F429191

General Info

Members Datasets Scaffolds Average Seq Length
382 163 764 168

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100161671|Ga0070669_1001616712
Length 181
Sequence MAGAMSGSANRTPPVYAPLIVTAEMAPADLAWLDALRRHHYPAERNQLPAHLTMFHALPPSLEGEARQRLALATKAKAPRAAVAGVMDLGGGVAFRIVSDDLDSIRNDLSDAFHGMLGAQDQGGWRPHVTIQNKVSNREARRLVDALQAGLAPRTLGISGLGLHRYLGGPWETLQVWSFRG

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
114 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
115 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
116 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
134 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
135 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
162 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.33
Rhizosphere 92.67
Stem 0
Stem Tuber 0
Unclassified 6.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100161671 3300005353 Bacteria 1740
2 MBSR1b_contig_694234 2162886012 Bacteria 883
3 Ga0065712_10076471 3300005290 Bacteria 3654
4 Ga0065712_10419691 3300005290 Bacteria 675
5 Ga0065715_10274245 3300005293 Unclassified 1103
6 Ga0070658_10030076 3300005327 Bacteria 4365
7 Ga0070658_10351973 3300005327 Bacteria 1261
8 Ga0070676_10084621 3300005328 Bacteria 1931
9 Ga0070676_10726352 3300005328 Unclassified 727
10 Ga0070690_100548537 3300005330 Bacteria 871
11 Ga0070670_100000600 3300005331 Bacteria 28387
12 Ga0070670_100053729 3300005331 Bacteria 3459
13 Ga0070670_100092519 3300005331 Bacteria 2600
14 Ga0070670_100263832 3300005331 Bacteria 1502
15 Ga0070677_10010152 3300005333 Bacteria 3212
16 Ga0068869_100310851 3300005334 Bacteria 1275
17 Ga0070666_10005514 3300005335 Bacteria 7763
18 Ga0070666_10545322 3300005335 Bacteria 843
19 Ga0070666_10549480 3300005335 Bacteria 840
20 Ga0070680_100729038 3300005336 Bacteria 853
21 Ga0068868_100243576 3300005338 Bacteria 1511
22 Ga0070660_100073254 3300005339 Bacteria 2678
23 Ga0070661_100011159 3300005344 Bacteria 6259
24 Ga0070661_100872713 3300005344 Bacteria 741
25 Ga0070668_100084537 3300005347 Bacteria 2493
26 Ga0070668_101444937 3300005347 Bacteria 628
27 Ga0070669_100018451 3300005353 Bacteria 4985
28 Ga0070669_100144498 3300005353 Bacteria 1837
29 Ga0070669_100452228 3300005353 Bacteria 1059
30 Ga0070675_100004368 3300005354 Bacteria 10784
31 Ga0070675_100027859 3300005354 Bacteria 4542
32 Ga0070675_100101004 3300005354 Bacteria 2430
33 Ga0070675_100726109 3300005354 Bacteria 906
34 Ga0070671_100000190 3300005355 Bacteria 41368
35 Ga0070671_100007604 3300005355 Bacteria 8666
36 Ga0070671_100027780 3300005355 Bacteria 4658
37 Ga0070671_100067204 3300005355 Bacteria 2988
38 Ga0070671_101055097 3300005355 Bacteria 713
39 Ga0070674_100047395 3300005356 Bacteria 2944
40 Ga0070674_100107493 3300005356 Bacteria 2043
41 Ga0070674_100785096 3300005356 Bacteria 821
42 Ga0070673_100206409 3300005364 Bacteria 1694
43 Ga0070659_100005399 3300005366 Bacteria 9177
44 Ga0070659_100050952 3300005366 Bacteria 3254
45 Ga0070659_101020879 3300005366 Unclassified 726
46 Ga0070667_100024135 3300005367 Bacteria 5050
47 Ga0070667_100267352 3300005367 Bacteria 1532
48 Ga0070667_100671282 3300005367 Bacteria 958
49 Ga0070714_100441402 3300005435 Bacteria 1235
50 Ga0070713_100007715 3300005436 Bacteria 7575
51 Ga0070663_100023003 3300005455 Bacteria 4173
52 Ga0070663_100056723 3300005455 Bacteria 2808
53 Ga0070663_100415273 3300005455 Bacteria 1103
54 Ga0070678_100012317 3300005456 Bacteria 5310
55 Ga0070678_100025075 3300005456 Bacteria 4004
56 Ga0070678_100055703 3300005456 Bacteria 2888
57 Ga0070662_100005543 3300005457 Bacteria 8065
58 Ga0070662_100009643 3300005457 Bacteria 6316
59 Ga0070662_100103024 3300005457 Bacteria 2163
