F429094

General Info

Members Datasets Scaffolds Average Seq Length
381 226 322 251

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_28261_c1|nmdc:mga0k408_28261_c1_841_1674
Length 277
Sequence LYIAGSSVYKLINLLTYQLITSFMAKIIFITGATSGFGKATAEIFAVNGYDLILNGRRADRLEELCKTLVKKFNIAALTLPFDVRDEKAVFDSINHLPAEWKNIDILFNNAGLALGRDYFDEADLNDWNIMIDTNVKGFMYVAKAVSQLMVARKQGHIINMGSIAGKQVYEKGNAYCASKYAVDALNHAMRIDLLRHNIKVTGIHPGAAETEFSLVRFKGDGDTAKKIYDGLTPLTPEDVAGVIWYCASLPPHVCINDLTITCTRQADGIYFYRNSY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
3 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
4 2547132181 Kosakonia sacchari SP1 Isolate Stem
5 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
6 2561511199 Enterobacter sp. R4-368 Isolate Nodule
7 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
8 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
9 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
10 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
11 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
12 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
13 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
14 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
15 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
16 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
17 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
18 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
19 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
20 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
21 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
22 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
23 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
24 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
25 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
26 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
27 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
28 2855730933 Achromobacter sp. HZ28 Isolate Nodule
29 2855767633 Achromobacter sp. HZ34 Isolate Nodule
30 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
31 2865014394 Pantoea sp. R-71966 Isolate Unclassified
32 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
33 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
34 2876601092 Pantoea endophytica 596 Isolate Unclassified
35 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
36 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
37 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
38 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
39 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
40 2932406140 Serratia sp. 2723 Isolate Rhizosphere
41 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
42 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
43 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
44 2939577877 Serratia sp. 509 Isolate Rhizosphere
45 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
46 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
47 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
48 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
49 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
50 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
51 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
52 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
53 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
54 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
55 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
56 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
59 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
60 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
61 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
64 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
65 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
73 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
149 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
150 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
151 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
152 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
153 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
