F429333

General Info

Members Datasets Scaffolds Average Seq Length
382 198 764 223

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0112635|Ga0373947_0112635_191_916
Length 241
Sequence MRPKAAAKKRSEFDPKTFLSTIDGGRKIAAFSKKQTIFVQGDPSDAVFYIQKGRVKLVLVQREMEKRRSPGRVKLTVVSKIGKEATIGILNEGDFFGEGCLTGQPVRLCSAIAMTDCSVMRIDKKSMMEVLHQEHAFSDMFVAYLLTRNIRYEEDLVDQLFNSSEKRLARILLLLAHFGKEGVPETVIPKISQEMLAEMIGTTRSRVSFFMNRFRKLGFIDYDGGSGFQVHSSLLNIVLHD

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
82 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
83 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
84 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
85 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 2.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.88
Rhizosphere 96.86
Stem 0
Stem Tuber 0
Unclassified 36.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0112635 3300035725 Bacteria 1721
2 Ga0065704_10036268 3300005289 Unclassified 993
3 Ga0065715_10195936 3300005293 Unclassified 1388
4 Ga0070658_10687100 3300005327 Unclassified 888
5 Ga0070690_100107830 3300005330 Bacteria 1854
6 Ga0070670_100206174 3300005331 Bacteria 1709
7 Ga0068869_100044433 3300005334 Bacteria 3195
8 Ga0068869_100261637 3300005334 Unclassified 1385
9 Ga0068868_100018866 3300005338 Bacteria 5162
10 Ga0068868_100082333 3300005338 Bacteria 2581
11 Ga0070660_100089728 3300005339 Unclassified 2422
12 Ga0070660_100159147 3300005339 Bacteria 1819
13 Ga0070660_100207353 3300005339 Bacteria 1591
14 Ga0070689_100155134 3300005340 Bacteria 1848
15 Ga0070661_100002374 3300005344 Bacteria 12918
16 Ga0070671_100235241 3300005355 Unclassified 1555
17 Ga0070673_100135168 3300005364 Unclassified 2074
18 Ga0070709_10101710 3300005434 Bacteria 1916
19 Ga0070709_10150743 3300005434 Bacteria 1607
20 Ga0070709_10375414 3300005434 Unclassified 1056
21 Ga0070714_100164824 3300005435 Bacteria 2008
22 Ga0070714_100299432 3300005435 Unclassified 1499
23 Ga0070714_100854349 3300005435 Unclassified 883
24 Ga0070713_100018413 3300005436 Bacteria 5308
25 Ga0070713_100147961 3300005436 Unclassified 2086
26 Ga0070713_100240448 3300005436 Bacteria 1648
27 Ga0070713_100834200 3300005436 Unclassified 885
28 Ga0070710_10244627 3300005437 Bacteria 1150
29 Ga0070711_100041700 3300005439 Bacteria 3101
30 Ga0070711_100147569 3300005439 Bacteria 1770
31 Ga0070711_100276570 3300005439 Bacteria 1327
32 Ga0070708_100001221 3300005445 Bacteria 19765
33 Ga0070708_100003962 3300005445 Bacteria 11622
34 Ga0070708_100018534 3300005445 Bacteria 5826
35 Ga0070708_100021702 3300005445 Bacteria 5436
36 Ga0070708_100030068 3300005445 Bacteria 4691
37 Ga0070708_100139977 3300005445 Unclassified 2244
38 Ga0070678_100042985 3300005456 Bacteria 3216
39 Ga0070678_100304523 3300005456 Unclassified 1355
40 Ga0070662_100232067 3300005457 Unclassified 1476
41 Ga0070681_10023083 3300005458 Bacteria 6256
42 Ga0070681_10555485 3300005458 Unclassified 1062
43 Ga0070681_10565075 3300005458 Unclassified 1051
44 Ga0068867_100030361 3300005459 Unclassified 3899
45 Ga0068867_100336969 3300005459 Unclassified 1255
46 Ga0068867_100622033 3300005459 Unclassified 944
47 Ga0070685_10031683 3300005466 Unclassified 2956
48 Ga0070706_100002274 3300005467 Bacteria 19455
49 Ga0070706_100019120 3300005467 Bacteria 6320
50 Ga0070706_100467505 3300005467 Bacteria 1173
51 Ga0070707_100025190 3300005468 Bacteria 5642
52 Ga0070707_100026214 3300005468 Bacteria 5533
53 Ga0070707_100036167 3300005468 Bacteria 4712
54 Ga0070707_100110670 3300005468 Bacteria 2664
55 Ga0070707_100224373 3300005468 Unclassified 1830
56 Ga0070707_100275466 3300005468 Bacteria 1636
57 Ga0070707_100607107 3300005468 Bacteria 1056
58 Ga0070707_100995053 3300005468 Bacteria 804
59 Ga0070698_100004288 3300005471 Bacteria 15679