60 Ga0070662_100307516 3300005457 Bacteria 1289
61 Ga0070681_10169878 3300005458 Bacteria 2103
62 Ga0068867_100046495 3300005459 Bacteria 3188
63 Ga0068853_100090345 3300005539 Bacteria 2692
64 Ga0068853_100095946 3300005539 Bacteria 2616
65 Ga0068853_100305872 3300005539 Bacteria 1471
66 Ga0070672_100006166 3300005543 Bacteria 8024
67 Ga0070672_100134869 3300005543 Bacteria 2032
68 Ga0070672_100854016 3300005543 Bacteria 803
69 Ga0070695_100102921 3300005545 Bacteria 1926
70 Ga0070693_100674434 3300005547 Bacteria 754
71 Ga0070665_100045039 3300005548 Bacteria 4430
72 Ga0070664_100001240 3300005564 Bacteria 20395
73 Ga0070664_100134072 3300005564 Bacteria 2177
74 Ga0070664_100347896 3300005564 Bacteria 1348
75 Ga0070664_100729031 3300005564 Bacteria 924
76 Ga0070664_101666643 3300005564 Unclassified 604
77 Ga0068857_100541320 3300005577 Bacteria 1096
78 Ga0068854_100013323 3300005578 Bacteria 5393
79 Ga0068856_100289488 3300005614 Bacteria 1655
80 Ga0070702_100254244 3300005615 Bacteria 1193
81 Ga0068852_100033597 3300005616 Bacteria 4261
82 Ga0068852_100364232 3300005616 Bacteria 1415
83 Ga0068859_101421507 3300005617 Bacteria 765
84 Ga0068864_100015962 3300005618 Bacteria 6250
85 Ga0068864_100017710 3300005618 Bacteria 5943
86 Ga0068864_101899689 3300005618 Unclassified 601
87 Ga0068866_10024321 3300005718 Bacteria 2830
88 Ga0068861_100211172 3300005719 Bacteria 1635
89 Ga0068851_10023215 3300005834 Bacteria 3030
90 Ga0068851_10293320 3300005834 Bacteria 933
91 Ga0068851_10679993 3300005834 Bacteria 632
92 Ga0068863_100562639 3300005841 Bacteria 1126
93 Ga0068863_100823772 3300005841 Unclassified 926
94 Ga0068858_100032632 3300005842 Bacteria 4835
95 Ga0068858_100324462 3300005842 Bacteria 1472
96 Ga0070717_10017482 3300006028 Bacteria 5580
97 Ga0097621_100050670 3300006237 Bacteria 3377
98 Ga0097621_101545713 3300006237 Bacteria 630
99 Ga0068871_100946808 3300006358 Bacteria 800
100 Ga0068865_100052959 3300006881 Bacteria 2815
101 Ga0068865_100089369 3300006881 Bacteria 2231
102 Ga0068865_100208389 3300006881 Bacteria 1522
103 Ga0097620_101421911 3300006931 Bacteria 765
104 Ga0105242_10605626 3300009176 Bacteria 1059
105 Ga0105248_10001289 3300009177 Bacteria 27923
106 Ga0105248_10003624 3300009177 Bacteria 17137
107 Ga0105248_10125335 3300009177 Bacteria 2897
108 Ga0105248_10383069 3300009177 Bacteria 1583
109 Ga0105239_11675859 3300010375 Bacteria 736
110 Ga0105246_10053781 3300011119 Bacteria 2772
111 Ga0105246_10214157 3300011119 Bacteria 1506
112 Ga0157373_10018534 3300013100 Bacteria 5065
113 Ga0157373_10042244 3300013100 Bacteria 3259
114 Ga0157373_10129673 3300013100 Bacteria 1773
115 Ga0157373_10811201 3300013100 Bacteria 690
116 Ga0157371_10061689 3300013102 Bacteria 2658
117 Ga0157371_10831562 3300013102 Bacteria 697
118 Ga0157370_10622990 3300013104 Bacteria 987
119 Ga0157374_10040807 3300013296 Bacteria 4275
120 Ga0157378_10083052 3300013297 Bacteria 2898
121 Ga0157378_10102843 3300013297 Bacteria 2610
122 Ga0163162_10044227 3300013306 Bacteria 4459
123 Ga0157372_10482744 3300013307 Bacteria 1445
124 Ga0157375_10005886 3300013308 Bacteria 10680
125 Ga0157375_10009899 3300013308 Bacteria 8384
126 Ga0157375_10090854 3300013308 Bacteria 3113
127 Ga0157375_10249292 3300013308 Bacteria 1936
128 Ga0163163_10001398 3300014325 Bacteria 20368
129 Ga0163163_11020361 3300014325 Unclassified 891
130 Ga0157377_10088393 3300014745 Bacteria 1825
131 Ga0157376_10533902 3300014969 Bacteria 1158
132 Ga0157376_10582935 3300014969 Bacteria 1111
133 Ga0157376_11759053 3300014969 Unclassified 656
134 Ga0163161_10008421 3300017792 Bacteria 7137
135 Ga0207697_10015802 3300025315 Bacteria 3114
136 Ga0207697_10033437 3300025315 Bacteria 2105