154 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
155 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
156 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
185 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
208 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
217 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
222 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
223 8018221730 Enterobacter sp. CM29 Isolate Unclassified
224 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
225 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
226 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.51
Metatranscriptomes 0
Isolates 15.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 4.46
Nodule 3.67
Rhizoplane 4.72
Rhizosphere 62.2
Stem 0.26
Stem Tuber 1.57
Unclassified 22.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_198135 2162886007 Bacteria 1467
2 SwRhRL2b_contig_333401 2162886007 Bacteria 2538
3 JGI24751J29686_10000693 3300002459 Bacteria 8367
4 JGI25152J39213_1000914 3300002773 Bacteria 14477
5 JGI25151J46595_10016125 3300003187 Bacteria 3274
6 rootH2_10034631 3300003320 Bacteria 31510
7 rootL2_10230917 3300003322 Bacteria 5745
8 Ga0058692_1000055 3300003856 Bacteria 105550
9 Ga0058692_1000094 3300003856 Bacteria 60087
10 Ga0058692_1000095 3300003856 Bacteria 59986
11 Ga0058692_1001146 3300003856 Bacteria 10274
12 Ga0065714_10004679 3300005288 Bacteria 7130
13 Ga0065704_10003369 3300005289 Bacteria 6310
14 Ga0065704_10003735 3300005289 Bacteria 9908
15 Ga0065712_10002866 3300005290 Bacteria 4096
16 Ga0065712_10003352 3300005290 Bacteria 7382
17 Ga0070676_10109522 3300005328 Bacteria 1718
18 Ga0070683_100007261 3300005329 Bacteria 9347
19 Ga0070670_100159831 3300005331 Bacteria 1952
20 Ga0068869_100006382 3300005334 Bacteria 7474
21 Ga0070668_100002673 3300005347 Bacteria 13105
22 Ga0070669_100004763 3300005353 Bacteria 9785
23 Ga0070675_100056921 3300005354 Bacteria 3223
24 Ga0070674_100027103 3300005356 Unclassified 3752
25 Ga0070674_100345460 3300005356 Bacteria 1200
26 Ga0070688_100013318 3300005365 Bacteria 4632
27 Ga0070701_10098517 3300005438 Bacteria 1615
28 Ga0070681_10189569 3300005458 Bacteria 1976
29 Ga0070684_100003266 3300005535 Bacteria 12142
30 Ga0068853_100150492 3300005539 Bacteria 2095
31 Ga0070672_100055335 3300005543 Bacteria 3108
32 Ga0070704_100124947 3300005549 Bacteria 1983
33 Ga0070664_100320000 3300005564 Bacteria 1405
34 Ga0068854_100088614 3300005578 Bacteria 2298
35 Ga0070702_100390359 3300005615 Unclassified 992
36 Ga0068859_100133796 3300005617 Bacteria 2551
37 Ga0068864_100013585 3300005618 Bacteria 6750
38 Ga0068861_100004091 3300005719 Bacteria 9776
39 Ga0068862_100093454 3300005844 Bacteria 2622
40 Ga0081540_1015970 3300005983 Bacteria 4729
41 Ga0075364_10011753 3300006051 Bacteria 5329
42 Ga0075364_10207044 3300006051 Bacteria 1330
43 Ga0075366_10010147 3300006195 Bacteria 5281
44 Ga0075366_10024480 3300006195 Bacteria 3521
45 Ga0097620_100133811 3300006931 Bacteria 2551
46 Ga0079104_1000049 3300006946 Bacteria 177499
47 Ga0079104_1000223 3300006946 Bacteria 78580
48 Ga0079104_1000486 3300006946 Bacteria 43595
49 Ga0079104_1001107 3300006946 Bacteria 19927
50 Ga0079104_1002044 3300006946 Bacteria 11716
51 Ga0105251_10000040 3300009011 Bacteria 115504
52 Ga0105251_10001043 3300009011 Bacteria 24296
53 Ga0105251_10007626 3300009011 Bacteria 6627
54 Ga0105251_10017106 3300009011 Bacteria 3895
55 Ga0105251_10017936 3300009011 Bacteria 3779
56 Ga0105251_10023364 3300009011 Bacteria 3192
57 Ga0105244_10000705 3300009036 Bacteria 28994
58 Ga0105244_10000960 3300009036 Bacteria 24197
59 Ga0105244_10001297 3300009036 Bacteria 20478
60 Ga0105244_10002861 3300009036 Bacteria 12790
61 Ga0105244_10053472 3300009036 Bacteria 2052
62 Ga0105250_10000264 3300009092 Bacteria 42668
63 Ga0105250_10000533 3300009092 Bacteria 26352
64 Ga0105250_10000837 3300009092 Bacteria 18280
65 Ga0105250_10004257 3300009092 Bacteria 6618
66 Ga0105250_10006430 3300009092 Bacteria 5131
67 Ga0105240_10000273 3300009093 Bacteria 102198
68 Ga0111539_10018813 3300009094 Bacteria 8546
69 Ga0105243_10233004 3300009148 Bacteria 1635