60 Ga0070698_100054737 3300005471 Bacteria 4050
61 Ga0070699_100002162 3300005518 Bacteria 17781
62 Ga0070699_100029898 3300005518 Unclassified 4699
63 Ga0070699_100041207 3300005518 Bacteria 3998
64 Ga0070679_100093767 3300005530 Bacteria 2989
65 Ga0070697_100000488 3300005536 Bacteria 30188
66 Ga0070697_100005380 3300005536 Bacteria 9852
67 Ga0070697_100006673 3300005536 Bacteria 8955
68 Ga0070697_100037255 3300005536 Bacteria 3929
69 Ga0070697_100112494 3300005536 Unclassified 2270
70 Ga0070697_100311081 3300005536 Unclassified 1355
71 Ga0068853_100147720 3300005539 Unclassified 2114
72 Ga0068853_100228165 3300005539 Unclassified 1703
73 Ga0070672_100220865 3300005543 Unclassified 1589
74 Ga0068855_100040458 3300005563 Bacteria 5533
75 Ga0068855_100044774 3300005563 Bacteria 5237
76 Ga0068855_100099376 3300005563 Bacteria 3352
77 Ga0070664_100037583 3300005564 Bacteria 4071
78 Ga0068857_100003152 3300005577 Unclassified 13663
79 Ga0068857_100006131 3300005577 Bacteria 10272
80 Ga0068854_100028243 3300005578 Unclassified 3875
81 Ga0068854_100215347 3300005578 Unclassified 1517
82 Ga0068856_100001765 3300005614 Bacteria 22633
83 Ga0068856_100040619 3300005614 Unclassified 4570
84 Ga0068856_100108323 3300005614 Unclassified 2775
85 Ga0068856_100109210 3300005614 Unclassified 2762
86 Ga0068856_100388100 3300005614 Bacteria 1416
87 Ga0070702_100045857 3300005615 Bacteria 2475
88 Ga0068859_100252349 3300005617 Bacteria 1854
89 Ga0068859_101284629 3300005617 Unclassified 806
90 Ga0068864_100025145 3300005618 Bacteria 5013
91 Ga0068864_100077956 3300005618 Bacteria 2899
92 Ga0068866_10059515 3300005718 Bacteria 1977
93 Ga0068851_10088132 3300005834 Unclassified 1630
94 Ga0068870_10281061 3300005840 Unclassified 1043
95 Ga0068863_100032524 3300005841 Unclassified 4972
96 Ga0068863_100329298 3300005841 Bacteria 1485
97 Ga0068863_100540259 3300005841 Unclassified 1150
98 Ga0068858_100026917 3300005842 Bacteria 5341
99 Ga0068858_100089192 3300005842 Unclassified 2869
100 Ga0068860_100199158 3300005843 Bacteria 1940
101 Ga0068860_100276348 3300005843 Bacteria 1640
102 Ga0070717_10009905 3300006028 Bacteria 7176
103 Ga0070717_10011899 3300006028 Bacteria 6621
104 Ga0070717_10016286 3300006028 Bacteria 5762
105 Ga0070717_10022426 3300006028 Bacteria 4988
106 Ga0070717_10059344 3300006028 Bacteria 3165
107 Ga0070717_10297764 3300006028 Unclassified 1434
108 Ga0070717_10311719 3300006028 Unclassified 1401
109 Ga0070717_10322913 3300006028 Unclassified 1376
110 Ga0070716_100000263 3300006173 Bacteria 21048
111 Ga0070716_100011035 3300006173 Unclassified 4544
112 Ga0070716_100084326 3300006173 Bacteria 1905
113 Ga0070712_100008128 3300006175 Bacteria 6588
114 Ga0070712_100047230 3300006175 Bacteria 2979
115 Ga0070712_100244240 3300006175 Unclassified 1431
116 Ga0070712_100750541 3300006175 Unclassified 835
117 Ga0070712_100752817 3300006175 Bacteria 834
118 Ga0070712_100814124 3300006175 Unclassified 802
119 Ga0097621_100014609 3300006237 Bacteria 5883
120 Ga0068871_100000703 3300006358 Bacteria 22748
121 Ga0068871_100012980 3300006358 Bacteria 6169
122 Ga0075433_10024736 3300006852 Bacteria 5071
123 Ga0075434_100020468 3300006871 Bacteria 6418
124 Ga0068865_100060497 3300006881 Unclassified 2652
125 Ga0075436_100002999 3300006914 Bacteria 11561
126 Ga0075436_100018779 3300006914 Unclassified 4735
127 Ga0097620_100252343 3300006931 Bacteria 1854
128 Ga0097620_101284556 3300006931 Unclassified 806
129 Ga0075435_100004776 3300007076 Bacteria 9361
130 Ga0105240_10006540 3300009093 Bacteria 17111
131 Ga0105245_10094488 3300009098 Bacteria 2756
132 Ga0105245_10669900 3300009098 Unclassified 1069
133 Ga0105245_10902507 3300009098 Unclassified 925
134 Ga0105247_10162046 3300009101 Unclassified 1481
135 Ga0105247_10276568 3300009101 Unclassified 1157