137 Ga0207656_10245979 3300025321 Unclassified 875
138 Ga0207682_10005863 3300025893 Bacteria 4977
139 Ga0207642_10080598 3300025899 Bacteria 1579
140 Ga0207688_10071078 3300025901 Bacteria 1975
141 Ga0207680_10131991 3300025903 Bacteria 1647
142 Ga0207645_10036333 3300025907 Bacteria 3163
143 Ga0207645_10104675 3300025907 Bacteria 1828
144 Ga0207645_10664853 3300025907 Unclassified 708
145 Ga0207705_10017031 3300025909 Bacteria 5205
146 Ga0207662_10048001 3300025918 Bacteria 2529
147 Ga0207657_10003353 3300025919 Bacteria 17133
148 Ga0207657_10066641 3300025919 Bacteria 3064
149 Ga0207657_10134816 3300025919 Bacteria 2021
150 Ga0207657_10153928 3300025919 Bacteria 1871
151 Ga0207649_10041905 3300025920 Bacteria 2790
152 Ga0207649_10274845 3300025920 Bacteria 1222
153 Ga0207681_10005340 3300025923 Bacteria 7895
154 Ga0207681_10034408 3300025923 Bacteria 3331
155 Ga0207681_10359755 3300025923 Bacteria 1167
156 Ga0207650_10006130 3300025925 Bacteria 8190
157 Ga0207650_10068070 3300025925 Bacteria 2673
158 Ga0207650_10141713 3300025925 Bacteria 1890
159 Ga0207650_10220839 3300025925 Bacteria 1525
160 Ga0207650_10228739 3300025925 Bacteria 1499
161 Ga0207650_10326672 3300025925 Bacteria 1257
162 Ga0207650_11309964 3300025925 Unclassified 616
163 Ga0207659_10012307 3300025926 Bacteria 5438
164 Ga0207687_10571084 3300025927 Unclassified 951
165 Ga0207700_10750093 3300025928 Bacteria 872
166 Ga0207664_11111474 3300025929 Bacteria 706
167 Ga0207644_10008320 3300025931 Bacteria 6797
168 Ga0207644_10008586 3300025931 Bacteria 6682
169 Ga0207644_10283984 3300025931 Bacteria 1329
170 Ga0207690_10003577 3300025932 Bacteria 9253
171 Ga0207690_10312851 3300025932 Bacteria 1232
172 Ga0207706_10004069 3300025933 Bacteria 13822
173 Ga0207706_10013661 3300025933 Bacteria 7373
174 Ga0207706_10046115 3300025933 Bacteria 3859
175 Ga0207706_10258510 3300025933 Bacteria 1520
176 Ga0207686_10268734 3300025934 Bacteria 1253
177 Ga0207709_10207694 3300025935 Bacteria 1403
178 Ga0207669_10010488 3300025937 Bacteria 4464
179 Ga0207669_10067581 3300025937 Bacteria 2228
180 Ga0207704_10316935 3300025938 Bacteria 1201
181 Ga0207691_10001285 3300025940 Bacteria 25027
182 Ga0207691_10002713 3300025940 Bacteria 17293
183 Ga0207691_10158480 3300025940 Bacteria 1987
184 Ga0207691_10870100 3300025940 Unclassified 755
185 Ga0207691_10912405 3300025940 Unclassified 735
186 Ga0207711_10000999 3300025941 Bacteria 27105
187 Ga0207711_10028725 3300025941 Bacteria 4684
188 Ga0207711_10128590 3300025941 Bacteria 2269
189 Ga0207711_10534429 3300025941 Bacteria 1093
190 Ga0207689_10018523 3300025942 Bacteria 5875
191 Ga0207679_10004430 3300025945 Bacteria 8746
192 Ga0207679_10012441 3300025945 Bacteria 5550
193 Ga0207679_10147660 3300025945 Bacteria 1909
194 Ga0207651_10005545 3300025960 Bacteria 6496
195 Ga0207651_10141736 3300025960 Bacteria 1857
196 Ga0207668_10120728 3300025972 Bacteria 1984
197 Ga0207640_10006147 3300025981 Bacteria 6571
198 Ga0207658_10018065 3300025986 Bacteria 4864
199 Ga0207658_10430911 3300025986 Bacteria 1164
200 Ga0207703_10107199 3300026035 Bacteria 2378
201 Ga0207639_10149398 3300026041 Bacteria 1955
202 Ga0207678_10018538 3300026067 Bacteria 6112
203 Ga0207678_10037198 3300026067 Bacteria 4235
204 Ga0207678_10079778 3300026067 Bacteria 2802
205 Ga0207678_10167833 3300026067 Bacteria 1874
206 Ga0207702_10513671 3300026078 Bacteria 1169
207 Ga0207641_10941479 3300026088 Unclassified 859
208 Ga0207648_10023554 3300026089 Bacteria 5513
209 Ga0207648_10048596 3300026089 Bacteria 3713
210 Ga0207676_10002638 3300026095 Bacteria 12786
211 Ga0207676_10012929 3300026095 Bacteria 5995
212 Ga0207674_10244639 3300026116 Bacteria 1741
213 Ga0207675_100180309 3300026118 Bacteria 2022