70 Ga0105243_10335973 3300009148 Bacteria 1382
71 Ga0105249_10005287 3300009553 Bacteria 11145
72 Ga0105239_10253726 3300010375 Unclassified 1976
73 Ga0105246_10146663 3300011119 Bacteria 1781
74 Ga0157373_10000469 3300013100 Bacteria 31979
75 Ga0157371_10000782 3300013102 Bacteria 36580
76 Ga0157371_10001758 3300013102 Bacteria 21966
77 Ga0157370_10052182 3300013104 Bacteria 3904
78 Ga0157370_10180237 3300013104 Bacteria 1963
79 Ga0157369_10002617 3300013105 Bacteria 21518
80 Ga0157369_10003245 3300013105 Bacteria 19370
81 Ga0157369_10022428 3300013105 Bacteria 7044
82 Ga0163162_10058691 3300013306 Bacteria 3878
83 Ga0163162_10073850 3300013306 Bacteria 3467
84 Ga0157372_10003680 3300013307 Bacteria 16478
85 Ga0157372_10013672 3300013307 Bacteria 8674
86 Ga0157372_10014587 3300013307 Bacteria 8406
87 Ga0157372_10044379 3300013307 Bacteria 4926
88 Ga0157372_10075170 3300013307 Bacteria 3811
89 Ga0157375_10630818 3300013308 Bacteria 1229
90 Ga0163163_10301399 3300014325 Unclassified 1655
91 Ga0163163_10492771 3300014325 Bacteria 1287
92 Ga0157380_10861228 3300014326 Bacteria 929
93 Ga0182008_10069716 3300014497 Bacteria 1730
94 Ga0157377_10045598 3300014745 Bacteria 2450
95 Ga0182006_1004446 3300015261 Bacteria 6915
96 Ga0163161_10048512 3300017792 Bacteria 3067
97 Ga0163161_10072204 3300017792 Bacteria 2527
98 Ga0163161_10085760 3300017792 Bacteria 2323
99 Ga0209437_100073 3300025233 Bacteria 302948
100 Ga0207425_1010822 3300025245 Bacteria 2204
101 Ga0209129_1000004 3300025258 Bacteria 884499
102 Ga0209025_1000003 3300025294 Bacteria 1366495
103 Ga0207697_10015216 3300025315 Bacteria 3181
104 Ga0207696_1000005 3300025711 Bacteria 642078
105 Ga0207696_1000042 3300025711 Bacteria 307256
106 Ga0207696_1000432 3300025711 Bacteria 38094
107 Ga0207696_1000858 3300025711 Bacteria 19072
108 Ga0207696_1001101 3300025711 Bacteria 15838
109 Ga0207696_1002965 3300025711 Bacteria 7946
110 Ga0207696_1005899 3300025711 Bacteria 5011
111 Ga0207655_1000001 3300025728 Bacteria 1866413
112 Ga0207655_1000069 3300025728 Bacteria 239968
113 Ga0207655_1000774 3300025728 Bacteria 35660
114 Ga0207655_1005188 3300025728 Bacteria 8961
115 Ga0207655_1014021 3300025728 Bacteria 4561
116 Ga0207655_1027418 3300025728 Bacteria 2714
117 Ga0207655_1057203 3300025728 Bacteria 1533
118 Ga0207713_1000001 3300025735 Bacteria 2295391
119 Ga0207713_1000002 3300025735 Bacteria 1061749
120 Ga0207713_1000003 3300025735 Bacteria 860698
121 Ga0207713_1017140 3300025735 Bacteria 3646
122 Ga0207713_1019422 3300025735 Bacteria 3325
123 Ga0207713_1026645 3300025735 Bacteria 2643
124 Ga0207643_10009119 3300025908 Bacteria 5329
125 Ga0207707_10160943 3300025912 Bacteria 1963
126 Ga0207695_10000130 3300025913 Bacteria 224214
127 Ga0207650_10116815 3300025925 Bacteria 2072
128 Ga0207659_10008616 3300025926 Bacteria 6344
129 Ga0207706_10049254 3300025933 Bacteria 3724
130 Ga0207709_10238878 3300025935 Bacteria 1320
131 Ga0207670_10017047 3300025936 Bacteria 4382
132 Ga0207704_10119133 3300025938 Bacteria 1802
133 Ga0207691_10170653 3300025940 Bacteria 1905
134 Ga0207689_10007546 3300025942 Bacteria 9538
135 Ga0207668_10109002 3300025972 Bacteria 2073
136 Ga0207640_10073280 3300025981 Bacteria 2314
137 Ga0207703_10252133 3300026035 Bacteria 1591
138 Ga0207676_10019528 3300026095 Bacteria 4946
139 Ga0207674_10003317 3300026116 Bacteria 19789
140 Ga0207675_100001235 3300026118 Bacteria 25524
141 Ga0207683_10311312 3300026121 Bacteria 1441
142 Ga0209281_1000001 3300027111 Bacteria 1933496
143 Ga0209281_1000004 3300027111 Bacteria 1253949
144 Ga0209281_1000006 3300027111 Bacteria 1170244
145 Ga0209281_1000012 3300027111 Bacteria 684886
146 Ga0209281_1001189 3300027111 Bacteria 17837
147 Ga0209281_1003086 3300027111 Bacteria 5819
148 Ga0209371_1000002 3300027312 Bacteria 1551985
149 Ga0209371_1000041 3300027312 Bacteria 340377
150 Ga0209371_1000075 3300027312 Bacteria 196676
151 Ga0209371_1000077 3300027312 Bacteria 191208
152 Ga0209371_1000271 3300027312 Bacteria 60423
153 Ga0209371_1000436 3300027312 Bacteria 42413
154 Ga0209371_1002538 3300027312 Bacteria 10103
155 Ga0209371_1006199 3300027312 Bacteria 4502
156 Ga0209371_1014229 3300027312 Bacteria 2191