136 Ga0105243_10166806 3300009148 Bacteria 1904
137 Ga0105241_10028917 3300009174 Unclassified 4130
138 Ga0105241_10077233 3300009174 Unclassified 2599
139 Ga0105241_10125569 3300009174 Unclassified 2071
140 Ga0105242_10039763 3300009176 Bacteria 3786
141 Ga0105248_10019916 3300009177 Bacteria 7426
142 Ga0105248_10054895 3300009177 Bacteria 4469
143 Ga0105248_11315446 3300009177 Unclassified 818
144 Ga0105249_10128230 3300009553 Unclassified 2419
145 Ga0105239_10264650 3300010375 Unclassified 1933
146 Ga0105246_10192975 3300011119 Bacteria 1578
147 Ga0157373_10560163 3300013100 Unclassified 829
148 Ga0157369_10018318 3300013105 Bacteria 7852
149 Ga0157369_10083545 3300013105 Bacteria 3415
150 Ga0157369_10100810 3300013105 Unclassified 3078
151 Ga0157369_10235273 3300013105 Bacteria 1914
152 Ga0157374_10000394 3300013296 Bacteria 39643
153 Ga0157374_10000651 3300013296 Bacteria 30638
154 Ga0157374_10042088 3300013296 Unclassified 4213
155 Ga0157378_10000523 3300013297 Bacteria 36450
156 Ga0157378_10005113 3300013297 Bacteria 11517
157 Ga0157378_10036744 3300013297 Bacteria 4335
158 Ga0157378_10072465 3300013297 Bacteria 3095
159 Ga0163162_10033035 3300013306 Bacteria 5140
160 Ga0163162_10085498 3300013306 Bacteria 3231
161 Ga0163162_10489221 3300013306 Bacteria 1361
162 Ga0157372_10001945 3300013307 Bacteria 22420
163 Ga0157372_10007172 3300013307 Bacteria 11863
164 Ga0157372_10040835 3300013307 Bacteria 5127
165 Ga0157372_10246107 3300013307 Bacteria 2075
166 Ga0157372_10450320 3300013307 Unclassified 1500
167 Ga0157372_10501533 3300013307 Bacteria 1415
168 Ga0157372_10621611 3300013307 Unclassified 1259
169 Ga0157375_10691707 3300013308 Unclassified 1174
170 Ga0163163_10000945 3300014325 Bacteria 24672
171 Ga0163163_10066160 3300014325 Unclassified 3589
172 Ga0157377_10177304 3300014745 Unclassified 1337
173 Ga0157376_10001308 3300014969 Bacteria 16411
174 Ga0163161_10112223 3300017792 Unclassified 2039
175 Ga0184594_104785 3300019181 Unclassified 890
176 Ga0184598_131339 3300019182 Bacteria 1195
177 Ga0224570_100643 3300022730 Unclassified 2772
178 Ga0224571_100389 3300022734 Bacteria 2380
179 Ga0224572_1002026 3300024225 Unclassified 3182
180 Ga0224572_1018872 3300024225 Unclassified 1325
181 Ga0228598_1006268 3300024227 Unclassified 2465
182 Ga0228598_1015538 3300024227 Bacteria 1502
183 Ga0207696_1058473 3300025711 Unclassified 1088
184 Ga0207682_10131209 3300025893 Unclassified 1119
185 Ga0207692_10012414 3300025898 Bacteria 3658
186 Ga0207642_10069317 3300025899 Bacteria 1672
187 Ga0207647_10015305 3300025904 Bacteria 5262
188 Ga0207647_10096948 3300025904 Unclassified 1754
189 Ga0207699_10089650 3300025906 Bacteria 1928
190 Ga0207699_10311629 3300025906 Bacteria 1101
191 Ga0207645_10074641 3300025907 Unclassified 2171
192 Ga0207643_10049994 3300025908 Unclassified 2370
193 Ga0207643_10171589 3300025908 Bacteria 1309
194 Ga0207684_10001251 3300025910 Bacteria 28180
195 Ga0207684_10002315 3300025910 Bacteria 19334
196 Ga0207684_10031943 3300025910 Bacteria 4479
197 Ga0207684_10034505 3300025910 Bacteria 4298
198 Ga0207654_10030496 3300025911 Bacteria 2960
199 Ga0207654_10058774 3300025911 Unclassified 2240
200 Ga0207695_10129004 3300025913 Unclassified 2487
201 Ga0207671_10350748 3300025914 Unclassified 1170
202 Ga0207693_10009275 3300025915 Bacteria 8032
203 Ga0207693_10064431 3300025915 Unclassified 2871
204 Ga0207693_10070690 3300025915 Bacteria 2731
205 Ga0207693_10219428 3300025915 Unclassified 1494
206 Ga0207693_10752605 3300025915 Bacteria 753
207 Ga0207663_10009477 3300025916 Bacteria 5144
208 Ga0207663_10015173 3300025916 Bacteria 4243
209 Ga0207663_10073040 3300025916 Bacteria 2219
210 Ga0207663_10304419 3300025916 Unclassified 1192
211 Ga0207660_10108755 3300025917 Bacteria 2083
212 Ga0207657_10046009 3300025919 Bacteria 3824
