0157372_10001945 | |||
| 545 | Ga0157372_10007172 | |||
| 546 | Ga0157372_10040835 | |||
| 547 | Ga0157372_10246107 | |||
| 548 | Ga0157372_10450320 | |||
| 549 | Ga0157372_10501533 | |||
| 550 | Ga0157372_10621611 | |||
| 551 | Ga0157375_10691707 | |||
| 552 | Ga0163163_10000945 | |||
| 553 | Ga0163163_10066160 | |||
| 554 | Ga0157377_10177304 | |||
| 555 | Ga0157376_10001308 | |||
| 556 | Ga0163161_10112223 | |||
| 557 | Ga0184594_104785 | |||
| 558 | Ga0184598_131339 | |||
| 559 | Ga0224570_100643 | |||
| 560 | Ga0224571_100389 | |||
| 561 | Ga0224572_1002026 | |||
| 562 | Ga0224572_1018872 | |||
| 563 | Ga0228598_1006268 | |||
| 564 | Ga0228598_1015538 | |||
| 565 | Ga0207696_1058473 | |||
| 566 | Ga0207682_10131209 | |||
| 567 | Ga0207692_10012414 | |||
| 568 | Ga0207642_10069317 | |||
| 569 | Ga0207647_10015305 | |||
| 570 | Ga0207647_10096948 | |||
| 571 | Ga0207699_10089650 | |||
| 572 | Ga0207699_10311629 | |||
| 573 | Ga0207645_10074641 | |||
| 574 | Ga0207643_10049994 | |||
| 575 | Ga0207643_10171589 | |||
| 576 | Ga0207684_10001251 | |||
| 577 | Ga0207684_10002315 | |||
| 578 | Ga0207684_10031943 | |||
| 579 | Ga0207684_10034505 | |||
| 580 | Ga0207654_10030496 | |||
| 581 | Ga0207654_10058774 | |||
| 582 | Ga0207695_10129004 | |||
| 583 | Ga0207671_10350748 | |||
| 584 | Ga0207693_10009275 | |||
| 585 | Ga0207693_10064431 | |||
| 586 | Ga0207693_10070690 | |||
| 587 | Ga0207693_10219428 | |||
| 588 | Ga0207693_10752605 | |||
| 589 | Ga0207663_10009477 | |||
| 590 | Ga0207663_10015173 | |||
| 591 | Ga0207663_10073040 | |||
| 592 | Ga0207663_10304419 | |||
| 593 | Ga0207660_10108755 | |||
| 594 | Ga0207657_10046009 | |||
| 595 | Ga0207649_10003300 | |||
| 596 | Ga0207646_10003151 | |||
| 597 | Ga0207646_10122228 | |||
| 598 | Ga0207646_10207963 | |||
| 599 | Ga0207646_10220682 | |||
| 600 | Ga0207646_10561596 | |||
| 601 | Ga0207646_10701736 | |||
| 602 | Ga0207650_10000090 | |||
| 603 | Ga0207659_10014386 | |||
| 604 | Ga0207687_10149308 | |||
| 605 | Ga0207700_10010898 | |||
| 606 | Ga0207700_10175311 | |||
| 607 | Ga0207700_10236651 | |||
| 608 | Ga0207664_10190034 | |||
| 609 | Ga0207664_10191673 | |||
| 610 | Ga0207664_10992832 | |||
| 611 | Ga0207644_10072186 | |||
| 612 | Ga0207709_10162575 | |||
| 613 | Ga0207670_10074609 | |||
| 614 | Ga0207704_10098013 | |||
| 615 | Ga0207704_10392441 | |||
| 616 | Ga0207665_10002589 | |||
| 617 | Ga0207665_10010003 | |||
| 618 | Ga0207665_10037292 | |||
| 619 | Ga0207665_10171161 | |||
| 620 | Ga0207665_10179235 | |||
| 621 | Ga0207691_10276684 | |||
| 622 | Ga0207711_10043019 | |||
| 623 | Ga0207689_10030677 | |||
| 624 | Ga0207689_10083777 | |||
| 625 | Ga0207689_10398433 | |||
| 626 | Ga0207661_10037397 | |||
| 627 | Ga0207679_10020124 | |||
| 628 | Ga0207679_10396388 | |||
| 629 | Ga0207667_10003430 | |||
| 630 | Ga0207667_10035572 | |||
| 631 | Ga0207667_10676956 | |||
| 632 | Ga0207712_10113905 | |||
| 633 | Ga0207712_10180904 | |||
| 634 | Ga0207640_10254805 | |||
| 635 | Ga0207677_10107556 | |||