157 Ga0207428_10187581 3300027907 Bacteria 1560
158 Ga0268256_1000002 3300030500 Bacteria 1535763
159 Ga0268256_1000003 3300030500 Bacteria 1289401
160 Ga0268256_1000033 3300030500 Bacteria 420973
161 Ga0268256_1000068 3300030500 Bacteria 196676
162 Ga0268256_1000317 3300030500 Bacteria 47947
163 Ga0268256_1000376 3300030500 Bacteria 42413
164 Ga0268256_1006407 3300030500 Bacteria 4384
165 Ga0268256_1009605 3300030500 Bacteria 3191
166 Ga0268256_1013609 3300030500 Bacteria 2454
167 Ga0265327_10000219 3300031251 Bacteria 116606
168 Ga0436365_0693472 3300039437 Bacteria 1626
169 Ga0436363_1379572 3300039450 Bacteria 2830
170 Ga0439438_000001 3300041405 Bacteria 1263568
171 Ga0439439_0024904 3300041406 Bacteria 1504
172 Ga0439447_002339 3300041407 Bacteria 6931
173 Ga0439447_007808 3300041407 Bacteria 3359
174 Ga0439466_0000009 3300041411 Bacteria 232657
175 Ga0451843_1721864 3300041509 Bacteria 3231
176 Ga0439442_017726 3300042002 Unclassified 1470
177 Ga0439432_009362 3300042006 Bacteria 3418
178 Ga0439452_000028 3300042010 Bacteria 204513
179 Ga0439452_023625 3300042010 Bacteria 1580
180 Ga0439452_040894 3300042010 Bacteria 1092
181 Ga0450894_008246 3300042131 Bacteria 1346
182 Ga0450898_003819 3300042134 Bacteria 2188
183 Ga0450907_000172 3300042146 Bacteria 23725
184 Ga0451577_0233991 3300042876 Unclassified 1662
185 Ga0453684_0601509 3300044712 Unclassified 1205
186 Ga0495591_000003 3300046458 Bacteria 449825
187 Ga0495591_000007 3300046458 Bacteria 366385
188 Ga0495591_001918 3300046458 Bacteria 12207
189 Ga0495638_0002827 3300046460 Bacteria 13907
190 Ga0495638_0111152 3300046460 Bacteria 1628
191 Ga0495585_0030732 3300046492 Bacteria 3054
192 Ga0495596_0021461 3300046500 Bacteria 2636
193 Ga0495620_0002310 3300046515 Bacteria 11044
194 Ga0495648_0001677 3300046524 Bacteria 21423
195 Ga0495654_0000007 3300046530 Bacteria 403529
196 Ga0495654_0012677 3300046530 Bacteria 4526
197 Ga0495654_0023563 3300046530 Bacteria 3187
198 Ga0495597_0000396 3300046542 Bacteria 37594
199 Ga0495668_0012466 3300046616 Bacteria 5040
200 Ga0495588_0006734 3300046674 Bacteria 5194
201 Ga0495671_0056232 3300046692 Bacteria 1948
202 Ga0495649_0000229 3300046694 Bacteria 48965
203 Ga0495649_0000261 3300046694 Bacteria 46982
204 Ga0495649_0099474 3300046694 Bacteria 1546
205 Ga0495660_0030834 3300046810 Bacteria 3018
206 Ga0495672_0000034 3300047320 Bacteria 290832
207 Ga0495672_0000053 3300047320 Bacteria 233823
208 Ga0495679_000005 3300047446 Bacteria 455007
209 Ga0495679_000484 3300047446 Bacteria 28480
210 Ga0495679_010848 3300047446 Bacteria 3554
211 Ga0495679_064285 3300047446 Bacteria 1069
212 Ga0495679_087308 3300047446 Bacteria 878
213 Ga0495673_0000070 3300047469 Bacteria 217453
214 Ga0495686_0025667 3300047472 Bacteria 3862
215 Ga0495686_0054141 3300047472 Bacteria 2513
216 Ga0496100_0100068 3300048903 Bacteria 1996
217 Ga0496101_0000083 3300048904 Bacteria 104105
218 Ga0496101_0615800 3300048904 Bacteria 858
219 Ga0496102_0000807 3300048905 Bacteria 30477
220 Ga0496104_0004356 3300048907 Bacteria 12311
221 Ga0496104_0218281 3300048907 Bacteria 1819
222 Ga0496105_0023364 3300048908 Bacteria 5013
223 Ga0496105_0059894 3300048908 Bacteria 3141
224 Ga0496116_0029594 3300048919 Bacteria 3945
225 Ga0496116_0032443 3300048919 Bacteria 3721
226 Ga0496116_0118833 3300048919 Bacteria 1535
227 Ga0496116_0222211 3300048919 Bacteria 966
228 Ga0496117_0000022 3300048920 Bacteria 439512
229 Ga0496117_0000268 3300048920 Bacteria 98537
230 Ga0496117_0003107 3300048920 Bacteria 19847
231 Ga0496117_0006104 3300048920 Bacteria 12338
232 Ga0496117_0017399 3300048920 Bacteria 6002
233 Ga0496117_0028484 3300048920 Bacteria 4324
234 Ga0496117_0037724 3300048920 Bacteria 3595
235 Ga0496117_0073944 3300048920 Bacteria 2272
236 Ga0496118_0000007 3300048921 Bacteria 650986
237 Ga0496118_0000774 3300048921 Bacteria 51332
238 Ga0496118_0021689 3300048921 Bacteria 5644
239 Ga0496118_0045695 3300048921 Bacteria 3414
240 Ga0496118_0057492 3300048921 Bacteria 2914
241 Ga0496118_0066498 3300048921 Bacteria 2630
242 Ga0496118_0072804 3300048921 Bacteria 2465
243 Ga0496118_0117571 3300048921 Bacteria 1743
244 Ga0496119_0000001 3300048922 Bacteria 789520