213 Ga0207649_10003300 3300025920 Bacteria 8833
214 Ga0207646_10003151 3300025922 Bacteria 18896
215 Ga0207646_10122228 3300025922 Unclassified 2339
216 Ga0207646_10207963 3300025922 Bacteria 1767
217 Ga0207646_10220682 3300025922 Unclassified 1713
218 Ga0207646_10561596 3300025922 Bacteria 1026
219 Ga0207646_10701736 3300025922 Bacteria 905
220 Ga0207650_10000090 3300025925 Bacteria 118973
221 Ga0207659_10014386 3300025926 Bacteria 5101
222 Ga0207687_10149308 3300025927 Bacteria 1781
223 Ga0207700_10010898 3300025928 Bacteria 5770
224 Ga0207700_10175311 3300025928 Bacteria 1792
225 Ga0207700_10236651 3300025928 Bacteria 1555
226 Ga0207664_10190034 3300025929 Bacteria 1767
227 Ga0207664_10191673 3300025929 Unclassified 1760
228 Ga0207664_10992832 3300025929 Bacteria 752
229 Ga0207644_10072186 3300025931 Unclassified 2527
230 Ga0207709_10162575 3300025935 Bacteria 1558
231 Ga0207670_10074609 3300025936 Unclassified 2355
232 Ga0207704_10098013 3300025938 Unclassified 1946
233 Ga0207704_10392441 3300025938 Unclassified 1093
234 Ga0207665_10002589 3300025939 Bacteria 12159
235 Ga0207665_10010003 3300025939 Bacteria 6227
236 Ga0207665_10037292 3300025939 Unclassified 3235
237 Ga0207665_10171161 3300025939 Bacteria 1569
238 Ga0207665_10179235 3300025939 Unclassified 1534
239 Ga0207691_10276684 3300025940 Unclassified 1445
240 Ga0207711_10043019 3300025941 Bacteria 3851
241 Ga0207689_10030677 3300025942 Unclassified 4480
242 Ga0207689_10083777 3300025942 Bacteria 2621
243 Ga0207689_10398433 3300025942 Unclassified 1147
244 Ga0207661_10037397 3300025944 Unclassified 3796
245 Ga0207679_10020124 3300025945 Bacteria 4499
246 Ga0207679_10396388 3300025945 Unclassified 1213
247 Ga0207667_10003430 3300025949 Bacteria 19570
248 Ga0207667_10035572 3300025949 Bacteria 5342
249 Ga0207667_10676956 3300025949 Unclassified 1035
250 Ga0207712_10113905 3300025961 Bacteria 2033
251 Ga0207712_10180904 3300025961 Unclassified 1656
252 Ga0207640_10254805 3300025981 Bacteria 1364
253 Ga0207677_10107556 3300026023 Unclassified 2069
254 Ga0207677_10110735 3300026023 Bacteria 2044
255 Ga0207677_10542447 3300026023 Unclassified 1012
256 Ga0207639_10468024 3300026041 Bacteria 1147
257 Ga0207639_10484711 3300026041 Unclassified 1127
258 Ga0207708_10149828 3300026075 Unclassified 1835
259 Ga0207702_10004513 3300026078 Bacteria 12344
260 Ga0207702_10038005 3300026078 Bacteria 4032
261 Ga0207702_10308854 3300026078 Bacteria 1503
262 Ga0207702_10550297 3300026078 Unclassified 1129
263 Ga0207641_10001842 3300026088 Bacteria 20372
264 Ga0207641_10174958 3300026088 Unclassified 1962
265 Ga0207641_10923815 3300026088 Unclassified 867
266 Ga0207648_10036003 3300026089 Bacteria 4361
267 Ga0207648_10043729 3300026089 Unclassified 3932
268 Ga0207648_10223147 3300026089 Unclassified 1675
269 Ga0207676_10014579 3300026095 Bacteria 5659
270 Ga0207676_10015126 3300026095 Bacteria 5565
271 Ga0207674_10005128 3300026116 Bacteria 15632
272 Ga0207674_10006859 3300026116 Bacteria 13355
273 Ga0207675_100082245 3300026118 Unclassified 3020
274 Ga0207675_100238944 3300026118 Bacteria 1755
275 Ga0207683_10064946 3300026121 Bacteria 3217
276 Ga0207683_10527347 3300026121 Bacteria 1091
277 Ga0207698_10366322 3300026142 Unclassified 1366
278 Ga0209588_1104179 3300027671 Unclassified 912
279 Ga0265356_1000038 3300028017 Bacteria 21148
280 Ga0265356_1001709 3300028017 Bacteria 3145
281 Ga0265356_1006669 3300028017 Bacteria 1344
282 Ga0268266_10481124 3300028379 Unclassified 1183
283 Ga0268264_10132213 3300028381 Bacteria 2214
284 Ga0268264_10856985 3300028381 Unclassified 910
285 Ga0265336_10037850 3300028666 Unclassified 1482
286 Ga0265338_10023798 3300028800 Bacteria 6281
287 Ga0265338_10028521 3300028800 Bacteria 5564
288 Ga0265338_10031367 3300028800 Bacteria 5212