214 Ga0207683_10005036 3300026121 Bacteria 11345
215 Ga0207683_10038456 3300026121 Bacteria 4171
216 Ga0207683_10179813 3300026121 Bacteria 1918
217 Ga0207698_10249471 3300026142 Bacteria 1623
218 Ga0207698_10483325 3300026142 Bacteria 1202
219 Ga0268266_10112064 3300028379 Bacteria 2418
220 Ga0316176_1039145 3300030732 Bacteria 1899
221 Ga0314311_1027858 3300030733 Unclassified 1238
222 Ga0316178_1105123 3300030735 Bacteria 1490
223 Ga0316183_1089622 3300030742 Bacteria 1069
224 Ga0307408_100019587 3300031548 Bacteria 4557
225 Ga0307408_100414756 3300031548 Bacteria 1159
226 Ga0307408_101408971 3300031548 Unclassified 656
227 Ga0307405_10001186 3300031731 Bacteria 10757
228 Ga0307405_10002739 3300031731 Bacteria 7892
229 Ga0307405_10006519 3300031731 Bacteria 5748
230 Ga0307405_10018608 3300031731 Bacteria 3837
231 Ga0307405_10094746 3300031731 Bacteria 1986
232 Ga0307405_10297041 3300031731 Bacteria 1223
233 Ga0307405_10922602 3300031731 Bacteria 740
234 Ga0307405_11098817 3300031731 Bacteria 683
235 Ga0307413_10001454 3300031824 Bacteria 8998
236 Ga0307413_10003061 3300031824 Bacteria 6954
237 Ga0307413_10005296 3300031824 Bacteria 5737
238 Ga0307413_10013736 3300031824 Bacteria 4085
239 Ga0307413_10065621 3300031824 Bacteria 2261
240 Ga0307413_10140398 3300031824 Bacteria 1668
241 Ga0307413_10219180 3300031824 Bacteria 1388
242 Ga0307413_10222392 3300031824 Bacteria 1380
243 Ga0307413_10233813 3300031824 Bacteria 1352
244 Ga0307413_10643495 3300031824 Bacteria 873
245 Ga0307413_11310535 3300031824 Unclassified 634
246 Ga0307413_11589085 3300031824 Bacteria 580
247 Ga0307410_10005915 3300031852 Bacteria 6539
248 Ga0307410_10010686 3300031852 Bacteria 5215
249 Ga0307410_10025697 3300031852 Bacteria 3698
250 Ga0307410_10030792 3300031852 Bacteria 3433
251 Ga0307410_10036987 3300031852 Bacteria 3184
252 Ga0307410_10063805 3300031852 Bacteria 2528
253 Ga0307410_10131817 3300031852 Bacteria 1837
254 Ga0307410_10139678 3300031852 Bacteria 1790
255 Ga0307410_10261511 3300031852 Bacteria 1350
256 Ga0307410_10302836 3300031852 Bacteria 1262
257 Ga0307410_10407003 3300031852 Bacteria 1100
258 Ga0307410_10831111 3300031852 Bacteria 787
259 Ga0307406_10026080 3300031901 Bacteria 3505
260 Ga0307406_10048691 3300031901 Bacteria 2678
261 Ga0307406_10087894 3300031901 Bacteria 2084
262 Ga0307406_10113641 3300031901 Bacteria 1869
263 Ga0307406_10216979 3300031901 Bacteria 1419
264 Ga0307407_10025884 3300031903 Bacteria 3099
265 Ga0307407_10044207 3300031903 Bacteria 2508
266 Ga0307407_10064507 3300031903 Bacteria 2153
267 Ga0307407_10068470 3300031903 Bacteria 2102
268 Ga0307407_10102000 3300031903 Bacteria 1783
269 Ga0307407_10202781 3300031903 Bacteria 1330
270 Ga0307412_10038506 3300031911 Bacteria 3079
271 Ga0307412_10041584 3300031911 Bacteria 2980
272 Ga0307412_10072097 3300031911 Bacteria 2360
273 Ga0307412_10117717 3300031911 Bacteria 1908
274 Ga0307412_10157285 3300031911 Bacteria 1684
275 Ga0307412_10246403 3300031911 Bacteria 1385
276 Ga0307412_10474487 3300031911 Bacteria 1036
277 Ga0307409_100003351 3300031995 Bacteria 8681
278 Ga0307409_100011173 3300031995 Bacteria 5641
279 Ga0307409_100011669 3300031995 Bacteria 5554
280 Ga0307409_100013341 3300031995 Bacteria 5283
281 Ga0307409_100020985 3300031995 Bacteria 4467
282 Ga0307409_100021154 3300031995 Bacteria 4454
283 Ga0307409_100026278 3300031995 Bacteria 4102
284 Ga0307409_100114889 3300031995 Bacteria 2265
285 Ga0307409_100156293 3300031995 Bacteria 1987
286 Ga0307409_100317156 3300031995 Bacteria 1457
287 Ga0307409_100386408 3300031995 Bacteria 1332
288 Ga0307409_101276307 3300031995 Bacteria 759
289 Ga0307409_101392474 3300031995 Bacteria 727
290 Ga0307416_100005985 3300032002 Bacteria 7561
