F429220

General Info

Members Datasets Scaffolds Average Seq Length
382 201 382 275

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100221405|Ga0068864_1002214052
Length 267
Sequence MFHLRSVELRRVPAAAADRFPFTVPVIRDLPLLDLDAAVTFLVGENGSGKSTLLEGLASAAGLPTVGSESIQQDESLGAQRLLGKSFKLTWNRRAMRGFFLRAEDFFGFTKSLSKLRAELKARLAEYETEYQGRDYAKGLASMPLVGSLVDMERRYGVDLDANSHGQSFLKLFQSRFVPGGLYLLDEPEAPLSPQSQLALIAMIRDMVAQDAQFIIATHSPILLGYPGARIYSFDSVPVTAVQFNELDHVVLTRDFLNNPERFLRHL

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.57
Rhizosphere 97.91
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10993801 2162886012 Unclassified 945
2 MBSR1b_contig_4224469 2162886012 Unclassified 1572
3 JGI25406J46586_10035914 3300003203 Bacteria 1804
4 Ga0070658_10004268 3300005327 Bacteria 11682
5 Ga0070658_10175339 3300005327 Bacteria 1803
6 Ga0070658_10287461 3300005327 Bacteria 1401
7 Ga0070658_10352429 3300005327 Bacteria 1260
8 Ga0070683_100000188 3300005329 Bacteria 41226
9 Ga0070683_100013842 3300005329 Bacteria 7044
10 Ga0070683_100040584 3300005329 Bacteria 4280
11 Ga0070683_100049756 3300005329 Bacteria 3877
12 Ga0070683_100075785 3300005329 Bacteria 3144
13 Ga0070683_100129402 3300005329 Bacteria 2388
14 Ga0070683_100168811 3300005329 Bacteria 2076
15 Ga0070680_100009895 3300005336 Bacteria 7339
16 Ga0070680_100024264 3300005336 Bacteria 4841
17 Ga0070680_100051150 3300005336 Bacteria 3371
18 Ga0070680_100054126 3300005336 Bacteria 3276
19 Ga0070680_100157383 3300005336 Bacteria 1909
20 Ga0070680_100197445 3300005336 Bacteria 1696
21 Ga0070682_100209320 3300005337 Bacteria 1381
22 Ga0070660_100005681 3300005339 Bacteria 8642
23 Ga0070689_100332399 3300005340 Bacteria 1271
24 Ga0070661_100051570 3300005344 Bacteria 3011
25 Ga0070661_100100089 3300005344 Bacteria 2155
26 Ga0070669_100001653 3300005353 Bacteria 16126
27 Ga0070669_100039955 3300005353 Bacteria 3409
28 Ga0070675_100471670 3300005354 Bacteria 1128
29 Ga0070671_100287965 3300005355 Bacteria 1398
30 Ga0070674_100130044 3300005356 Bacteria 1876
31 Ga0070673_100116095 3300005364 Bacteria 2226
32 Ga0070673_100479154 3300005364 Bacteria 1123
33 Ga0070688_100022535 3300005365 Bacteria 3694
34 Ga0070659_100010163 3300005366 Bacteria 6925
35 Ga0070659_100414248 3300005366 Bacteria 1139
36 Ga0070709_10305894 3300005434 Bacteria 1162
37 Ga0070714_100000743 3300005435 Bacteria 23044
38 Ga0070714_100009338 3300005435 Bacteria 7706
39 Ga0070714_100067734 3300005435 Bacteria 3079
40 Ga0070714_100093454 3300005435 Bacteria 2637
41 Ga0070713_100000053 3300005436 Bacteria 71704
42 Ga0070713_100001087 3300005436 Bacteria 17404
43 Ga0070713_100561156 3300005436 Bacteria 1082
44 Ga0070711_100027505 3300005439 Bacteria 3735
45 Ga0070700_100027476 3300005441 Bacteria 3374
46 Ga0070708_100000113 3300005445 Bacteria 53689
47 Ga0070708_100049549 3300005445 Bacteria 3716
48 Ga0070663_100441466 3300005455 Bacteria 1071
49 Ga0070678_100201240 3300005456 Bacteria 1644
50 Ga0070681_10005965 3300005458 Bacteria 11797
51 Ga0070681_10013292 3300005458 Bacteria 8180
52 Ga0070681_10036927 3300005458 Bacteria 4904
53 Ga0070681_10059253 3300005458 Bacteria 3808
54 Ga0068867_100044986 3300005459 Bacteria 3235
55 Ga0068867_100232479 3300005459 Bacteria 1491
56 Ga0070699_100010504 3300005518 Bacteria 8010
57 Ga0070699_100032893 3300005518 Bacteria 4480
58 Ga0070699_100177358 3300005518 Bacteria 1890
59 Ga0070679_100002807 3300005530 Bacteria 15823
60 Ga0070679_100023359 3300005530 Bacteria 6050
61 Ga0070679_100027907 3300005530 Bacteria 5562
62 Ga0070679_100066706 3300005530 Bacteria 3587
63 Ga0070679_100073615 3300005530 Bacteria 3407
64 Ga0070684_100000655 3300005535 Bacteria 23859
65 Ga0070684_100006002 3300005535 Bacteria 9358
66 Ga0070684_100014976 3300005535 Bacteria 6297
67 Ga0070684_100035912 3300005535 Bacteria 4244
68 Ga0070684_100102204 3300005535 Bacteria 2562
69 Ga0070684_100122546 3300005535 Bacteria 2339
70 Ga0070684_100129354 3300005535 Bacteria 2277
71 Ga0070684_100144758 3300005535 Bacteria 2151
72 Ga0070684_100178433 3300005535 Bacteria 1931
73 Ga0070684_100572803 3300005535 Unclassified 1049
74 Ga0070697_100082786 3300005536 Bacteria 2646
75 Ga0068853_100025555 3300005539 Bacteria 4957
76 Ga0068853_100236093 3300005539 Bacteria 1674
77 Ga0068853_100436614 3300005539 Bacteria 1230
78 Ga0070672_100029913 3300005543 Bacteria 4088
79 Ga0070696_100000178 3300005546 Bacteria 36749
80 Ga0070693_100015155 3300005547 Bacteria 3964
81 Ga0070693_100152149 3300005547 Bacteria 1467
82 Ga0070665_100084778 3300005548 Bacteria 3174
83 Ga0068855_100037707 3300005563 Bacteria 5745
84 Ga0070664_100003935 3300005564 Bacteria 11984
85 Ga0070664_100115576 3300005564 Bacteria 2345
86 Ga0070664_100119656 3300005564 Bacteria 2305
87 Ga0068857_100061133 3300005577 Bacteria 3347
88 Ga0068852_100023021 3300005616 Bacteria 5007
89 Ga0068852_100087260 3300005616 Bacteria 2783
90 Ga0068852_100464007 3300005616 Bacteria 1256
91 Ga0068859_100003493 3300005617 Bacteria 16001
92 Ga0068864_100221405 3300005618 Bacteria 1746
93 Ga0068866_10001507 3300005718 Bacteria 9915
94 Ga0068861_100013517 3300005719 Bacteria 5713
95 Ga0068870_10049478 3300005840 Bacteria 2217
96 Ga0068862_100000345 3300005844 Bacteria 50340
97 Ga0081539_10000097 3300005985 Bacteria 202450
98 Ga0070717_10022917 3300006028 Bacteria 4941
99 Ga0075430_100010284 3300006846 Bacteria 7919
100 Ga0075431_100017941 3300006847 Bacteria 7198
101 Ga0075431_100033189 3300006847 Bacteria 5321
102 Ga0075431_100059930 3300006847 Bacteria 3928
103 Ga0075431_100162452 3300006847 Bacteria 2296