289 Ga0265338_10039557 3300028800 Unclassified 4446
290 Ga0265338_10045518 3300028800 Bacteria 4033
291 Ga0265338_10047321 3300028800 Bacteria 3929
292 Ga0265338_10058006 3300028800 Bacteria 3421
293 Ga0265338_10237959 3300028800 Unclassified 1350
294 Ga0265338_10258119 3300028800 Bacteria 1282
295 Ga0265762_1000529 3300030760 Bacteria 6693
296 Ga0265762_1001167 3300030760 Bacteria 4748
297 Ga0265762_1046623 3300030760 Bacteria 861
298 Ga0265762_1053529 3300030760 Unclassified 816
299 Ga0265760_10000366 3300031090 Bacteria 12614
300 Ga0265760_10000604 3300031090 Bacteria 10223
301 Ga0265760_10005098 3300031090 Bacteria 3761
302 Ga0265760_10009879 3300031090 Bacteria 2723
303 Ga0265340_10114251 3300031247 Bacteria 1246
304 Ga0265339_10057362 3300031249 Unclassified 2106
305 Ga0265339_10059035 3300031249 Unclassified 2069
306 Ga0265316_10006355 3300031344 Bacteria 11301
307 Ga0265316_10010717 3300031344 Bacteria 8329
308 Ga0265316_10021042 3300031344 Bacteria 5534
309 Ga0265316_10024171 3300031344 Bacteria 5098
310 Ga0265314_10005940 3300031711 Bacteria 10912
311 Ga0265314_10026030 3300031711 Bacteria 4402
312 Ga0265314_10046701 3300031711 Bacteria 3053
313 Ga0316212_1010698 3300033547 Bacteria 1314
314 Ga0373926_0057064 3300035083 Bacteria 1418
315 Ga0373944_0087707 3300035089 Bacteria 1036
316 Ga0373943_0116233 3300035170 Unclassified 1417
317 Ga0373935_0071396 3300035692 Bacteria 2240
318 Ga0373927_0191196 3300035695 Bacteria 1343
319 Ga0373927_0326308 3300035695 Bacteria 1011
320 Ga0373927_0435553 3300035695 Unclassified 866
321 Ga0373947_0014690 3300035725 Bacteria 4492
322 Ga0373937_0171126 3300036401 Bacteria 2038
323 Ga0373925_0039806 3300037068 Bacteria 3478
324 Ga0373925_0340981 3300037068 Bacteria 1216
325 Ga0373925_0483830 3300037068 Unclassified 1015
326 Ga0451576_0382249 3300045051 Bacteria 1476
327 Ga0451576_1150028 3300045051 Unclassified 811
328 Ga0495629_0252218 3300046459 Bacteria 1214
329 Ga0495651_0012155 3300046462 Bacteria 6628
330 Ga0495653_0026033 3300046463 Bacteria 4695
331 Ga0495580_0035807 3300046472 Bacteria 3568
332 Ga0495580_0142142 3300046472 Bacteria 1663
333 Ga0495580_0174211 3300046472 Bacteria 1486
334 Ga0495580_0315305 3300046472 Bacteria 1063
335 Ga0495662_0028613 3300046476 Bacteria 2690
336 Ga0495664_0099360 3300046477 Bacteria 1752
337 Ga0495608_0043978 3300046511 Bacteria 2983
338 Ga0495618_0177682 3300046514 Bacteria 1353
339 Ga0495628_0093413 3300046516 Bacteria 2326
340 Ga0495630_0283575 3300046517 Bacteria 1265
341 Ga0495630_0316555 3300046517 Unclassified 1193
342 Ga0495642_0164977 3300046528 Unclassified 961
343 Ga0495652_0057120 3300046529 Bacteria 3311
344 Ga0495665_0107045 3300046531 Bacteria 1467
345 Ga0495640_0021904 3300046533 Bacteria 4681
346 Ga0495586_0173274 3300046535 Bacteria 1219
347 Ga0495587_0018617 3300046536 Bacteria 4306
348 Ga0495667_0075545 3300046559 Bacteria 2192
349 Ga0495634_0119948 3300046642 Bacteria 1684
350 Ga0495657_0036491 3300046675 Bacteria 3397
351 Ga0495599_0000592 3300046678 Bacteria 20701
352 Ga0495623_0077405 3300046679 Bacteria 2062
353 Ga0495613_0516551 3300046689 Unclassified 803
354 Ga0495670_0248586 3300046691 Bacteria 948
355 Ga0495600_0041808 3300046809 Bacteria 2988
356 Ga0495604_0157840 3300047317 Bacteria 1605
357 Ga0495674_0077901 3300047319 Bacteria 2849
358 Ga0495674_0284324 3300047319 Unclassified 1354
359 Ga0495674_0447784 3300047319 Bacteria 1038
360 Ga0495680_0017489 3300047322 Bacteria 6120
361 Ga0495675_0027949 3300047444 Unclassified 3595
362 Ga0495684_0007863 3300047471 Bacteria 8251
363 Ga0495602_0093660 3300048088 Bacteria 2485
364 Ga0496102_0114134 3300048905 Plasmid 2520
365 Ga0496102_0346052 3300048905 Unclassified 1400
366 Ga0496102_0360518 3300048905 Unclassified 1369
367 Ga0496103_0109365 3300048906 Unclassified 1755