291 Ga0307416_100256287 3300032002 Bacteria 1706
292 Ga0307416_100367741 3300032002 Bacteria 1463
293 Ga0307416_100698957 3300032002 Bacteria 1103
294 Ga0307416_100777043 3300032002 Bacteria 1052
295 Ga0307416_102136568 3300032002 Bacteria 662
296 Ga0307414_10002915 3300032004 Bacteria 9040
297 Ga0307414_10010191 3300032004 Bacteria 5441
298 Ga0307414_10010259 3300032004 Bacteria 5426
299 Ga0307414_10064741 3300032004 Bacteria 2605
300 Ga0307414_10083653 3300032004 Bacteria 2344
301 Ga0307414_10091386 3300032004 Bacteria 2262
302 Ga0307414_10095327 3300032004 Bacteria 2223
303 Ga0307414_10436832 3300032004 Bacteria 1145
304 Ga0307411_10001008 3300032005 Bacteria 10869
305 Ga0307411_10005798 3300032005 Bacteria 6115
306 Ga0307411_10011747 3300032005 Bacteria 4743
307 Ga0307411_10035667 3300032005 Bacteria 3109
308 Ga0307411_10039356 3300032005 Bacteria 2990
309 Ga0307411_10042487 3300032005 Bacteria 2900
310 Ga0307411_10067256 3300032005 Bacteria 2410
311 Ga0307411_10122369 3300032005 Bacteria 1885
312 Ga0307411_10130225 3300032005 Bacteria 1837
313 Ga0307411_10236834 3300032005 Bacteria 1426
314 Ga0307411_10467092 3300032005 Bacteria 1059
315 Ga0307411_10842506 3300032005 Bacteria 810
316 Ga0307411_10948289 3300032005 Bacteria 767
317 Ga0307415_100005619 3300032126 Bacteria 6675
318 Ga0307415_100011251 3300032126 Bacteria 5112
319 Ga0307415_100012257 3300032126 Bacteria 4950
320 Ga0307415_100018656 3300032126 Bacteria 4195
321 Ga0307415_100029163 3300032126 Bacteria 3522
322 Ga0307415_100161047 3300032126 Bacteria 1739
323 Ga0307415_100286035 3300032126 Bacteria 1358
324 Ga0307415_100300002 3300032126 Bacteria 1330
325 Ga0307415_100305688 3300032126 Bacteria 1319
326 Ga0307415_101362092 3300032126 Unclassified 674
327 Ga0395900_0003022 3300037418 Bacteria 18307
328 Ga0395900_0297067 3300037418 Bacteria 1602
329 Ga0395898_0092776 3300037466 Bacteria 2903
330 Ga0395905_0000313 3300037471 Bacteria 70446
331 Ga0395905_0309616 3300037471 Bacteria 1468
332 Ga0395905_0865989 3300037471 Bacteria 806
333 Ga0395901_0068363 3300038443 Bacteria 3700
334 Ga0439448_0038022 3300042005 Bacteria 1548
335 Ga0439458_0000612 3300042157 Bacteria 9226
336 Ga0450908_011150 3300042184 Bacteria 1649
337 Ga0466965_0310818 3300044683 Bacteria 857
338 Ga0466957_0067668 3300044842 Bacteria 2204
339 Ga0466960_0071008 3300044901 Bacteria 1733
340 Ga0466960_0493331 3300044901 Bacteria 717
341 Ga0466958_0085911 3300045836 Bacteria 1941
342 Ga0466967_0024790 3300045976 Bacteria 4937
343 Ga0495580_0089760 3300046472 Bacteria 2140
344 Ga0495598_0042179 3300046537 Bacteria 1338
345 Ga0495598_0084165 3300046537 Bacteria 1026
346 Ga0495621_0000041 3300046539 Bacteria 25070
347 Ga0495633_0208273 3300046558 Unclassified 897
348 Ga0495588_0133357 3300046674 Bacteria 1311
349 Ga0495669_0042371 3300046684 Bacteria 2023
350 Ga0495670_0383455 3300046691 Bacteria 758
351 Ga0495677_0114483 3300047445 Unclassified 1026
352 Ga0496100_0444047 3300048903 Unclassified 994
353 Ga0496101_0029490 3300048904 Bacteria 3837
354 Ga0496101_0340137 3300048904 Bacteria 1179
355 Ga0496101_0360573 3300048904 Unclassified 1143
356 Ga0496102_0098807 3300048905 Bacteria 2709
357 Ga0496102_0830252 3300048905 Bacteria 846
358 Ga0496107_0050238 3300048910 Bacteria 3006
359 Ga0496107_0087741 3300048910 Bacteria 2271
360 Ga0496107_0132714 3300048910 Bacteria 1839
361 Ga0496108_0073873 3300048911 Bacteria 2878
362 Ga0496108_0168180 3300048911 Bacteria 1896
363 Ga0496109_0007700 3300048912 Bacteria 9129
364 Ga0496109_0284733 3300048912 Bacteria 1558
365 Ga0496109_0475409 3300048912 Bacteria 1180
366 Ga0496109_0523011 3300048912 Bacteria 1120
367 Ga0496110_0054395 3300048913 Bacteria 3521