245 Ga0496119_0000015 3300048922 Bacteria 312979
246 Ga0496119_0000145 3300048922 Bacteria 99245
247 Ga0496119_0001348 3300048922 Bacteria 30016
248 Ga0496119_0003462 3300048922 Bacteria 16377
249 Ga0496119_0004216 3300048922 Bacteria 14439
250 Ga0496119_0011723 3300048922 Bacteria 7213
251 Ga0496119_0117137 3300048922 Bacteria 1469
252 Ga0496120_0000029 3300048923 Bacteria 229859
253 Ga0496120_0000051 3300048923 Bacteria 186239
254 Ga0496120_0000107 3300048923 Bacteria 139739
255 Ga0496120_0000417 3300048923 Bacteria 67929
256 Ga0496120_0001248 3300048923 Bacteria 32026
257 Ga0496120_0001605 3300048923 Bacteria 26234
258 Ga0496120_0007780 3300048923 Bacteria 7916
259 Ga0496120_0015319 3300048923 Bacteria 5063
260 Ga0496120_0194053 3300048923 Bacteria 988
261 Ga0496121_0000103 3300048924 Bacteria 194818
262 Ga0496121_0018360 3300048924 Bacteria 7056
263 Ga0496121_0022171 3300048924 Bacteria 6178
264 Ga0496122_0000005 3300048925 Bacteria 630659
265 Ga0496122_0003310 3300048925 Bacteria 21316
266 Ga0496122_0015090 3300048925 Bacteria 7410
267 Ga0496122_0019457 3300048925 Bacteria 6200
268 Ga0496122_0059563 3300048925 Bacteria 2818
269 Ga0496122_0094368 3300048925 Bacteria 2025
270 Ga0496123_0000008 3300048926 Bacteria 630628
271 Ga0496123_0001296 3300048926 Bacteria 35611
272 Ga0496123_0014551 3300048926 Bacteria 6512
273 Ga0496123_0025107 3300048926 Bacteria 4502
274 Ga0496123_0048871 3300048926 Bacteria 2842
275 Ga0496124_0000195 3300048927 Bacteria 119909
276 Ga0496124_0000199 3300048927 Bacteria 118647
277 Ga0496124_0000216 3300048927 Bacteria 112485
278 Ga0496124_0003316 3300048927 Bacteria 19842
279 Ga0496124_0040118 3300048927 Bacteria 4052
280 Ga0496124_0059254 3300048927 Bacteria 3217
281 Ga0496124_0171205 3300048927 Bacteria 1681
282 Ga0496125_0000009 3300048928 Bacteria 677678
283 Ga0496125_0032878 3300048928 Bacteria 4600
284 Ga0496125_0034566 3300048928 Bacteria 4453
285 Ga0496125_0068487 3300048928 Bacteria 2791
286 Ga0496126_0013944 3300048929 Bacteria 8152
287 Ga0496126_0030235 3300048929 Bacteria 5134
288 Ga0496126_0079214 3300048929 Bacteria 2909
289 Ga0496126_0252678 3300048929 Bacteria 1468
290 Ga0496126_0335132 3300048929 Bacteria 1240
291 Ga0501032_0000402 3300049569 Bacteria 35659
292 Ga0501034_0025965 3300049571 Bacteria 5966
293 Ga0501036_0019016 3300049572 Bacteria 5763
294 Ga0501037_0042593 3300049573 Bacteria 3336
295 Ga0501038_0233768 3300049574 Bacteria 1462
296 Ga0501039_0052536 3300049575 Bacteria 3153
297 Ga0501043_0026951 3300049579 Bacteria 4509
298 Ga0501046_0003635 3300049580 Bacteria 14129
299 Ga0501047_0018906 3300049581 Bacteria 6607
300 Ga0501048_0032411 3300049582 Bacteria 3776
301 Ga0501067_0018156 3300049583 Bacteria 3896
302 Ga0501068_0183420 3300049584 Bacteria 1324
303 Ga0501070_0029460 3300049586 Bacteria 4602
304 Ga0501074_0000785 3300049590 Bacteria 20059
305 Ga0501077_0091554 3300049593 Bacteria 1927
306 Ga0501219_000078 3300049703 Bacteria 16680
307 Ga0501225_0009606 3300049705 Bacteria 2748
308 Ga0501080_0108593 3300049742 Bacteria 2571
309 Ga0501083_0021187 3300049744 Bacteria 4518
310 Ga0501035_0000392 3300049822 Bacteria 50188
311 Ga0501035_0003849 3300049822 Bacteria 14305
312 Ga0501284_00008 3300050005 Bacteria 143517
313 nmdc:mga00v17_24502_c1 3300050491 Bacteria 3501
314 nmdc:mga00v17_638_c1 3300050491 Bacteria 19381
315 nmdc:mga0k408_1677_c1 3300050493 Bacteria 11956
316 nmdc:mga0k408_28261_c1 3300050493 Bacteria 3189
317 nmdc:mga08y16_31668_c1 3300050511 Bacteria 5560
318 Ga0500639_133725 3300053163 Bacteria 1171
319 Ga0500611_000002 3300053727 Bacteria 345991
320 Ga0500645_019478 3300053730 Bacteria 2110
321 Ga0501084_0207985 3300054114 Bacteria 1651
322 Ga0501082_0125244 3300060353 Bacteria 2229

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009036 Ga0105244_10053472 Ga0105244_100534721 222
2 3300048923 Ga0496120_0194053 Ga0496120_0194053_11_697 222
3 3300005618 Ga0068864_100013585 Ga0068864_1000135852 227
4 3300026095 Ga0207676_10019528 Ga0207676_100195282 227
5 3300002459 JGI24751J29686_10000693 JGI24751J29686_100006937 229
6 3300005331 Ga0070670_100159831 Ga0070670_1001598312 229
7 3300009553 Ga0105249_10005287 Ga0105249_100052877 229