368 Ga0496106_0037811 3300048909 Plasmid 3611
369 Ga0496108_0050410 3300048911 Unclassified 3485
370 Ga0496109_0047103 3300048912 Unclassified 3918
371 Ga0496110_0044363 3300048913 Unclassified 3883
372 Ga0496112_0000506 3300048915 Bacteria 26406
373 Ga0496113_0045568 3300048916 Unclassified 3253
374 Ga0496115_0749260 3300048918 Unclassified 764
375 nmdc:mga05p37_418500_c1 3300050507 Unclassified 1560
376 nmdc:mga09592_149677_c1 3300050508 Unclassified 2013
377 nmdc:mga08y16_19410_c1 3300050511 Bacteria 7167
378 nmdc:mga0n895_484_c1 3300050512 Bacteria 26835
379 nmdc:mga0rr50_1774_c1 3300050513 Bacteria 11916
380 nmdc:mga08x19_1846_c1 3300050514 Bacteria 12979
381 nmdc:mga08x19_24090_c1 3300050514 Unclassified 3779
382 nmdc:mga0a205_2913_c1 3300050515 Bacteria 13157
383 Ga0373947_0112635
384 Ga0065704_10036268
385 Ga0065715_10195936
386 Ga0070658_10687100
387 Ga0070690_100107830
388 Ga0070670_100206174
389 Ga0068869_100044433
390 Ga0068869_100261637
391 Ga0068868_100018866
392 Ga0068868_100082333
393 Ga0070660_100089728
394 Ga0070660_100159147
395 Ga0070660_100207353
396 Ga0070689_100155134
397 Ga0070661_100002374
398 Ga0070671_100235241
399 Ga0070673_100135168
400 Ga0070709_10101710
401 Ga0070709_10150743
402 Ga0070709_10375414
403 Ga0070714_100164824
404 Ga0070714_100299432
405 Ga0070714_100854349
406 Ga0070713_100018413
407 Ga0070713_100147961
408 Ga0070713_100240448
409 Ga0070713_100834200
410 Ga0070710_10244627
411 Ga0070711_100041700
412 Ga0070711_100147569
413 Ga0070711_100276570
414 Ga0070708_100001221
415 Ga0070708_100003962
416 Ga0070708_100018534
417 Ga0070708_100021702
418 Ga0070708_100030068
419 Ga0070708_100139977
420 Ga0070678_100042985
421 Ga0070678_100304523
422 Ga0070662_100232067
423 Ga0070681_10023083
424 Ga0070681_10555485
425 Ga0070681_10565075
426 Ga0068867_100030361
427 Ga0068867_100336969
428 Ga0068867_100622033
429 Ga0070685_10031683
430 Ga0070706_100002274
431 Ga0070706_100019120
432 Ga0070706_100467505
433 Ga0070707_100025190
434 Ga0070707_100026214
435 Ga0070707_100036167
436 Ga0070707_100110670
437 Ga0070707_100224373
438 Ga0070707_100275466
439 Ga0070707_100607107
440 Ga0070707_100995053
441 Ga0070698_100004288
442 Ga0070698_100054737
443 Ga0070699_100002162
444 Ga0070699_100029898
445 Ga0070699_100041207
446 Ga0070679_100093767
447 Ga0070697_100000488
448 Ga0070697_100005380
449 Ga0070697_100006673
450 Ga0070697_100037255
451 Ga0070697_100112494
452 Ga0070697_100311081
453 Ga0068853_100147720
454 Ga0068853_100228165
455 Ga0070672_100220865
456 Ga0068855_100040458
457 Ga0068855_100044774
458 Ga0068855_100099376
459 Ga0070664_100037583
460 Ga0068857_100003152
461 Ga0068857_100006131
462 Ga0068854_100028243
463 Ga0068854_100215347
464 Ga0068856_100001765
465 Ga0068856_100040619
466 Ga0068856_100108323
467 Ga0068856_100109210
468 Ga0068856_100388100
469 Ga0070702_100045857
470 Ga0068859_100252349
471 Ga0068859_101284629
472 Ga0068864_100025145
473 Ga0068864_100077956
474 Ga0068866_10059515
475 Ga0068851_10088132
476 Ga0068870_10281061
477 Ga0068863_100032524
478 Ga0068863_100329298
479 Ga0068863_100540259
480 Ga0068858_100026917
481 Ga0068858_100089192
482 Ga0068860_100199158
483 Ga0068860_100276348
484 Ga0070717_10009905
485 Ga0070717_10011899
486 Ga0070717_10016286
487 Ga0070717_10022426
488 Ga0070717_10059344
489 Ga0070717_10297764
490 Ga0070717_10311719
491 Ga0070717_10322913
492 Ga0070716_100000263
493 Ga0070716_100011035
494 Ga0070716_100084326
495 Ga0070712_100008128
496 Ga0070712_100047230
497 Ga0070712_100244240
498 Ga0070712_100750541
499 Ga0070712_100752817
500 Ga0070712_100814124
501 Ga0097621_100014609
502 Ga0068871_100000703
503 Ga0068871_100012980
504 Ga0075433_10024736
505 Ga0075434_100020468
506 Ga0068865_100060497
507 Ga0075436_100002999
508 Ga0075436_100018779
509 Ga0097620_100252343