104 Ga0075433_10014841 3300006852 Bacteria 6375
105 Ga0075433_10015980 3300006852 Bacteria 6172
106 Ga0075434_100007050 3300006871 Bacteria 10371
107 Ga0075434_100044332 3300006871 Bacteria 4412
108 Ga0075429_100067940 3300006880 Bacteria 3102
109 Ga0075429_100104004 3300006880 Bacteria 2480
110 Ga0075429_100207821 3300006880 Bacteria 1715
111 Ga0068865_100206779 3300006881 Bacteria 1527
112 Ga0097620_100003493 3300006931 Bacteria 16001
113 Ga0075435_100339457 3300007076 Bacteria 1287
114 Ga0105240_10250158 3300009093 Bacteria 2050
115 Ga0111539_10058673 3300009094 Bacteria 4565
116 Ga0105245_10111011 3300009098 Unclassified 2550
117 Ga0114129_10042847 3300009147 Bacteria 6370
118 Ga0114129_10816011 3300009147 Unclassified 1189
119 Ga0105243_10165404 3300009148 Bacteria 1911
120 Ga0105243_10674367 3300009148 Bacteria 1005
121 Ga0105241_10296230 3300009174 Bacteria 1387
122 Ga0105242_10538843 3300009176 Bacteria 1117
123 Ga0105238_10176575 3300009551 Bacteria 2113
124 Ga0105238_10204124 3300009551 Bacteria 1952
125 Ga0105249_10000276 3300009553 Bacteria 54132
126 Ga0105249_10746392 3300009553 Bacteria 1041
127 Ga0105246_10188856 3300011119 Bacteria 1593
128 Ga0157373_10068551 3300013100 Bacteria 2507
129 Ga0157373_10244381 3300013100 Bacteria 1269
130 Ga0157371_10117010 3300013102 Bacteria 1894
131 Ga0157370_10050519 3300013104 Bacteria 3974
132 Ga0157370_10158652 3300013104 Bacteria 2105
133 Ga0157369_10179014 3300013105 Bacteria 2231
134 Ga0157369_10219016 3300013105 Bacteria 1993
135 Ga0157369_10519024 3300013105 Bacteria 1232
136 Ga0157372_10018513 3300013307 Bacteria 7488
137 Ga0157372_10027774 3300013307 Bacteria 6168
138 Ga0157372_10071382 3300013307 Bacteria 3910
139 Ga0157372_10277095 3300013307 Bacteria 1950
140 Ga0157372_10353991 3300013307 Bacteria 1711
141 Ga0157372_10505107 3300013307 Unclassified 1410
142 Ga0157375_10017466 3300013308 Bacteria 6475
143 Ga0157375_10211804 3300013308 Bacteria 2095
144 Ga0157380_10019448 3300014326 Bacteria 5061
145 Ga0157380_10020894 3300014326 Bacteria 4902
146 Ga0157376_10064709 3300014969 Bacteria 3085
147 Ga0207697_10023106 3300025315 Bacteria 2546
148 Ga0207682_10004036 3300025893 Bacteria 6243
149 Ga0207642_10033753 3300025899 Bacteria 2168
150 Ga0207688_10143398 3300025901 Bacteria 1407
151 Ga0207699_10003737 3300025906 Bacteria 7268
152 Ga0207645_10149758 3300025907 Bacteria 1523
153 Ga0207643_10000956 3300025908 Bacteria 17331
154 Ga0207643_10007256 3300025908 Bacteria 5948
155 Ga0207705_10010652 3300025909 Bacteria 6677
156 Ga0207705_10032637 3300025909 Bacteria 3722
157 Ga0207705_10224792 3300025909 Bacteria 1427
158 Ga0207707_10017061 3300025912 Bacteria 6325
159 Ga0207707_10023792 3300025912 Bacteria 5356
160 Ga0207707_10074788 3300025912 Bacteria 2955
161 Ga0207707_10348500 3300025912 Bacteria 1276
162 Ga0207695_10003339 3300025913 Bacteria 22724
163 Ga0207695_10252864 3300025913 Bacteria 1661
164 Ga0207693_10221409 3300025915 Bacteria 1487
165 Ga0207663_10051440 3300025916 Bacteria 2565
166 Ga0207660_10001781 3300025917 Bacteria 14415
167 Ga0207660_10040997 3300025917 Bacteria 3243
168 Ga0207660_10069788 3300025917 Bacteria 2553
169 Ga0207657_10013864 3300025919 Bacteria 7888
170 Ga0207652_10000673 3300025921 Bacteria 33429
171 Ga0207652_10046457 3300025921 Bacteria 3704
172 Ga0207652_10047123 3300025921 Bacteria 3681
173 Ga0207652_10129509 3300025921 Bacteria 2250
174 Ga0207652_10337810 3300025921 Bacteria 1360
175 Ga0207646_10030877 3300025922 Bacteria 4854
176 Ga0207681_10000315 3300025923 Bacteria 35258
177 Ga0207681_10060542 3300025923 Bacteria 2599
178 Ga0207659_10061058 3300025926 Bacteria 2715
179 Ga0207659_10121519 3300025926 Bacteria 2002
180 Ga0207659_10176758 3300025926 Bacteria 1688
181 Ga0207687_10051957 3300025927 Bacteria 2859
182 Ga0207700_10002442 3300025928 Bacteria 10670
183 Ga0207700_10003995 3300025928 Bacteria 8637
184 Ga0207700_10013413 3300025928 Bacteria 5331
185 Ga0207664_10010918 3300025929 Bacteria 6432
186 Ga0207664_10064085 3300025929 Bacteria 2938
187 Ga0207664_10506256 3300025929 Bacteria 1081
188 Ga0207644_10120446 3300025931 Bacteria 1997
189 Ga0207644_10168973 3300025931 Bacteria 1706
190 Ga0207644_10210615 3300025931 Bacteria 1537
191 Ga0207706_10022128 3300025933 Bacteria 5706
192 Ga0207686_10024465 3300025934 Bacteria 3501
193 Ga0207686_10125784 3300025934 Bacteria 1751
194 Ga0207709_10219997 3300025935 Bacteria 1369
195 Ga0207665_10096075 3300025939 Bacteria 2060
196 Ga0207691_10015411 3300025940 Bacteria 7272
197 Ga0207691_10023409 3300025940 Bacteria 5814
198 Ga0207691_10300654 3300025940 Bacteria 1379
199 Ga0207661_10008852 3300025944 Bacteria 7204
200 Ga0207661_10010490 3300025944 Bacteria 6668
201 Ga0207661_10032177 3300025944 Bacteria 4060
202 Ga0207661_10040133 3300025944 Bacteria 3678
203 Ga0207661_10130659 3300025944 Bacteria 2150
204 Ga0207661_10145771 3300025944 Bacteria 2042
205 Ga0207679_10067958 3300025945 Bacteria 2675
206 Ga0207679_10299423 3300025945 Bacteria 1386
207 Ga0207667_10017939 3300025949 Bacteria 7954
208 Ga0207667_10383863 3300025949 Bacteria 1431
209 Ga0207667_10702245 3300025949 Bacteria 1014
210 Ga0207712_10000346 3300025961 Bacteria 41710
211 Ga0207668_10013788 3300025972 Bacteria 4988
212 Ga0207639_10211654 3300026041 Bacteria 1669
213 Ga0207639_10236676 3300026041 Bacteria 1586
214 Ga0207639_10617514 3300026041 Bacteria 1001
215 Ga0207648_10034041 3300026089 Bacteria 4493
216 Ga0207648_10034098 3300026089 Bacteria 4489
217 Ga0207648_10060985 3300026089 Bacteria 3289