8 3300005288 Ga0065714_10004679 Ga0065714_100046795 235
9 3300009036 Ga0105244_10002861 Ga0105244_100028616 235
10 3300025728 Ga0207655_1000774 Ga0207655_100077428 235
11 3300053163 Ga0500639_133725 Ga0500639_133725_41_769 236
12 3300005329 Ga0070683_100007261 Ga0070683_1000072612 239
13 3300005535 Ga0070684_100003266 Ga0070684_1000032666 239
14 3300005539 Ga0068853_100150492 Ga0068853_1001504922 239
15 3300009093 Ga0105240_10000273 Ga0105240_1000027317 239
16 3300010375 Ga0105239_10253726 Ga0105239_102537262 239
17 3300013104 Ga0157370_10052182 Ga0157370_100521824 239
18 3300013105 Ga0157369_10022428 Ga0157369_100224282 239
19 3300025913 Ga0207695_10000130 Ga0207695_10000130164 239
20 3300026035 Ga0207703_10252133 Ga0207703_102521331 241
21 iso_pu_bacteria 2511231025 2511379551 244
22 iso_pu_bacteria 2537561728 2538424781 244
23 iso_pu_bacteria 2547132181 2547695295 244
24 iso_pu_bacteria 2554235234 2555257659 244
25 iso_pu_bacteria 2561511199 2562462834 244
26 iso_pu_bacteria 2599185299 2599925733 244
27 iso_pu_bacteria 2600255256 2601532523 244
28 iso_pu_bacteria 2600255257 2601537893 244
29 iso_pu_bacteria 2600255310 2601756451 244
30 iso_pu_bacteria 2600255311 2601763068 244
31 iso_pu_bacteria 2602042046 2603638026 244
32 iso_pu_bacteria 2602042109 2603866673 244
33 iso_pu_bacteria 2608642108 2608669496 244
34 iso_pu_bacteria 2648501693 2650899066 244
35 iso_pu_bacteria 2684622997 2686353451 244
36 iso_pu_bacteria 2706794495 2707099135 244
37 iso_pu_bacteria 2711768156 2712468582 244
38 iso_pu_bacteria 2791355275 2793405608 244
39 iso_pu_bacteria 2808606414 2809123493 244
40 iso_pu_bacteria 2811995292 2813729034 244
41 iso_pu_bacteria 2814123068 2814696577 244
42 iso_pu_bacteria 2844528606 2844530959 244
43 iso_pu_bacteria 2847797336 2847799759 244
44 iso_pu_bacteria 2852103415 2852104557 244
45 iso_pu_bacteria 2854601825 2854604076 244
46 iso_pu_bacteria 2855195626 2855197278 244
47 iso_pu_bacteria 2855730933 2855734550 244
48 iso_pu_bacteria 2855767633 2855770140 244
49 iso_pu_bacteria 2858466076 2858468577 244
50 iso_pu_bacteria 2865014394 2865015332 244
51 iso_pu_bacteria 2871272651 2871272902 244
52 iso_pu_bacteria 2871282230 2871283547 244
53 iso_pu_bacteria 2876601092 2876604153 244
54 iso_pu_bacteria 2881609920 2881612635 244
55 iso_pu_bacteria 2888373701 2888378112 244
56 iso_pu_bacteria 2891670763 2891670980 244
57 iso_pu_bacteria 2900051742 2900051898 244
58 iso_pu_bacteria 2919108558 2919108861 244
59 iso_pu_bacteria 2932406140 2932408094 244
60 iso_pu_bacteria 2935625433 2935626750 244
61 iso_pu_bacteria 2939568625 2939569080 244
62 iso_pu_bacteria 2939573065 2939573670 244
63 iso_pu_bacteria 2939577877 2939578551 244
64 iso_pu_bacteria 2939617950 2939619471 244
65 iso_pu_bacteria 2939642701 2939643872 244
66 iso_pu_bacteria 2945951305 2945952917 244
67 iso_pu_bacteria 2969079654 2969082450 244
68 iso_pu_bacteria 2971820967 2971823427 244
69 iso_pu_bacteria 2974435778 2974438348 244
70 iso_pu_bacteria 2984494565 2984496739 244
71 iso_pu_bacteria 2990261002 2990262156 244
72 iso_pu_bacteria 3000376612 3000378896 244
73 iso_pu_bacteria 8015394850 8015398161 244
74 iso_pu_bacteria 8016733728 8016735839 244
75 iso_pu_bacteria 8018221730 8018221921 244
76 iso_pu_bacteria 8019499862 8019500761 244
77 iso_pu_bacteria 8019504834 8019506355 244
78 iso_pu_bacteria 8057304971 8057308551 244
79 3300005290 Ga0065712_10002866 Ga0065712_100028663 245
80 3300005334 Ga0068869_100006382 Ga0068869_1000063824 245
81 3300005549 Ga0070704_100124947 Ga0070704_1001249472 245
82 3300005564 Ga0070664_100320000 Ga0070664_1003200001 245
83 3300005844 Ga0068862_100093454 Ga0068862_1000934542 245
84 3300013104 Ga0157370_10180237 Ga0157370_101802373 245
85 3300026121 Ga0207683_10311312 Ga0207683_103113122 245
86 3300042876 Ga0451577_0233991 Ga0451577_0233991_319_1071 245
87 3300044712 Ga0453684_0601509 Ga0453684_0601509_240_992 245
88 3300003320 rootH2_10034631 rootH2_1003463127 246
89 3300003322 rootL2_10230917 rootL2_102309174 246
90 3300005290 Ga0065712_10003352 Ga0065712_100033522 246
91 3300005328 Ga0070676_10109522 Ga0070676_101095222 246
92 3300005353 Ga0070669_100004763 Ga0070669_1000047632 246
93 3300005354 Ga0070675_100056921 Ga0070675_1000569213 246