510 Ga0097620_101284556
511 Ga0075435_100004776
512 Ga0105240_10006540
513 Ga0105245_10094488
514 Ga0105245_10669900
515 Ga0105245_10902507
516 Ga0105247_10162046
517 Ga0105247_10276568
518 Ga0105243_10166806
519 Ga0105241_10028917
520 Ga0105241_10077233
521 Ga0105241_10125569
522 Ga0105242_10039763
523 Ga0105248_10019916
524 Ga0105248_10054895
525 Ga0105248_11315446
526 Ga0105249_10128230
527 Ga0105239_10264650
528 Ga0105246_10192975
529 Ga0157373_10560163
530 Ga0157369_10018318
531 Ga0157369_10083545
532 Ga0157369_10100810
533 Ga0157369_10235273
534 Ga0157374_10000394
535 Ga0157374_10000651
536 Ga0157374_10042088
537 Ga0157378_10000523
538 Ga0157378_10005113
539 Ga0157378_10036744
540 Ga0157378_10072465
541 Ga0163162_10033035
542 Ga0163162_10085498
543 Ga0163162_10489221
544 Ga0157372_10001945
545 Ga0157372_10007172
546 Ga0157372_10040835
547 Ga0157372_10246107
548 Ga0157372_10450320
549 Ga0157372_10501533
550 Ga0157372_10621611
551 Ga0157375_10691707
552 Ga0163163_10000945
553 Ga0163163_10066160
554 Ga0157377_10177304
555 Ga0157376_10001308
556 Ga0163161_10112223
557 Ga0184594_104785
558 Ga0184598_131339
559 Ga0224570_100643
560 Ga0224571_100389
561 Ga0224572_1002026
562 Ga0224572_1018872
563 Ga0228598_1006268
564 Ga0228598_1015538
565 Ga0207696_1058473
566 Ga0207682_10131209
567 Ga0207692_10012414
568 Ga0207642_10069317
569 Ga0207647_10015305
570 Ga0207647_10096948
571 Ga0207699_10089650
572 Ga0207699_10311629
573 Ga0207645_10074641
574 Ga0207643_10049994
575 Ga0207643_10171589
576 Ga0207684_10001251
577 Ga0207684_10002315
578 Ga0207684_10031943
579 Ga0207684_10034505
580 Ga0207654_10030496
581 Ga0207654_10058774
582 Ga0207695_10129004
583 Ga0207671_10350748
584 Ga0207693_10009275
585 Ga0207693_10064431
586 Ga0207693_10070690
587 Ga0207693_10219428
588 Ga0207693_10752605
589 Ga0207663_10009477
590 Ga0207663_10015173
591 Ga0207663_10073040
592 Ga0207663_10304419
593 Ga0207660_10108755
594 Ga0207657_10046009
595 Ga0207649_10003300
596 Ga0207646_10003151
597 Ga0207646_10122228
598 Ga0207646_10207963
599 Ga0207646_10220682
600 Ga0207646_10561596
601 Ga0207646_10701736
602 Ga0207650_10000090
603 Ga0207659_10014386
604 Ga0207687_10149308
605 Ga0207700_10010898
606 Ga0207700_10175311
607 Ga0207700_10236651
608 Ga0207664_10190034
609 Ga0207664_10191673
610 Ga0207664_10992832
611 Ga0207644_10072186
612 Ga0207709_10162575
613 Ga0207670_10074609
614 Ga0207704_10098013
615 Ga0207704_10392441
616 Ga0207665_10002589
617 Ga0207665_10010003
618 Ga0207665_10037292
619 Ga0207665_10171161
620 Ga0207665_10179235
621 Ga0207691_10276684
622 Ga0207711_10043019
623 Ga0207689_10030677
624 Ga0207689_10083777
625 Ga0207689_10398433
626 Ga0207661_10037397
627 Ga0207679_10020124
628 Ga0207679_10396388
629 Ga0207667_10003430
630 Ga0207667_10035572
631 Ga0207667_10676956
632 Ga0207712_10113905
633 Ga0207712_10180904
634 Ga0207640_10254805
635 Ga0207677_10107556
636 Ga0207677_10110735
637 Ga0207677_10542447
638 Ga0207639_10468024
639 Ga0207639_10484711
640 Ga0207708_10149828
641 Ga0207702_10004513
642 Ga0207702_10038005
643 Ga0207702_10308854
644 Ga0207702_10550297
645 Ga0207641_10001842
646 Ga0207641_10174958
647 Ga0207641_10923815
648 Ga0207648_10036003
649 Ga0207648_10043729
650 Ga0207648_10223147
651 Ga0207676_10014579
652 Ga0207676_10015126
653 Ga0207674_10005128
654 Ga0207674_10006859
655 Ga0207675_100082245
656 Ga0207675_100238944
657 Ga0207683_10064946
658 Ga0207683_10527347
659 Ga0207698_10366322
660 Ga0209588_1104179
661 Ga0265356_1000038
662 Ga0265356_1001709
663 Ga0265356_1006669
664 Ga0268266_10481124
665 Ga0268264_10132213
666 Ga0268264_10856985
667 Ga0265336_10037850
668 Ga0265338_10023798
669 Ga0265338_10028521
670 Ga0265338_10031367
671 Ga0265338_10039557
672 Ga0265338_10045518
673 Ga0265338_10047321
674 Ga0265338_10058006
675 Ga0265338_10237959