368 Ga0496110_0151163 3300048913 Bacteria 2102
369 Ga0496111_0005797 3300048914 Bacteria 7966
370 Ga0496111_0068409 3300048914 Bacteria 2581
371 Ga0496111_0077489 3300048914 Bacteria 2423
372 Ga0496111_0776741 3300048914 Bacteria 694
373 Ga0496112_0001644 3300048915 Bacteria 17341
374 Ga0496112_0050281 3300048915 Bacteria 4087
375 Ga0496112_0468505 3300048915 Bacteria 1197
376 Ga0496113_0663591 3300048916 Bacteria 833
377 Ga0496114_0095227 3300048917 Bacteria 2533
378 Ga0496114_0102432 3300048917 Bacteria 2446
379 Ga0496115_0126898 3300048918 Bacteria 2102
380 Ga0501217_042909 3300049661 Bacteria 1157
381 Ga0501273_007326 3300049770 Bacteria 1296
382 nmdc:mga08y16_1141981_c1 3300050511 Bacteria 752
383 Ga0070669_100161671
384 MBSR1b_contig_694234
385 Ga0065712_10076471
386 Ga0065712_10419691
387 Ga0065715_10274245
388 Ga0070658_10030076
389 Ga0070658_10351973
390 Ga0070676_10084621
391 Ga0070676_10726352
392 Ga0070690_100548537
393 Ga0070670_100000600
394 Ga0070670_100053729
395 Ga0070670_100092519
396 Ga0070670_100263832
397 Ga0070677_10010152
398 Ga0068869_100310851
399 Ga0070666_10005514
400 Ga0070666_10545322
401 Ga0070666_10549480
402 Ga0070680_100729038
403 Ga0068868_100243576
404 Ga0070660_100073254
405 Ga0070661_100011159
406 Ga0070661_100872713
407 Ga0070668_100084537
408 Ga0070668_101444937
409 Ga0070669_100018451
410 Ga0070669_100144498
411 Ga0070669_100452228
412 Ga0070675_100004368
413 Ga0070675_100027859
414 Ga0070675_100101004
415 Ga0070675_100726109
416 Ga0070671_100000190
417 Ga0070671_100007604
418 Ga0070671_100027780
419 Ga0070671_100067204
420 Ga0070671_101055097
421 Ga0070674_100047395
422 Ga0070674_100107493
423 Ga0070674_100785096
424 Ga0070673_100206409
425 Ga0070659_100005399
426 Ga0070659_100050952
427 Ga0070659_101020879
428 Ga0070667_100024135
429 Ga0070667_100267352
430 Ga0070667_100671282
431 Ga0070714_100441402
432 Ga0070713_100007715
433 Ga0070663_100023003
434 Ga0070663_100056723
435 Ga0070663_100415273
436 Ga0070678_100012317
437 Ga0070678_100025075
438 Ga0070678_100055703
439 Ga0070662_100005543
440 Ga0070662_100009643
441 Ga0070662_100103024
442 Ga0070662_100307516
443 Ga0070681_10169878
444 Ga0068867_100046495
445 Ga0068853_100090345
446 Ga0068853_100095946
447 Ga0068853_100305872
448 Ga0070672_100006166
449 Ga0070672_100134869
450 Ga0070672_100854016
451 Ga0070695_100102921
452 Ga0070693_100674434
453 Ga0070665_100045039
454 Ga0070664_100001240
455 Ga0070664_100134072
456 Ga0070664_100347896
457 Ga0070664_100729031
458 Ga0070664_101666643
459 Ga0068857_100541320
460 Ga0068854_100013323
461 Ga0068856_100289488
462 Ga0070702_100254244
463 Ga0068852_100033597
464 Ga0068852_100364232
465 Ga0068859_101421507
466 Ga0068864_100015962
467 Ga0068864_100017710
468 Ga0068864_101899689
469 Ga0068866_10024321
470 Ga0068861_100211172
471 Ga0068851_10023215
472 Ga0068851_10293320
473 Ga0068851_10679993
474 Ga0068863_100562639
475 Ga0068863_100823772
476 Ga0068858_100032632
477 Ga0068858_100324462
478 Ga0070717_10017482
479 Ga0097621_100050670
480 Ga0097621_101545713
481 Ga0068871_100946808
482 Ga0068865_100052959
483 Ga0068865_100089369
484 Ga0068865_100208389
485 Ga0097620_101421911
486 Ga0105242_10605626
487 Ga0105248_10001289
488 Ga0105248_10003624
489 Ga0105248_10125335
490 Ga0105248_10383069
491 Ga0105239_11675859
492 Ga0105246_10053781
493 Ga0105246_10214157
494 Ga0157373_10018534
495 Ga0157373_10042244
496 Ga0157373_10129673
497 Ga0157373_10811201
498 Ga0157371_10061689
499 Ga0157371_10831562
500 Ga0157370_10622990
501 Ga0157374_10040807
502 Ga0157378_10083052
503 Ga0157378_10102843
504 Ga0163162_10044227
505 Ga0157372_10482744
506 Ga0157375_10005886
507 Ga0157375_10009899
508 Ga0157375_10090854