218 Ga0207674_10042077 3300026116 Bacteria 4722
219 Ga0207683_10333295 3300026121 Bacteria 1391
220 Ga0207698_10009726 3300026142 Bacteria 6140
221 Ga0268265_10000331 3300028380 Bacteria 51469
222 Ga0265332_10022936 3300031238 Bacteria 2753
223 Ga0265327_10041503 3300031251 Bacteria 2479
224 Ga0265314_10040802 3300031711 Bacteria 3327
225 Ga0316576_10073366 3300031727 Bacteria 2529
226 Ga0316578_10013514 3300031728 Bacteria 4333
227 Ga0373934_0000102 3300035086 Bacteria 29993
228 Ga0373934_0000322 3300035086 Bacteria 16849
229 Ga0373923_0001898 3300035111 Bacteria 6235
230 Ga0373923_0187988 3300035111 Bacteria 951
231 Ga0373945_0029363 3300035116 Bacteria 1932
232 Ga0373945_0081157 3300035116 Bacteria 1243
233 Ga0373953_0014920 3300035117 Unclassified 2804
234 Ga0373954_0025764 3300035118 Bacteria 2692
235 Ga0373956_0000206 3300035119 Bacteria 22898
236 Ga0373956_0031411 3300035119 Bacteria 2327
237 Ga0373956_0099394 3300035119 Bacteria 1348
238 Ga0373957_0002618 3300035120 Bacteria 5167
239 Ga0373957_0069727 3300035120 Bacteria 1373
240 Ga0373960_0109316 3300035121 Bacteria 905
241 Ga0373955_0000727 3300035172 Bacteria 14089
242 Ga0373955_0003325 3300035172 Bacteria 7064
243 Ga0373931_0083948 3300035691 Bacteria 1763
244 Ga0373931_0122158 3300035691 Bacteria 1489
245 Ga0373935_0153306 3300035692 Bacteria 1565
246 Ga0373927_0383110 3300035695 Bacteria 927
247 Ga0373933_0001525 3300035724 Bacteria 13513
248 Ga0373933_0011539 3300035724 Bacteria 4875
249 Ga0373947_0061652 3300035725 Bacteria 2280
250 Ga0373937_0000444 3300036401 Bacteria 38345
251 Ga0373937_0004318 3300036401 Bacteria 12058
252 Ga0373937_0024805 3300036401 Bacteria 5411
253 Ga0436364_1226216 3300037853 Bacteria 1025
254 Ga0439439_0050678 3300041406 Bacteria 1088
255 Ga0451853_0598990 3300041512 Bacteria 1147
256 Ga0439448_0048547 3300042005 Bacteria 1386
257 Ga0439462_0040761 3300042015 Bacteria 1239
258 Ga0453683_0002711 3300044673 Bacteria 13514
259 Ga0453683_0132950 3300044673 Bacteria 1569
260 Ga0453683_0202555 3300044673 Bacteria 1260
261 Ga0453683_0373198 3300044673 Bacteria 918
262 Ga0453684_0000162 3300044712 Bacteria 298154
263 Ga0453684_0075905 3300044712 Bacteria 4222
264 Ga0453684_0190368 3300044712 Bacteria 2400
265 Ga0453684_0536772 3300044712 Bacteria 1290
266 Ga0466957_0023788 3300044842 Bacteria 3624
267 Ga0451576_0000242 3300045051 Bacteria 133680
268 Ga0451576_0083469 3300045051 Bacteria 3323
269 Ga0466958_0015034 3300045836 Bacteria 4428
270 Ga0466967_0062939 3300045976 Bacteria 3295
271 Ga0466967_0077476 3300045976 Bacteria 2993
272 Ga0495592_0002166 3300046454 Bacteria 13834
273 Ga0495629_0042780 3300046459 Bacteria 3182
274 Ga0495629_0069614 3300046459 Bacteria 2455
275 Ga0495629_0293876 3300046459 Bacteria 1113
276 Ga0495651_0000063 3300046462 Bacteria 78974
277 Ga0495653_0000136 3300046463 Bacteria 60956
278 Ga0495653_0016482 3300046463 Bacteria 6015
279 Ga0495580_0011862 3300046472 Bacteria 6719
280 Ga0495580_0055273 3300046472 Bacteria 2798
281 Ga0495582_0014759 3300046473 Bacteria 4293
282 Ga0495582_0102584 3300046473 Bacteria 1602
283 Ga0495582_0272555 3300046473 Bacteria 971
284 Ga0495639_0055928 3300046475 Bacteria 1800
285 Ga0495662_0108759 3300046476 Bacteria 1358
286 Ga0495594_0069004 3300046499 Bacteria 1963
287 Ga0495594_0121894 3300046499 Bacteria 1474
288 Ga0495608_0000059 3300046511 Bacteria 89203
289 Ga0495618_0155711 3300046514 Bacteria 1458
290 Ga0495618_0212727 3300046514 Bacteria 1221
291 Ga0495628_0000089 3300046516 Bacteria 72154
292 Ga0495628_0030606 3300046516 Bacteria 4357
293 Ga0495630_0000633 3300046517 Bacteria 25465
294 Ga0495630_0006570 3300046517 Bacteria 8282
295 Ga0495652_0002865 3300046529 Bacteria 17394
296 Ga0495652_0008137 3300046529 Bacteria 9590
297 Ga0495665_0025305 3300046531 Bacteria 3189
298 Ga0495665_0112409 3300046531 Bacteria 1428
299 Ga0495586_0012604 3300046535 Bacteria 4484
300 Ga0495587_0000326 3300046536 Bacteria 33958
301 Ga0495587_0006354 3300046536 Bacteria 7704
302 Ga0495587_0021470 3300046536 Bacteria 3982
303 Ga0495645_0000403 3300046543 Bacteria 29779
304 Ga0495645_0001447 3300046543 Bacteria 16038
305 Ga0495645_0113942 3300046543 Bacteria 1911
306 Ga0495667_0000181 3300046559 Bacteria 42708
307 Ga0495667_0008694 3300046559 Bacteria 6893
308 Ga0495635_0000099 3300046663 Bacteria 51232
309 Ga0495635_0117633 3300046663 Bacteria 1814
310 Ga0495588_0014707 3300046674 Bacteria 3752
311 Ga0495657_0000264 3300046675 Bacteria 47805
312 Ga0495657_0282769 3300046675 Bacteria 992
313 Ga0495599_0000525 3300046678 Bacteria 22043
314 Ga0495599_0002098 3300046678 Bacteria 11571
315 Ga0495599_0022990 3300046678 Bacteria 3894
316 Ga0495623_0000010 3300046679 Bacteria 121464
317 Ga0495623_0009811 3300046679 Bacteria 6205
318 Ga0495623_0084165 3300046679 Bacteria 1963
319 Ga0495646_0000340 3300046680 Bacteria 23878
320 Ga0495646_0011892 3300046680 Bacteria 5537
321 Ga0495658_0073079 3300046683 Bacteria 1996
322 Ga0495613_0079397 3300046689 Unclassified 2386
323 Ga0495613_0260924 3300046689 Bacteria 1207
324 Ga0495600_0000299 3300046809 Bacteria 26483
325 Ga0495600_0100289 3300046809 Bacteria 1887
326 Ga0495581_0039394 3300047315 Bacteria 2735
327 Ga0495581_0055538 3300047315 Bacteria 2285
328 Ga0495604_0001216 3300047317 Bacteria 21184
329 Ga0495604_0223647 3300047317 Bacteria 1295
330 Ga0495636_0063132 3300047318 Bacteria 1569
331 Ga0495674_0004267 3300047319 Bacteria 13762
332 Ga0495674_0086370 3300047319 Bacteria 2686
333 Ga0495674_0180276 3300047319 Bacteria 1759