94 3300005356 Ga0070674_100027103 Ga0070674_1000271033 246
95 3300005356 Ga0070674_100345460 Ga0070674_1003454602 246
96 3300005365 Ga0070688_100013318 Ga0070688_1000133183 246
97 3300005438 Ga0070701_10098517 Ga0070701_100985171 246
98 3300005458 Ga0070681_10189569 Ga0070681_101895692 246
99 3300005543 Ga0070672_100055335 Ga0070672_1000553352 246
100 3300005578 Ga0068854_100088614 Ga0068854_1000886143 246
101 3300005615 Ga0070702_100390359 Ga0070702_1003903591 246
102 3300005617 Ga0068859_100133796 Ga0068859_1001337962 246
103 3300005719 Ga0068861_100004091 Ga0068861_10000409111 246
104 3300005983 Ga0081540_1015970 Ga0081540_10159702 246
105 3300006195 Ga0075366_10010147 Ga0075366_100101473 246
106 3300006195 Ga0075366_10024480 Ga0075366_100244802 246
107 3300006931 Ga0097620_100133811 Ga0097620_1001338113 246
108 3300009094 Ga0111539_10018813 Ga0111539_100188139 246
109 3300009148 Ga0105243_10335973 Ga0105243_103359731 246
110 3300013308 Ga0157375_10630818 Ga0157375_106308181 246
111 3300014325 Ga0163163_10301399 Ga0163163_103013992 246
112 3300014325 Ga0163163_10492771 Ga0163163_104927712 246
113 3300014326 Ga0157380_10861228 Ga0157380_108612281 246
114 3300014745 Ga0157377_10045598 Ga0157377_100455982 246
115 3300017792 Ga0163161_10085760 Ga0163161_100857603 246
116 3300025315 Ga0207697_10015216 Ga0207697_100152162 246
117 3300025908 Ga0207643_10009119 Ga0207643_100091195 246
118 3300025912 Ga0207707_10160943 Ga0207707_101609432 246
119 3300025925 Ga0207650_10116815 Ga0207650_101168152 246
120 3300025926 Ga0207659_10008616 Ga0207659_100086161 246
121 3300025933 Ga0207706_10049254 Ga0207706_100492542 246
122 3300025936 Ga0207670_10017047 Ga0207670_100170472 246
123 3300025938 Ga0207704_10119133 Ga0207704_101191332 246
124 3300025940 Ga0207691_10170653 Ga0207691_101706532 246
125 3300025942 Ga0207689_10007546 Ga0207689_100075462 246
126 3300025981 Ga0207640_10073280 Ga0207640_100732802 246
127 3300026116 Ga0207674_10003317 Ga0207674_100033172 246
128 3300026118 Ga0207675_100001235 Ga0207675_10000123520 246
129 3300027907 Ga0207428_10187581 Ga0207428_101875812 246
130 3300031251 Ga0265327_10000219 Ga0265327_1000021993 246
131 3300039437 Ga0436365_0693472 Ga0436365_0693472_104_883 246
132 3300041406 Ga0439439_0024904 Ga0439439_0024904_13_777 246
133 3300041509 Ga0451843_1721864 Ga0451843_1721864_148_915 246
134 3300042002 Ga0439442_017726 Ga0439442_017726_348_1112 246
135 3300042131 Ga0450894_008246 Ga0450894_008246_262_1026 246
136 3300042134 Ga0450898_003819 Ga0450898_003819_634_1398 246
137 3300046460 Ga0495638_0111152 Ga0495638_0111152_358_1122 246
138 3300046694 Ga0495649_0099474 Ga0495649_0099474_264_1025 246
139 3300047472 Ga0495686_0025667 Ga0495686_0025667_233_997 246
140 3300047472 Ga0495686_0054141 Ga0495686_0054141_37_801 246
141 3300049569 Ga0501032_0000402 Ga0501032_0000402_9850_10611 246
142 3300049571 Ga0501034_0025965 Ga0501034_0025965_4133_4894 246
143 3300049572 Ga0501036_0019016 Ga0501036_0019016_591_1352 246
144 3300049573 Ga0501037_0042593 Ga0501037_0042593_845_1606 246
145 3300049574 Ga0501038_0233768 Ga0501038_0233768_279_1043 246
146 3300049575 Ga0501039_0052536 Ga0501039_0052536_1724_2485 246
147 3300049579 Ga0501043_0026951 Ga0501043_0026951_940_1701 246
148 3300049580 Ga0501046_0003635 Ga0501046_0003635_442_1203 246
149 3300049581 Ga0501047_0018906 Ga0501047_0018906_1610_2371 246
150 3300049582 Ga0501048_0032411 Ga0501048_0032411_2451_3212 246
151 3300049583 Ga0501067_0018156 Ga0501067_0018156_169_930 246
152 3300049584 Ga0501068_0183420 Ga0501068_0183420_219_980 246
153 3300049586 Ga0501070_0029460 Ga0501070_0029460_3092_3853 246
154 3300049590 Ga0501074_0000785 Ga0501074_0000785_1822_2583 246
155 3300049593 Ga0501077_0091554 Ga0501077_0091554_156_917 246
156 3300049703 Ga0501219_000078 Ga0501219_000078_5559_6320 246
157 3300049705 Ga0501225_0009606 Ga0501225_0009606_491_1252 246
158 3300049742 Ga0501080_0108593 Ga0501080_0108593_355_1116 246
159 3300049744 Ga0501083_0021187 Ga0501083_0021187_2063_2824 246
160 3300049822 Ga0501035_0003849 Ga0501035_0003849_7146_7907 246
161 3300050005 Ga0501284_00008 Ga0501284_00008_121803_122564 246