| 636 | Ga0207677_10110735 | |||
| 637 | Ga0207677_10542447 | |||
| 638 | Ga0207639_10468024 | |||
| 639 | Ga0207639_10484711 | |||
| 640 | Ga0207708_10149828 | |||
| 641 | Ga0207702_10004513 | |||
| 642 | Ga0207702_10038005 | |||
| 643 | Ga0207702_10308854 | |||
| 644 | Ga0207702_10550297 | |||
| 645 | Ga0207641_10001842 | |||
| 646 | Ga0207641_10174958 | |||
| 647 | Ga0207641_10923815 | |||
| 648 | Ga0207648_10036003 | |||
| 649 | Ga0207648_10043729 | |||
| 650 | Ga0207648_10223147 | |||
| 651 | Ga0207676_10014579 | |||
| 652 | Ga0207676_10015126 | |||
| 653 | Ga0207674_10005128 | |||
| 654 | Ga0207674_10006859 | |||
| 655 | Ga0207675_100082245 | |||
| 656 | Ga0207675_100238944 | |||
| 657 | Ga0207683_10064946 | |||
| 658 | Ga0207683_10527347 | |||
| 659 | Ga0207698_10366322 | |||
| 660 | Ga0209588_1104179 | |||
| 661 | Ga0265356_1000038 | |||
| 662 | Ga0265356_1001709 | |||
| 663 | Ga0265356_1006669 | |||
| 664 | Ga0268266_10481124 | |||
| 665 | Ga0268264_10132213 | |||
| 666 | Ga0268264_10856985 | |||
| 667 | Ga0265336_10037850 | |||
| 668 | Ga0265338_10023798 | |||
| 669 | Ga0265338_10028521 | |||
| 670 | Ga0265338_10031367 | |||
| 671 | Ga0265338_10039557 | |||
| 672 | Ga0265338_10045518 | |||
| 673 | Ga0265338_10047321 | |||
| 674 | Ga0265338_10058006 | |||
| 675 | Ga0265338_10237959 | |||
| 676 | Ga0265338_10258119 | |||
| 677 | Ga0265762_1000529 | |||
| 678 | Ga0265762_1001167 | |||
| 679 | Ga0265762_1046623 | |||
| 680 | Ga0265762_1053529 | |||
| 681 | Ga0265760_10000366 | |||
| 682 | Ga0265760_10000604 | |||
| 683 | Ga0265760_10005098 | |||
| 684 | Ga0265760_10009879 | |||
| 685 | Ga0265340_10114251 | |||
| 686 | Ga0265339_10057362 | |||
| 687 | Ga0265339_10059035 | |||
| 688 | Ga0265316_10006355 | |||
| 689 | Ga0265316_10010717 | |||
| 690 | Ga0265316_10021042 | |||
| 691 | Ga0265316_10024171 | |||
| 692 | Ga0265314_10005940 | |||
| 693 | Ga0265314_10026030 | |||
| 694 | Ga0265314_10046701 | |||
| 695 | Ga0316212_1010698 | |||
| 696 | Ga0373926_0057064 | |||
| 697 | Ga0373944_0087707 | |||
| 698 | Ga0373943_0116233 | |||
| 699 | Ga0373935_0071396 | |||
| 700 | Ga0373927_0191196 | |||
| 701 | Ga0373927_0326308 | |||
| 702 | Ga0373927_0435553 | |||
| 703 | Ga0373947_0014690 | |||
| 704 | Ga0373937_0171126 | |||
| 705 | Ga0373925_0039806 | |||
| 706 | Ga0373925_0340981 | |||
| 707 | Ga0373925_0483830 | |||
| 708 | Ga0451576_0382249 | |||
| 709 | Ga0451576_1150028 | |||
| 710 | Ga0495629_0252218 | |||
| 711 | Ga0495651_0012155 | |||
| 712 | Ga0495653_0026033 | |||
| 713 | Ga0495580_0035807 | |||
| 714 | Ga0495580_0142142 | |||
| 715 | Ga0495580_0174211 | |||
| 716 | Ga0495580_0315305 | |||
| 717 | Ga0495662_0028613 | |||
| 718 | Ga0495664_0099360 | |||
| 719 | Ga0495608_0043978 | |||
| 720 | Ga0495618_0177682 | |||
| 721 | Ga0495628_0093413 | |||
| 722 | Ga0495630_0283575 | |||
| 723 | Ga0495630_0316555 | |||
| 724 | Ga0495642_0164977 | |||
| 725 | Ga0495652_0057120 | |||
| 726 | Ga0495665_0107045 | |||
| 727 | Ga0495640_0021904 | |||