334 Ga0495674_0309932 3300047319 Bacteria 1288
335 Ga0495680_0068544 3300047322 Unclassified 2710
336 Ga0495680_0254518 3300047322 Unclassified 1244
337 Ga0495675_0007214 3300047444 Bacteria 6847
338 Ga0495675_0036248 3300047444 Bacteria 3146
339 Ga0495675_0255588 3300047444 Bacteria 1051
340 Ga0495685_060522 3300047447 Bacteria 1276
341 Ga0495684_0014101 3300047471 Bacteria 6148
342 Ga0495684_0075260 3300047471 Bacteria 2565
343 Ga0495684_0097721 3300047471 Bacteria 2221
344 Ga0495593_0161912 3300047673 Bacteria 1129
345 Ga0495602_0000308 3300048088 Bacteria 45250
346 Ga0495602_0282668 3300048088 Bacteria 1221
347 Ga0496105_0067933 3300048908 Bacteria 2944
348 Ga0496108_0181188 3300048911 Bacteria 1824
349 Ga0496108_0264577 3300048911 Bacteria 1496
350 Ga0496109_0248194 3300048912 Bacteria 1676
351 Ga0496112_0001470 3300048915 Bacteria 18080
352 Ga0496113_0005842 3300048916 Bacteria 7723
353 Ga0501042_0129037 3300049578 Bacteria 1822
354 Ga0501043_0352823 3300049579 Bacteria 1117
355 Ga0501047_0023281 3300049581 Bacteria 5948
356 Ga0501081_0360055 3300049743 Unclassified 1073
357 Ga0501044_0455116 3300049823 Bacteria 1186
358 nmdc:mga05p37_12342_c1 3300050507 Bacteria 10205
359 nmdc:mga05p37_360791_c1 3300050507 Bacteria 1708
360 nmdc:mga09592_231700_c1 3300050508 Bacteria 1600
361 nmdc:mga09592_99583_c1 3300050508 Bacteria 2488
362 nmdc:mga0qj67_282988_c1 3300050509 Bacteria 1344
363 nmdc:mga0qj67_3012_c1 3300050509 Bacteria 12105
364 nmdc:mga06r32_10791_c1 3300050510 Bacteria 8230
365 nmdc:mga06r32_474678_c1 3300050510 Bacteria 1229
366 nmdc:mga06r32_49533_c1 3300050510 Bacteria 4017
367 nmdc:mga06r32_752254_c1 3300050510 Bacteria 938
368 nmdc:mga08y16_360131_c1 3300050511 Bacteria 1493
369 nmdc:mga0n895_12908_c1 3300050512 Bacteria 7509
370 nmdc:mga0n895_2705_c1 3300050512 Bacteria 13993
371 nmdc:mga0n895_80297_c1 3300050512 Bacteria 3250
372 nmdc:mga0rr50_195402_c1 3300050513 Unclassified 1660
373 nmdc:mga0rr50_244200_c1 3300050513 Bacteria 1489
374 nmdc:mga0rr50_372674_c1 3300050513 Unclassified 1203
375 nmdc:mga0a205_29161_c1 3300050515 Bacteria 5282
376 nmdc:mga0a205_8843_c1 3300050515 Bacteria 9175
377 Ga0495601_0012736 3300053077 Bacteria 5047
378 Ga0495601_0032034 3300053077 Bacteria 3270
379 Ga0495612_0066216 3300053078 Bacteria 1501
380 Ga0495619_0000524 3300053085 Bacteria 25395
381 Ga0495619_0076986 3300053085 Bacteria 2240
382 Ga0495619_0477478 3300053085 Bacteria 858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025940 Ga0207691_10023409 Ga0207691_100234097 260
2 3300050512 nmdc:mga0n895_2705_c1 nmdc:mga0n895_2705_c1_2770_3567 261
3 3300050515 nmdc:mga0a205_29161_c1 nmdc:mga0a205_29161_c1_3569_4366 261
4 3300005530 Ga0070679_100027907 Ga0070679_1000279076 262
5 3300025921 Ga0207652_10046457 Ga0207652_100464572 262
6 3300025944 Ga0207661_10145771 Ga0207661_101457713 262
7 3300041406 Ga0439439_0050678 Ga0439439_0050678_170_958 262
8 3300042015 Ga0439462_0040761 Ga0439462_0040761_92_880 262
9 3300005564 Ga0070664_100115576 Ga0070664_1001155763 264
10 3300005616 Ga0068852_100464007 Ga0068852_1004640071 264
11 3300048911 Ga0496108_0181188 Ga0496108_0181188_94_921 264
12 3300048912 Ga0496109_0248194 Ga0496109_0248194_643_1485 264
13 3300003203 JGI25406J46586_10035914 JGI25406J46586_100359143 265
14 3300005336 Ga0070680_100051150 Ga0070680_1000511502 265
15 3300005336 Ga0070680_100157383 Ga0070680_1001573832 265
16 3300005518 Ga0070699_100177358 Ga0070699_1001773583 265
17 3300005546 Ga0070696_100000178 Ga0070696_1000001786 265
18 3300005985 Ga0081539_10000097 Ga0081539_1000009769 265
19 3300025917 Ga0207660_10001781 Ga0207660_100017814 265
20 3300025917 Ga0207660_10040997 Ga0207660_100409973 265
21 3300047318 Ga0495636_0063132 Ga0495636_0063132_528_1340 265
22 3300005327 Ga0070658_10352429 Ga0070658_103524291 266
23 3300005329 Ga0070683_100000188 Ga0070683_1000001888 266
24 3300005329 Ga0070683_100168811 Ga0070683_1001688113 266
25 3300005353 Ga0070669_100039955 Ga0070669_1000399552 266
26 3300005364 Ga0070673_100116095 Ga0070673_1001160953 266
27 3300005365 Ga0070688_100022535 Ga0070688_1000225356 266
28 3300005366 Ga0070659_100414248 Ga0070659_1004142482 266
29 3300005518 Ga0070699_100032893 Ga0070699_1000328934 266
30 3300005535 Ga0070684_100014976 Ga0070684_1000149767 266
31 3300005535 Ga0070684_100102204 Ga0070684_1001022043 266
32 3300005535 Ga0070684_100122546 Ga0070684_1001225462 266
33 3300005543 Ga0070672_100029913 Ga0070672_1000299133 266
34 3300005564 Ga0070664_100003935 Ga0070664_1000039354 266
35 3300005616 Ga0068852_100087260 Ga0068852_1000872602 266
36 3300005617 Ga0068859_100003493 Ga0068859_10000349314 266
37 3300005840 Ga0068870_10049478 Ga0068870_100494782 266
38 3300006931 Ga0097620_100003493 Ga0097620_10000349314 266
39 3300009551 Ga0105238_10204124 Ga0105238_102041242 266
40 3300013105 Ga0157369_10179014 Ga0157369_101790143 266
41 3300014326 Ga0157380_10019448 Ga0157380_100194482 266
42 3300025315 Ga0207697_10023106 Ga0207697_100231062 266
43 3300025893 Ga0207682_10004036 Ga0207682_100040367 266
44 3300025901 Ga0207688_10143398 Ga0207688_101433982 266
45 3300025908 Ga0207643_10000956 Ga0207643_100009561 266
46 3300025923 Ga0207681_10060542 Ga0207681_100605424 266
47 3300025926 Ga0207659_10061058 Ga0207659_100610584 266
48 3300025931 Ga0207644_10120446 Ga0207644_101204461 266
49 3300025940 Ga0207691_10015411 Ga0207691_100154114 266
50 3300025944 Ga0207661_10008852 Ga0207661_100088527 266
51 3300025944 Ga0207661_10010490 Ga0207661_100104903 266
52 3300037853 Ga0436364_1226216 Ga0436364_1226216_57_893 266