676 Ga0265338_10258119
677 Ga0265762_1000529
678 Ga0265762_1001167
679 Ga0265762_1046623
680 Ga0265762_1053529
681 Ga0265760_10000366
682 Ga0265760_10000604
683 Ga0265760_10005098
684 Ga0265760_10009879
685 Ga0265340_10114251
686 Ga0265339_10057362
687 Ga0265339_10059035
688 Ga0265316_10006355
689 Ga0265316_10010717
690 Ga0265316_10021042
691 Ga0265316_10024171
692 Ga0265314_10005940
693 Ga0265314_10026030
694 Ga0265314_10046701
695 Ga0316212_1010698
696 Ga0373926_0057064
697 Ga0373944_0087707
698 Ga0373943_0116233
699 Ga0373935_0071396
700 Ga0373927_0191196
701 Ga0373927_0326308
702 Ga0373927_0435553
703 Ga0373947_0014690
704 Ga0373937_0171126
705 Ga0373925_0039806
706 Ga0373925_0340981
707 Ga0373925_0483830
708 Ga0451576_0382249
709 Ga0451576_1150028
710 Ga0495629_0252218
711 Ga0495651_0012155
712 Ga0495653_0026033
713 Ga0495580_0035807
714 Ga0495580_0142142
715 Ga0495580_0174211
716 Ga0495580_0315305
717 Ga0495662_0028613
718 Ga0495664_0099360
719 Ga0495608_0043978
720 Ga0495618_0177682
721 Ga0495628_0093413
722 Ga0495630_0283575
723 Ga0495630_0316555
724 Ga0495642_0164977
725 Ga0495652_0057120
726 Ga0495665_0107045
727 Ga0495640_0021904
728 Ga0495586_0173274
729 Ga0495587_0018617
730 Ga0495667_0075545
731 Ga0495634_0119948
732 Ga0495657_0036491
733 Ga0495599_0000592
734 Ga0495623_0077405
735 Ga0495613_0516551
736 Ga0495670_0248586
737 Ga0495600_0041808
738 Ga0495604_0157840
739 Ga0495674_0077901
740 Ga0495674_0284324
741 Ga0495674_0447784
742 Ga0495680_0017489
743 Ga0495675_0027949
744 Ga0495684_0007863
745 Ga0495602_0093660
746 Ga0496102_0114134
747 Ga0496102_0346052
748 Ga0496102_0360518
749 Ga0496103_0109365
750 Ga0496106_0037811
751 Ga0496108_0050410
752 Ga0496109_0047103
753 Ga0496110_0044363
754 Ga0496112_0000506
755 Ga0496113_0045568
756 Ga0496115_0749260
757 nmdc:mga05p37_418500_c1
758 nmdc:mga09592_149677_c1
759 nmdc:mga08y16_19410_c1
760 nmdc:mga0n895_484_c1
761 nmdc:mga0rr50_1774_c1
762 nmdc:mga08x19_1846_c1
763 nmdc:mga08x19_24090_c1
764 nmdc:mga0a205_2913_c1

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

70

134

0.92

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

166

232

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j48-assembly2.cif.gz_B pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.8896 15 113
5kbf-assembly2.cif.gz_B camp bound pfpka-r (141-441) 0.8834 16 112
4qx5-assembly1.cif.gz_A neutron diffraction reveals hydrogen bonds critical for cgmp-selective activation: insights for pkg agonist design 0.8803 14 113
4z07-assembly1.cif.gz_C co-crystal structure of the tandem cnb (cnb-a/b) domains of human pkg i beta with cgmp 0.8786 14 113
5j48-assembly1.cif.gz_A pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.8746 15 114
ID Description Score Start End Superfamily
2xkpF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9392 26 129 2.60.120.10
2xkpF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9138 26 129 2.60.120.10
af_A0A2R8Q8R8_221_349_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9128 17 113 2.60.120.10
af_G5EDB9_5_131_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.908 25 105 2.60.120.10
af_O76360_306_441_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9027 17 113 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1Q7EDL1-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.941 27 105 GO:0005829
AF-A0A672U5I1-F1-model_v4 Patatin like phospholipase domain containing 7 0.9225 25 132 GO:0004622
GO:0005789
GO:0016042
AF-A0A2V7XR34-F1-model_v4 Crp/Fnr family transcriptional regulator 0.906 26 130 GO:0005221
GO:0016020
GO:0044877
AF-A0A4Q1ZUQ0-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9037 13 141
AF-A0A661EYI6-F1-model_v4 Protein kinase 0.9025 17 112 GO:0004862
GO:0005829
GO:0005952
GO:0016301
GO:0030552
GO:0034236

Map