509 Ga0157375_10249292
510 Ga0163163_10001398
511 Ga0163163_11020361
512 Ga0157377_10088393
513 Ga0157376_10533902
514 Ga0157376_10582935
515 Ga0157376_11759053
516 Ga0163161_10008421
517 Ga0207697_10015802
518 Ga0207697_10033437
519 Ga0207656_10245979
520 Ga0207682_10005863
521 Ga0207642_10080598
522 Ga0207688_10071078
523 Ga0207680_10131991
524 Ga0207645_10036333
525 Ga0207645_10104675
526 Ga0207645_10664853
527 Ga0207705_10017031
528 Ga0207662_10048001
529 Ga0207657_10003353
530 Ga0207657_10066641
531 Ga0207657_10134816
532 Ga0207657_10153928
533 Ga0207649_10041905
534 Ga0207649_10274845
535 Ga0207681_10005340
536 Ga0207681_10034408
537 Ga0207681_10359755
538 Ga0207650_10006130
539 Ga0207650_10068070
540 Ga0207650_10141713
541 Ga0207650_10220839
542 Ga0207650_10228739
543 Ga0207650_10326672
544 Ga0207650_11309964
545 Ga0207659_10012307
546 Ga0207687_10571084
547 Ga0207700_10750093
548 Ga0207664_11111474
549 Ga0207644_10008320
550 Ga0207644_10008586
551 Ga0207644_10283984
552 Ga0207690_10003577
553 Ga0207690_10312851
554 Ga0207706_10004069
555 Ga0207706_10013661
556 Ga0207706_10046115
557 Ga0207706_10258510
558 Ga0207686_10268734
559 Ga0207709_10207694
560 Ga0207669_10010488
561 Ga0207669_10067581
562 Ga0207704_10316935
563 Ga0207691_10001285
564 Ga0207691_10002713
565 Ga0207691_10158480
566 Ga0207691_10870100
567 Ga0207691_10912405
568 Ga0207711_10000999
569 Ga0207711_10028725
570 Ga0207711_10128590
571 Ga0207711_10534429
572 Ga0207689_10018523
573 Ga0207679_10004430
574 Ga0207679_10012441
575 Ga0207679_10147660
576 Ga0207651_10005545
577 Ga0207651_10141736
578 Ga0207668_10120728
579 Ga0207640_10006147
580 Ga0207658_10018065
581 Ga0207658_10430911
582 Ga0207703_10107199
583 Ga0207639_10149398
584 Ga0207678_10018538
585 Ga0207678_10037198
586 Ga0207678_10079778
587 Ga0207678_10167833
588 Ga0207702_10513671
589 Ga0207641_10941479
590 Ga0207648_10023554
591 Ga0207648_10048596
592 Ga0207676_10002638
593 Ga0207676_10012929
594 Ga0207674_10244639
595 Ga0207675_100180309
596 Ga0207683_10005036
597 Ga0207683_10038456
598 Ga0207683_10179813
599 Ga0207698_10249471
600 Ga0207698_10483325
601 Ga0268266_10112064
602 Ga0316176_1039145
603 Ga0314311_1027858
604 Ga0316178_1105123
605 Ga0316183_1089622
606 Ga0307408_100019587
607 Ga0307408_100414756
608 Ga0307408_101408971
609 Ga0307405_10001186
610 Ga0307405_10002739
611 Ga0307405_10006519
612 Ga0307405_10018608
613 Ga0307405_10094746
614 Ga0307405_10297041
615 Ga0307405_10922602
616 Ga0307405_11098817
617 Ga0307413_10001454
618 Ga0307413_10003061
619 Ga0307413_10005296
620 Ga0307413_10013736
621 Ga0307413_10065621
622 Ga0307413_10140398
623 Ga0307413_10219180
624 Ga0307413_10222392
625 Ga0307413_10233813
626 Ga0307413_10643495
627 Ga0307413_11310535
628 Ga0307413_11589085
629 Ga0307410_10005915
630 Ga0307410_10010686
631 Ga0307410_10025697
632 Ga0307410_10030792
633 Ga0307410_10036987
634 Ga0307410_10063805
635 Ga0307410_10131817
636 Ga0307410_10139678
637 Ga0307410_10261511
638 Ga0307410_10302836
639 Ga0307410_10407003
640 Ga0307410_10831111
641 Ga0307406_10026080
642 Ga0307406_10048691
643 Ga0307406_10087894
644 Ga0307406_10113641
645 Ga0307406_10216979
646 Ga0307407_10025884
647 Ga0307407_10044207
648 Ga0307407_10064507
649 Ga0307407_10068470
650 Ga0307407_10102000
651 Ga0307407_10202781
652 Ga0307412_10038506
653 Ga0307412_10041584
654 Ga0307412_10072097
655 Ga0307412_10117717
656 Ga0307412_10157285
657 Ga0307412_10246403
658 Ga0307412_10474487
659 Ga0307409_100003351
660 Ga0307409_100011173
661 Ga0307409_100011669
662 Ga0307409_100013341
663 Ga0307409_100020985
664 Ga0307409_100021154
665 Ga0307409_100026278
666 Ga0307409_100114889
667 Ga0307409_100156293
668 Ga0307409_100317156