53 3300041512 Ga0451853_0598990 Ga0451853_0598990_309_1109 266
54 3300044673 Ga0453683_0132950 Ga0453683_0132950_12_812 266
55 3300044673 Ga0453683_0202555 Ga0453683_0202555_313_1113 266
56 3300044712 Ga0453684_0000162 Ga0453684_0000162_256737_257537 266
57 3300045051 Ga0451576_0000242 Ga0451576_0000242_32431_33231 266
58 3300047447 Ga0495685_060522 Ga0495685_060522_27_899 266
59 3300005327 Ga0070658_10004268 Ga0070658_100042687 267
60 3300005327 Ga0070658_10175339 Ga0070658_101753393 267
61 3300005327 Ga0070658_10287461 Ga0070658_102874612 267
62 3300005329 Ga0070683_100049756 Ga0070683_1000497562 267
63 3300005336 Ga0070680_100009895 Ga0070680_1000098957 267
64 3300005336 Ga0070680_100197445 Ga0070680_1001974451 267
65 3300005339 Ga0070660_100005681 Ga0070660_1000056818 267
66 3300005366 Ga0070659_100010163 Ga0070659_1000101638 267
67 3300005435 Ga0070714_100000743 Ga0070714_1000007437 267
68 3300005435 Ga0070714_100067734 Ga0070714_1000677343 267
69 3300005436 Ga0070713_100561156 Ga0070713_1005611561 267
70 3300005445 Ga0070708_100049549 Ga0070708_1000495493 267
71 3300005458 Ga0070681_10013292 Ga0070681_100132927 267
72 3300005458 Ga0070681_10036927 Ga0070681_100369273 267
73 3300005518 Ga0070699_100010504 Ga0070699_1000105046 267
74 3300005530 Ga0070679_100023359 Ga0070679_1000233595 267
75 3300005530 Ga0070679_100066706 Ga0070679_1000667065 267
76 3300005535 Ga0070684_100144758 Ga0070684_1001447582 267
77 3300005535 Ga0070684_100178433 Ga0070684_1001784332 267
78 3300005536 Ga0070697_100082786 Ga0070697_1000827862 267
79 3300005539 Ga0068853_100025555 Ga0068853_1000255553 267
80 3300005539 Ga0068853_100236093 Ga0068853_1002360933 267
81 3300005547 Ga0070693_100015155 Ga0070693_1000151551 267
82 3300005616 Ga0068852_100023021 Ga0068852_1000230213 267
83 3300005618 Ga0068864_100221405 Ga0068864_1002214052 267
84 3300006847 Ga0075431_100033189 Ga0075431_1000331894 267
85 3300006852 Ga0075433_10015980 Ga0075433_100159802 267
86 3300006871 Ga0075434_100007050 Ga0075434_1000070509 267
87 3300006880 Ga0075429_100067940 Ga0075429_1000679403 267
88 3300013100 Ga0157373_10244381 Ga0157373_102443811 267
89 3300013102 Ga0157371_10117010 Ga0157371_101170103 267
90 3300013105 Ga0157369_10519024 Ga0157369_105190241 267
91 3300013307 Ga0157372_10018513 Ga0157372_100185138 267
92 3300013307 Ga0157372_10277095 Ga0157372_102770953 267
93 3300013307 Ga0157372_10353991 Ga0157372_103539913 267
94 3300013307 Ga0157372_10505107 Ga0157372_105051072 267
95 3300025909 Ga0207705_10010652 Ga0207705_100106524 267
96 3300025909 Ga0207705_10032637 Ga0207705_100326376 267
97 3300025909 Ga0207705_10224792 Ga0207705_102247922 267
98 3300025912 Ga0207707_10023792 Ga0207707_100237925 267
99 3300025919 Ga0207657_10013864 Ga0207657_100138647 267
100 3300025921 Ga0207652_10047123 Ga0207652_100471236 267
101 3300025921 Ga0207652_10129509 Ga0207652_101295092 267
102 3300025921 Ga0207652_10337810 Ga0207652_103378102 267
103 3300025929 Ga0207664_10064085 Ga0207664_100640851 267
104 3300025949 Ga0207667_10017939 Ga0207667_100179394 267
105 3300026041 Ga0207639_10211654 Ga0207639_102116543 267
106 3300026041 Ga0207639_10236676 Ga0207639_102366763 267
107 3300026142 Ga0207698_10009726 Ga0207698_100097263 267
108 3300031238 Ga0265332_10022936 Ga0265332_100229362 267
109 3300031251 Ga0265327_10041503 Ga0265327_100415033 267
110 3300031711 Ga0265314_10040802 Ga0265314_100408022 267
111 3300031727 Ga0316576_10073366 Ga0316576_100733662 267
112 3300031728 Ga0316578_10013514 Ga0316578_100135142 267
113 3300044673 Ga0453683_0002711 Ga0453683_0002711_5867_6676 267
114 3300044673 Ga0453683_0373198 Ga0453683_0373198_17_826 267
115 3300044712 Ga0453684_0190368 Ga0453684_0190368_311_1120 267
116 3300044712 Ga0453684_0536772 Ga0453684_0536772_143_952 267
117 3300045051 Ga0451576_0083469 Ga0451576_0083469_568_1383 267
118 3300049578 Ga0501042_0129037 Ga0501042_0129037_924_1727 267
119 3300049579 Ga0501043_0352823 Ga0501043_0352823_150_977 267
120 3300049581 Ga0501047_0023281 Ga0501047_0023281_164_991 267
121 3300049743 Ga0501081_0360055 Ga0501081_0360055_228_1031 267
122 3300049823 Ga0501044_0455116 Ga0501044_0455116_349_1176 267
123 3300050512 nmdc:mga0n895_80297_c1 nmdc:mga0n895_80297_c1_1553_2419 267
124 3300050513 nmdc:mga0rr50_195402_c1 nmdc:mga0rr50_195402_c1_103_969 267
125 3300050513 nmdc:mga0rr50_372674_c1 nmdc:mga0rr50_372674_c1_82_948 267
126 2162886012 MBSR1b_contig_10993801 MBSR1b_0397.00005860 268
127 2162886012 MBSR1b_contig_4224469 MBSR1b_0585.00002970 268
128 3300005329 Ga0070683_100013842 Ga0070683_1000138427 268
129 3300005329 Ga0070683_100040584 Ga0070683_1000405842 268
130 3300005329 Ga0070683_100075785 Ga0070683_1000757853 268
131 3300005329 Ga0070683_100129402 Ga0070683_1001294023 268
132 3300005336 Ga0070680_100024264 Ga0070680_1000242642 268
133 3300005336 Ga0070680_100054126 Ga0070680_1000541261 268
134 3300005337 Ga0070682_100209320 Ga0070682_1002093202 268
135 3300005340 Ga0070689_100332399 Ga0070689_1003323991 268
136 3300005344 Ga0070661_100051570 Ga0070661_1000515703 268
137 3300005344 Ga0070661_100100089 Ga0070661_1001000892 268
138 3300005353 Ga0070669_100001653 Ga0070669_1000016535 268
139 3300005354 Ga0070675_100471670 Ga0070675_1004716701 268
140 3300005355 Ga0070671_100287965 Ga0070671_1002879652 268
141 3300005356 Ga0070674_100130044 Ga0070674_1001300441 268
142 3300005364 Ga0070673_100479154 Ga0070673_1004791541 268
143 3300005434 Ga0070709_10305894 Ga0070709_103058941 268