| 728 | Ga0495586_0173274 | |||
| 729 | Ga0495587_0018617 | |||
| 730 | Ga0495667_0075545 | |||
| 731 | Ga0495634_0119948 | |||
| 732 | Ga0495657_0036491 | |||
| 733 | Ga0495599_0000592 | |||
| 734 | Ga0495623_0077405 | |||
| 735 | Ga0495613_0516551 | |||
| 736 | Ga0495670_0248586 | |||
| 737 | Ga0495600_0041808 | |||
| 738 | Ga0495604_0157840 | |||
| 739 | Ga0495674_0077901 | |||
| 740 | Ga0495674_0284324 | |||
| 741 | Ga0495674_0447784 | |||
| 742 | Ga0495680_0017489 | |||
| 743 | Ga0495675_0027949 | |||
| 744 | Ga0495684_0007863 | |||
| 745 | Ga0495602_0093660 | |||
| 746 | Ga0496102_0114134 | |||
| 747 | Ga0496102_0346052 | |||
| 748 | Ga0496102_0360518 | |||
| 749 | Ga0496103_0109365 | |||
| 750 | Ga0496106_0037811 | |||
| 751 | Ga0496108_0050410 | |||
| 752 | Ga0496109_0047103 | |||
| 753 | Ga0496110_0044363 | |||
| 754 | Ga0496112_0000506 | |||
| 755 | Ga0496113_0045568 | |||
| 756 | Ga0496115_0749260 | |||
| 757 | nmdc:mga05p37_418500_c1 | |||
| 758 | nmdc:mga09592_149677_c1 | |||
| 759 | nmdc:mga08y16_19410_c1 | |||
| 760 | nmdc:mga0n895_484_c1 | |||
| 761 | nmdc:mga0rr50_1774_c1 | |||
| 762 | nmdc:mga08x19_1846_c1 | |||
| 763 | nmdc:mga08x19_24090_c1 | |||
| 764 | nmdc:mga0a205_2913_c1 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j48-assembly2.cif.gz_B | pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp | 0.8896 | 15 | 113 |
| 5kbf-assembly2.cif.gz_B | camp bound pfpka-r (141-441) | 0.8834 | 16 | 112 |
| 4qx5-assembly1.cif.gz_A | neutron diffraction reveals hydrogen bonds critical for cgmp-selective activation: insights for pkg agonist design | 0.8803 | 14 | 113 |
| 4z07-assembly1.cif.gz_C | co-crystal structure of the tandem cnb (cnb-a/b) domains of human pkg i beta with cgmp | 0.8786 | 14 | 113 |
| 5j48-assembly1.cif.gz_A | pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp | 0.8746 | 15 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xkpF01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9392 | 26 | 129 | 2.60.120.10 |
| 2xkpF01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9138 | 26 | 129 | 2.60.120.10 |
| af_A0A2R8Q8R8_221_349_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9128 | 17 | 113 | 2.60.120.10 |
| af_G5EDB9_5_131_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.908 | 25 | 105 | 2.60.120.10 |
| af_O76360_306_441_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9027 | 17 | 113 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7EDL1-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.941 | 27 | 105 |
GO:0005829
|
| AF-A0A672U5I1-F1-model_v4 | Patatin like phospholipase domain containing 7 | 0.9225 | 25 | 132 |
GO:0004622
GO:0005789 GO:0016042 |
| AF-A0A2V7XR34-F1-model_v4 | Crp/Fnr family transcriptional regulator | 0.906 | 26 | 130 |
GO:0005221
GO:0016020 GO:0044877 |
| AF-A0A4Q1ZUQ0-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.9037 | 13 | 141 |
|
| AF-A0A661EYI6-F1-model_v4 | Protein kinase | 0.9025 | 17 | 112 |
GO:0004862
GO:0005829 GO:0005952 GO:0016301 GO:0030552 GO:0034236 |