669 Ga0307409_100386408
670 Ga0307409_101276307
671 Ga0307409_101392474
672 Ga0307416_100005985
673 Ga0307416_100256287
674 Ga0307416_100367741
675 Ga0307416_100698957
676 Ga0307416_100777043
677 Ga0307416_102136568
678 Ga0307414_10002915
679 Ga0307414_10010191
680 Ga0307414_10010259
681 Ga0307414_10064741
682 Ga0307414_10083653
683 Ga0307414_10091386
684 Ga0307414_10095327
685 Ga0307414_10436832
686 Ga0307411_10001008
687 Ga0307411_10005798
688 Ga0307411_10011747
689 Ga0307411_10035667
690 Ga0307411_10039356
691 Ga0307411_10042487
692 Ga0307411_10067256
693 Ga0307411_10122369
694 Ga0307411_10130225
695 Ga0307411_10236834
696 Ga0307411_10467092
697 Ga0307411_10842506
698 Ga0307411_10948289
699 Ga0307415_100005619
700 Ga0307415_100011251
701 Ga0307415_100012257
702 Ga0307415_100018656
703 Ga0307415_100029163
704 Ga0307415_100161047
705 Ga0307415_100286035
706 Ga0307415_100300002
707 Ga0307415_100305688
708 Ga0307415_101362092
709 Ga0395900_0003022
710 Ga0395900_0297067
711 Ga0395898_0092776
712 Ga0395905_0000313
713 Ga0395905_0309616
714 Ga0395905_0865989
715 Ga0395901_0068363
716 Ga0439448_0038022
717 Ga0439458_0000612
718 Ga0450908_011150
719 Ga0466965_0310818
720 Ga0466957_0067668
721 Ga0466960_0071008
722 Ga0466960_0493331
723 Ga0466958_0085911
724 Ga0466967_0024790
725 Ga0495580_0089760
726 Ga0495598_0042179
727 Ga0495598_0084165
728 Ga0495621_0000041
729 Ga0495633_0208273
730 Ga0495588_0133357
731 Ga0495669_0042371
732 Ga0495670_0383455
733 Ga0495677_0114483
734 Ga0496100_0444047
735 Ga0496101_0029490
736 Ga0496101_0340137
737 Ga0496101_0360573
738 Ga0496102_0098807
739 Ga0496102_0830252
740 Ga0496107_0050238
741 Ga0496107_0087741
742 Ga0496107_0132714
743 Ga0496108_0073873
744 Ga0496108_0168180
745 Ga0496109_0007700
746 Ga0496109_0284733
747 Ga0496109_0475409
748 Ga0496109_0523011
749 Ga0496110_0054395
750 Ga0496110_0151163
751 Ga0496111_0005797
752 Ga0496111_0068409
753 Ga0496111_0077489
754 Ga0496111_0776741
755 Ga0496112_0001644
756 Ga0496112_0050281
757 Ga0496112_0468505
758 Ga0496113_0663591
759 Ga0496114_0095227
760 Ga0496114_0102432
761 Ga0496115_0126898
762 Ga0501217_042909
763 Ga0501273_007326
764 nmdc:mga08y16_1141981_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13563

2_5_RNA_ligase2

2'-5' RNA ligase superfamily

25

170

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d4g-assembly1.cif.gz_B structure of yjcg protein, a putative 2'-5' rna ligase from bacillus subtilis 0.8134 5 166
1jh6-assembly1.cif.gz_A semi-reduced cyclic nucleotide phosphodiesterase from arabidopsis thaliana 0.7639 1 166
1jh6-assembly1.cif.gz_A semi-reduced cyclic nucleotide phosphodiesterase from arabidopsis thaliana 0.7519 1 166
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.7475 4 165
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.7212 4 165
ID Description Score Start End Superfamily
af_P56199_355_667_2.130.10.130 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Integrin alpha, N-terminal 0.8026 143 166 2.130.10.130
2d4gB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7902 5 166 3.90.1140.10
2d4gB00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7735 5 166 3.90.1140.10
af_Q2FZP9_3_169_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.7587 4 166 3.90.1140.10
af_R4GDY5_501_602_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7447 141 166 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A7W6LPA7-F1-model_v4 2'-5' RNA ligase family protein 0.991 2 167
AF-A0A1M2ZKC9-F1-model_v4 Phosphoesterase HXTX 0.9907 1 166
AF-A0A1M7SXE8-F1-model_v4 2'-5' RNA ligase 0.9902 2 166 GO:0016874
AF-A0A494VYK0-F1-model_v4 2'-5' RNA ligase family protein 0.9894 1 167
AF-N1MHK8-F1-model_v4 Phosphoesterase HXTX 0.9894 1 167

Map