144 3300005435 Ga0070714_100009338 Ga0070714_1000093388 268
145 3300005435 Ga0070714_100093454 Ga0070714_1000934543 268
146 3300005436 Ga0070713_100000053 Ga0070713_10000005335 268
147 3300005436 Ga0070713_100001087 Ga0070713_1000010876 268
148 3300005439 Ga0070711_100027505 Ga0070711_1000275056 268
149 3300005441 Ga0070700_100027476 Ga0070700_1000274761 268
150 3300005445 Ga0070708_100000113 Ga0070708_10000011314 268
151 3300005455 Ga0070663_100441466 Ga0070663_1004414662 268
152 3300005456 Ga0070678_100201240 Ga0070678_1002012402 268
153 3300005458 Ga0070681_10005965 Ga0070681_100059654 268
154 3300005458 Ga0070681_10059253 Ga0070681_100592532 268
155 3300005459 Ga0068867_100044986 Ga0068867_1000449862 268
156 3300005459 Ga0068867_100232479 Ga0068867_1002324792 268
157 3300005530 Ga0070679_100002807 Ga0070679_10000280714 268
158 3300005530 Ga0070679_100073615 Ga0070679_1000736151 268
159 3300005535 Ga0070684_100000655 Ga0070684_1000006553 268
160 3300005535 Ga0070684_100006002 Ga0070684_1000060022 268
161 3300005535 Ga0070684_100035912 Ga0070684_1000359125 268
162 3300005535 Ga0070684_100129354 Ga0070684_1001293542 268
163 3300005535 Ga0070684_100572803 Ga0070684_1005728031 268
164 3300005539 Ga0068853_100436614 Ga0068853_1004366143 268
165 3300005547 Ga0070693_100152149 Ga0070693_1001521492 268
166 3300005548 Ga0070665_100084778 Ga0070665_1000847785 268
167 3300005563 Ga0068855_100037707 Ga0068855_1000377072 268
168 3300005564 Ga0070664_100119656 Ga0070664_1001196565 268
169 3300005577 Ga0068857_100061133 Ga0068857_1000611332 268
170 3300005718 Ga0068866_10001507 Ga0068866_100015072 268
171 3300005719 Ga0068861_100013517 Ga0068861_1000135174 268
172 3300005844 Ga0068862_100000345 Ga0068862_10000034540 268
173 3300006028 Ga0070717_10022917 Ga0070717_100229175 268
174 3300006846 Ga0075430_100010284 Ga0075430_1000102843 268
175 3300006847 Ga0075431_100017941 Ga0075431_1000179412 268
176 3300006847 Ga0075431_100059930 Ga0075431_1000599302 268
177 3300006847 Ga0075431_100162452 Ga0075431_1001624522 268
178 3300006852 Ga0075433_10014841 Ga0075433_100148413 268
179 3300006871 Ga0075434_100044332 Ga0075434_1000443323 268
180 3300006880 Ga0075429_100104004 Ga0075429_1001040041 268
181 3300006880 Ga0075429_100207821 Ga0075429_1002078212 268
182 3300006881 Ga0068865_100206779 Ga0068865_1002067792 268
183 3300007076 Ga0075435_100339457 Ga0075435_1003394572 268
184 3300009093 Ga0105240_10250158 Ga0105240_102501584 268
185 3300009094 Ga0111539_10058673 Ga0111539_100586734 268
186 3300009098 Ga0105245_10111011 Ga0105245_101110113 268
187 3300009147 Ga0114129_10042847 Ga0114129_100428474 268
188 3300009147 Ga0114129_10816011 Ga0114129_108160112 268
189 3300009148 Ga0105243_10165404 Ga0105243_101654043 268
190 3300009148 Ga0105243_10674367 Ga0105243_106743671 268
191 3300009174 Ga0105241_10296230 Ga0105241_102962302 268
192 3300009176 Ga0105242_10538843 Ga0105242_105388431 268
193 3300009551 Ga0105238_10176575 Ga0105238_101765752 268
194 3300009553 Ga0105249_10000276 Ga0105249_1000027639 268
195 3300009553 Ga0105249_10746392 Ga0105249_107463921 268
196 3300011119 Ga0105246_10188856 Ga0105246_101888562 268
197 3300013100 Ga0157373_10068551 Ga0157373_100685512 268
198 3300013104 Ga0157370_10050519 Ga0157370_100505192 268
199 3300013104 Ga0157370_10158652 Ga0157370_101586524 268
200 3300013105 Ga0157369_10219016 Ga0157369_102190163 268
201 3300013307 Ga0157372_10027774 Ga0157372_100277746 268
202 3300013307 Ga0157372_10071382 Ga0157372_100713824 268
203 3300013308 Ga0157375_10017466 Ga0157375_100174662 268
204 3300013308 Ga0157375_10211804 Ga0157375_102118043 268
205 3300014326 Ga0157380_10020894 Ga0157380_100208942 268
206 3300014969 Ga0157376_10064709 Ga0157376_100647094 268
207 3300025899 Ga0207642_10033753 Ga0207642_100337532 268
208 3300025906 Ga0207699_10003737 Ga0207699_100037376 268
209 3300025907 Ga0207645_10149758 Ga0207645_101497583 268
210 3300025908 Ga0207643_10007256 Ga0207643_100072565 268
211 3300025912 Ga0207707_10017061 Ga0207707_100170615 268
212 3300025912 Ga0207707_10074788 Ga0207707_100747881 268
213 3300025912 Ga0207707_10348500 Ga0207707_103485001 268
214 3300025913 Ga0207695_10003339 Ga0207695_1000333917 268
215 3300025913 Ga0207695_10252864 Ga0207695_102528641 268
216 3300025915 Ga0207693_10221409 Ga0207693_102214091 268
217 3300025916 Ga0207663_10051440 Ga0207663_100514403 268
218 3300025917 Ga0207660_10069788 Ga0207660_100697884 268
219 3300025921 Ga0207652_10000673 Ga0207652_100006734 268
220 3300025922 Ga0207646_10030877 Ga0207646_100308771 268
221 3300025923 Ga0207681_10000315 Ga0207681_1000031516 268
222 3300025926 Ga0207659_10121519 Ga0207659_101215191 268
223 3300025926 Ga0207659_10176758 Ga0207659_101767582 268
224 3300025927 Ga0207687_10051957 Ga0207687_100519573 268
225 3300025928 Ga0207700_10002442 Ga0207700_100024427 268
226 3300025928 Ga0207700_10003995 Ga0207700_100039956 268
227 3300025928 Ga0207700_10013413 Ga0207700_100134136 268
228 3300025929 Ga0207664_10010918 Ga0207664_100109182 268
229 3300025929 Ga0207664_10506256 Ga0207664_105062562 268
230 3300025931 Ga0207644_10168973 Ga0207644_101689732 268
231 3300025931 Ga0207644_10210615 Ga0207644_102106153 268
232 3300025933 Ga0207706_10022128 Ga0207706_100221287 268
233 3300025934 Ga0207686_10024465 Ga0207686_100244654 268
234 3300025934 Ga0207686_10125784 Ga0207686_101257841 268
235 3300025935 Ga0207709_10219997 Ga0207709_102199971 268
236 3300025939 Ga0207665_10096075 Ga0207665_100960752 268
237 3300025940 Ga0207691_10300654 Ga0207691_103006542 268
238 3300025944 Ga0207661_10032177 Ga0207661_100321774 268
239 3300025944 Ga0207661_10040133 Ga0207661_100401335 268
240 3300025944 Ga0207661_10130659 Ga0207661_101306593 268
241 3300025945 Ga0207679_10067958 Ga0207679_100679583 268
242 3300025945 Ga0207679_10299423 Ga0207679_102994233 268
243 3300025949 Ga0207667_10383863 Ga0207667_103838632 268
244 3300025949 Ga0207667_10702245 Ga0207667_107022451 268
245 3300025961 Ga0207712_10000346 Ga0207712_1000034636 268
246 3300025972 Ga0207668_10013788 Ga0207668_100137882 268
247 3300026041 Ga0207639_10617514 Ga0207639_106175141 268
248 3300026089 Ga0207648_10034041 Ga0207648_100340413 268
249 3300026089 Ga0207648_10034098 Ga0207648_100340983 268
250 3300026089 Ga0207648_10060985 Ga0207648_100609855 268
251 3300026116 Ga0207674_10042077 Ga0207674_100420777 268
252 3300026121 Ga0207683_10333295 Ga0207683_103332952 268
253 3300028380 Ga0268265_10000331 Ga0268265_1000033141 268
254 3300035086 Ga0373934_0000102 Ga0373934_0000102_12283_13161 268
255 3300035086 Ga0373934_0000322 Ga0373934_0000322_4509_5318 268
256 3300035111 Ga0373923_0001898 Ga0373923_0001898_4994_5872 268
257 3300035111 Ga0373923_0187988 Ga0373923_0187988_131_937 268
258 3300035116 Ga0373945_0029363 Ga0373945_0029363_489_1295 268
259 3300035116 Ga0373945_0081157 Ga0373945_0081157_272_1081 268
260 3300035117 Ga0373953_0014920 Ga0373953_0014920_1376_2254 268
261 3300035118 Ga0373954_0025764 Ga0373954_0025764_584_1393 268
262 3300035119 Ga0373956_0000206 Ga0373956_0000206_251_1129 268
263 3300035119 Ga0373956_0031411 Ga0373956_0031411_1504_2310 268
264 3300035119 Ga0373956_0099394 Ga0373956_0099394_327_1136 268
265 3300035120 Ga0373957_0002618 Ga0373957_0002618_316_1194 268
266 3300035120 Ga0373957_0069727 Ga0373957_0069727_480_1289 268
267 3300035121 Ga0373960_0109316 Ga0373960_0109316_26_847 268
268 3300035172 Ga0373955_0000727 Ga0373955_0000727_4001_4807 268
269 3300035172 Ga0373955_0003325 Ga0373955_0003325_535_1413 268
270 3300035691 Ga0373931_0083948 Ga0373931_0083948_22_843 268
271 3300035691 Ga0373931_0122158 Ga0373931_0122158_171_992 268
272 3300035692 Ga0373935_0153306 Ga0373935_0153306_525_1331 268
273 3300035695 Ga0373927_0383110 Ga0373927_0383110_69_875 268
274 3300035724 Ga0373933_0001525 Ga0373933_0001525_511_1389 268
275 3300035724 Ga0373933_0011539 Ga0373933_0011539_413_1219 268
276 3300035725 Ga0373947_0061652 Ga0373947_0061652_40_849 268
277 3300036401 Ga0373937_0000444 Ga0373937_0000444_25745_26623 268
278 3300036401 Ga0373937_0004318 Ga0373937_0004318_3208_4014 268
279 3300036401 Ga0373937_0024805 Ga0373937_0024805_4158_4967 268
280 3300042005 Ga0439448_0048547 Ga0439448_0048547_130_939 268
281 3300044712 Ga0453684_0075905 Ga0453684_0075905_1049_1861 268
282 3300044842 Ga0466957_0023788 Ga0466957_0023788_1582_2400 268
283 3300045836 Ga0466958_0015034 Ga0466958_0015034_718_1536 268
284 3300045976 Ga0466967_0062939 Ga0466967_0062939_844_1653 268
285 3300045976 Ga0466967_0077476 Ga0466967_0077476_673_1482 268
286 3300046454 Ga0495592_0002166 Ga0495592_0002166_7605_8483 268
287 3300046459 Ga0495629_0042780 Ga0495629_0042780_753_1559 268
288 3300046459 Ga0495629_0069614 Ga0495629_0069614_1547_2356 268
289 3300046459 Ga0495629_0293876 Ga0495629_0293876_61_870 268
290 3300046462 Ga0495651_0000063 Ga0495651_0000063_25745_26623 268
291 3300046463 Ga0495653_0000136 Ga0495653_0000136_29757_30635 268
292 3300046463 Ga0495653_0016482 Ga0495653_0016482_4312_5121 268
293 3300046472 Ga0495580_0011862 Ga0495580_0011862_3548_4357 268
294 3300046472 Ga0495580_0055273 Ga0495580_0055273_289_1095 268
295 3300046473 Ga0495582_0014759 Ga0495582_0014759_864_1673 268
296 3300046473 Ga0495582_0102584 Ga0495582_0102584_642_1448 268
297 3300046473 Ga0495582_0272555 Ga0495582_0272555_101_907 268
298 3300046475 Ga0495639_0055928 Ga0495639_0055928_974_1780 268
299 3300046476 Ga0495662_0108759 Ga0495662_0108759_362_1171 268
300 3300046499 Ga0495594_0069004 Ga0495594_0069004_678_1484 268
301 3300046499 Ga0495594_0121894 Ga0495594_0121894_215_1030 268
302 3300046511 Ga0495608_0000059 Ga0495608_0000059_524_1402 268
303 3300046514 Ga0495618_0155711 Ga0495618_0155711_234_1112 268
304 3300046514 Ga0495618_0212727 Ga0495618_0212727_354_1163 268
305 3300046516 Ga0495628_0000089 Ga0495628_0000089_39344_40222 268
306 3300046516 Ga0495628_0030606 Ga0495628_0030606_3521_4330 268
307 3300046517 Ga0495630_0000633 Ga0495630_0000633_19059_19937 268
308 3300046517 Ga0495630_0006570 Ga0495630_0006570_6655_7461 268
309 3300046529 Ga0495652_0002865 Ga0495652_0002865_3960_4769 268
310 3300046529 Ga0495652_0008137 Ga0495652_0008137_1672_2550 268
311 3300046531 Ga0495665_0025305 Ga0495665_0025305_845_1723 268
312 3300046531 Ga0495665_0112409 Ga0495665_0112409_569_1378 268
313 3300046535 Ga0495586_0012604 Ga0495586_0012604_2703_3509 268
314 3300046536 Ga0495587_0000326 Ga0495587_0000326_19900_20778 268
315 3300046536 Ga0495587_0006354 Ga0495587_0006354_1168_1974 268
316 3300046536 Ga0495587_0021470 Ga0495587_0021470_288_1097 268
317 3300046543 Ga0495645_0000403 Ga0495645_0000403_13698_14504 268
318 3300046543 Ga0495645_0001447 Ga0495645_0001447_7596_8405 268
319 3300046543 Ga0495645_0113942 Ga0495645_0113942_408_1217 268
320 3300046559 Ga0495667_0000181 Ga0495667_0000181_36759_37637 268
321 3300046559 Ga0495667_0008694 Ga0495667_0008694_2449_3255 268
322 3300046663 Ga0495635_0000099 Ga0495635_0000099_11605_12483 268
323 3300046663 Ga0495635_0117633 Ga0495635_0117633_57_863 268
324 3300046674 Ga0495588_0014707 Ga0495588_0014707_2340_3146 268
325 3300046675 Ga0495657_0000264 Ga0495657_0000264_12815_13693 268
326 3300046675 Ga0495657_0282769 Ga0495657_0282769_139_948 268
327 3300046678 Ga0495599_0000525 Ga0495599_0000525_1832_2710 268
328 3300046678 Ga0495599_0002098 Ga0495599_0002098_131_940 268
329 3300046678 Ga0495599_0022990 Ga0495599_0022990_494_1300 268
330 3300046679 Ga0495623_0000010 Ga0495623_0000010_106592_107470 268
331 3300046679 Ga0495623_0009811 Ga0495623_0009811_1644_2453 268
332 3300046679 Ga0495623_0084165 Ga0495623_0084165_908_1714 268
333 3300046680 Ga0495646_0000340 Ga0495646_0000340_8483_9361 268
334 3300046680 Ga0495646_0011892 Ga0495646_0011892_148_957 268
335 3300046683 Ga0495658_0073079 Ga0495658_0073079_18_827 268
336 3300046689 Ga0495613_0079397 Ga0495613_0079397_1219_2097 268
337 3300046689 Ga0495613_0260924 Ga0495613_0260924_14_823 268
338 3300046809 Ga0495600_0000299 Ga0495600_0000299_13995_14873 268
339 3300046809 Ga0495600_0100289 Ga0495600_0100289_320_1126 268
340 3300047315 Ga0495581_0039394 Ga0495581_0039394_1831_2640 268
341 3300047315 Ga0495581_0055538 Ga0495581_0055538_801_1607 268
342 3300047317 Ga0495604_0001216 Ga0495604_0001216_8584_9462 268
343 3300047317 Ga0495604_0223647 Ga0495604_0223647_407_1216 268
344 3300047319 Ga0495674_0004267 Ga0495674_0004267_12483_13361 268
345 3300047319 Ga0495674_0086370 Ga0495674_0086370_1166_1972 268
346 3300047319 Ga0495674_0180276 Ga0495674_0180276_687_1496 268
347 3300047319 Ga0495674_0309932 Ga0495674_0309932_81_890 268
348 3300047322 Ga0495680_0068544 Ga0495680_0068544_1436_2314 268
349 3300047322 Ga0495680_0254518 Ga0495680_0254518_62_871 268
350 3300047444 Ga0495675_0007214 Ga0495675_0007214_417_1295 268
351 3300047444 Ga0495675_0036248 Ga0495675_0036248_2320_3129 268
352 3300047444 Ga0495675_0255588 Ga0495675_0255588_218_1027 268
353 3300047471 Ga0495684_0014101 Ga0495684_0014101_1517_2326 268
354 3300047471 Ga0495684_0075260 Ga0495684_0075260_1246_2055 268
355 3300047471 Ga0495684_0097721 Ga0495684_0097721_1142_1948 268
356 3300047673 Ga0495593_0161912 Ga0495593_0161912_22_900 268
357 3300048088 Ga0495602_0000308 Ga0495602_0000308_36768_37646 268
358 3300048088 Ga0495602_0282668 Ga0495602_0282668_107_916 268
359 3300048908 Ga0496105_0067933 Ga0496105_0067933_146_955 268
360 3300048911 Ga0496108_0264577 Ga0496108_0264577_279_1100 268
361 3300048915 Ga0496112_0001470 Ga0496112_0001470_7225_8046 268
362 3300048916 Ga0496113_0005842 Ga0496113_0005842_1474_2295 268
363 3300050507 nmdc:mga05p37_12342_c1 nmdc:mga05p37_12342_c1_6481_7287 268
364 3300050507 nmdc:mga05p37_360791_c1 nmdc:mga05p37_360791_c1_15_821 268
365 3300050508 nmdc:mga09592_231700_c1 nmdc:mga09592_231700_c1_782_1588 268
366 3300050508 nmdc:mga09592_99583_c1 nmdc:mga09592_99583_c1_190_996 268
367 3300050509 nmdc:mga0qj67_282988_c1 nmdc:mga0qj67_282988_c1_77_883 268
368 3300050509 nmdc:mga0qj67_3012_c1 nmdc:mga0qj67_3012_c1_7598_8404 268
369 3300050510 nmdc:mga06r32_10791_c1 nmdc:mga06r32_10791_c1_361_1167 268
370 3300050510 nmdc:mga06r32_474678_c1 nmdc:mga06r32_474678_c1_334_1140 268
371 3300050510 nmdc:mga06r32_49533_c1 nmdc:mga06r32_49533_c1_753_1559 268
372 3300050510 nmdc:mga06r32_752254_c1 nmdc:mga06r32_752254_c1_46_852 268
373 3300050511 nmdc:mga08y16_360131_c1 nmdc:mga08y16_360131_c1_133_939 268
374 3300050512 nmdc:mga0n895_12908_c1 nmdc:mga0n895_12908_c1_5198_6004 268
375 3300050513 nmdc:mga0rr50_244200_c1 nmdc:mga0rr50_244200_c1_453_1274 268
376 3300050515 nmdc:mga0a205_8843_c1 nmdc:mga0a205_8843_c1_5301_6107 268
377 3300053077 Ga0495601_0012736 Ga0495601_0012736_3846_4655 268
378 3300053077 Ga0495601_0032034 Ga0495601_0032034_665_1543 268
379 3300053078 Ga0495612_0066216 Ga0495612_0066216_413_1291 268
380 3300053085 Ga0495619_0000524 Ga0495619_0000524_7074_7952 268
381 3300053085 Ga0495619_0076986 Ga0495619_0076986_858_1667 268
382 3300053085 Ga0495619_0477478 Ga0495619_0477478_22_831 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

39

143

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3txq-assembly1.cif.gz_I crystal structure of phage 44rr small terminase gp16 0.84 104 155
3txq-assembly1.cif.gz_D crystal structure of phage 44rr small terminase gp16 0.822 104 155
7w1m-assembly1.cif.gz_B cryo-em structure of human cohesin-ctcf-dna complex 0.7451 159 244
3kta-assembly2.cif.gz_D structural basis for adenylate kinase activity in abc atpases 0.7303 159 255
6qpw-assembly1.cif.gz_E structural basis of cohesin ring opening 0.7248 159 243
ID Description Score Start End Superfamily
3txqI01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.84 104 155 1.10.287.1060
3txsB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.8379 104 155 1.10.287.1060
3txqE01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.8286 104 155 1.10.287.1060
3txqD01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.822 104 155 1.10.287.1060
3txsD01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.8081 104 155 1.10.287.1060
ID Description Score Start End GO Terms
AF-A0A0S7ZA09-F1-model_v4 AAA+ ATPase domain-containing protein 0.9769 25 267 GO:0005524
GO:0006302
GO:0016887
AF-A0A1I5SQT2-F1-model_v4 AAA ATPase domain-containing protein 0.9752 183 267 GO:0005886
GO:0006811
AF-A0A2E9WZL8-F1-model_v4 ATPase AAA-type core domain-containing protein 0.9735 178 267 GO:0005524
GO:0016887
AF-A0A4U3BXV2-F1-model_v4 deleted 0.9722 172 267
AF-A0A1Q7MBJ8-F1-model_v4 ATPase AAA-type core domain-containing protein 0.9722 177 267 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.27 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map