162 3300050493 nmdc:mga0k408_1677_c1 nmdc:mga0k408_1677_c1_4878_5642 246
163 3300050493 nmdc:mga0k408_28261_c1 nmdc:mga0k408_28261_c1_841_1674 246
164 3300050511 nmdc:mga08y16_31668_c1 nmdc:mga08y16_31668_c1_202_969 246
165 3300053727 Ga0500611_000002 Ga0500611_000002_177277_178035 246
166 3300053730 Ga0500645_019478 Ga0500645_019478_995_1756 246
167 3300054114 Ga0501084_0207985 Ga0501084_0207985_62_823 246
168 3300060353 Ga0501082_0125244 Ga0501082_0125244_861_1622 246
169 2162886007 SwRhRL2b_contig_198135 SwRhRL2b_0465.00000010 248
170 2162886007 SwRhRL2b_contig_333401 SwRhRL2b_0964.00002700 248
171 3300002773 JGI25152J39213_1000914 JGI25152J39213_10009148 248
172 3300003187 JGI25151J46595_10016125 JGI25151J46595_100161252 248
173 3300003856 Ga0058692_1000055 Ga0058692_100005547 248
174 3300003856 Ga0058692_1000094 Ga0058692_100009411 248
175 3300003856 Ga0058692_1000095 Ga0058692_100009518 248
176 3300003856 Ga0058692_1001146 Ga0058692_10011469 248
177 3300005289 Ga0065704_10003369 Ga0065704_100033695 248
178 3300005289 Ga0065704_10003735 Ga0065704_100037356 248
179 3300005347 Ga0070668_100002673 Ga0070668_1000026733 248
180 3300006051 Ga0075364_10011753 Ga0075364_100117533 248
181 3300006051 Ga0075364_10207044 Ga0075364_102070441 248
182 3300006946 Ga0079104_1000049 Ga0079104_1000049174 248
183 3300006946 Ga0079104_1000223 Ga0079104_100022314 248
184 3300006946 Ga0079104_1000486 Ga0079104_100048644 248
185 3300006946 Ga0079104_1001107 Ga0079104_100110715 248
186 3300006946 Ga0079104_1002044 Ga0079104_10020442 248
187 3300009011 Ga0105251_10000040 Ga0105251_1000004034 248
188 3300009011 Ga0105251_10001043 Ga0105251_1000104322 248
189 3300009011 Ga0105251_10007626 Ga0105251_100076265 248
190 3300009011 Ga0105251_10017106 Ga0105251_100171064 248
191 3300009011 Ga0105251_10017936 Ga0105251_100179362 248
192 3300009011 Ga0105251_10023364 Ga0105251_100233642 248
193 3300009036 Ga0105244_10000705 Ga0105244_1000070523 248
194 3300009036 Ga0105244_10000960 Ga0105244_1000096024 248
195 3300009036 Ga0105244_10001297 Ga0105244_100012978 248
196 3300009092 Ga0105250_10000264 Ga0105250_1000026415 248
197 3300009092 Ga0105250_10000533 Ga0105250_100005336 248
198 3300009092 Ga0105250_10000837 Ga0105250_100008374 248
199 3300009092 Ga0105250_10004257 Ga0105250_100042577 248
200 3300009092 Ga0105250_10006430 Ga0105250_100064303 248
201 3300009148 Ga0105243_10233004 Ga0105243_102330042 248
202 3300011119 Ga0105246_10146663 Ga0105246_101466632 248
203 3300013100 Ga0157373_10000469 Ga0157373_100004695 248
204 3300013102 Ga0157371_10000782 Ga0157371_1000078217 248
205 3300013102 Ga0157371_10001758 Ga0157371_1000175818 248
206 3300013105 Ga0157369_10002617 Ga0157369_1000261719 248
207 3300013105 Ga0157369_10003245 Ga0157369_1000324511 248
208 3300013306 Ga0163162_10058691 Ga0163162_100586914 248
209 3300013306 Ga0163162_10073850 Ga0163162_100738503 248
210 3300013307 Ga0157372_10003680 Ga0157372_1000368013 248
211 3300013307 Ga0157372_10013672 Ga0157372_100136725 248
212 3300013307 Ga0157372_10014587 Ga0157372_100145875 248
213 3300013307 Ga0157372_10044379 Ga0157372_100443792 248
214 3300013307 Ga0157372_10075170 Ga0157372_100751703 248
215 3300014497 Ga0182008_10069716 Ga0182008_100697161 248
216 3300015261 Ga0182006_1004446 Ga0182006_10044462 248
217 3300017792 Ga0163161_10048512 Ga0163161_100485122 248
218 3300017792 Ga0163161_10072204 Ga0163161_100722042 248
219 3300025233 Ga0209437_100073 Ga0209437_100073168 248
220 3300025245 Ga0207425_1010822 Ga0207425_10108222 248
221 3300025258 Ga0209129_1000004 Ga0209129_1000004175 248
222 3300025294 Ga0209025_1000003 Ga0209025_1000003399 248
223 3300025711 Ga0207696_1000005 Ga0207696_1000005469 248
224 3300025711 Ga0207696_1000042 Ga0207696_1000042176 248
225 3300025711 Ga0207696_1000432 Ga0207696_100043234 248
226 3300025711 Ga0207696_1000858 Ga0207696_10008586 248
227 3300025711 Ga0207696_1001101 Ga0207696_100110113 248
228 3300025711 Ga0207696_1002965 Ga0207696_10029653 248
229 3300025711 Ga0207696_1005899 Ga0207696_10058992 248
230 3300025728 Ga0207655_1000001 Ga0207655_10000011311 248
231 3300025728 Ga0207655_1000069 Ga0207655_1000069152 248
232 3300025728 Ga0207655_1005188 Ga0207655_10051884 248
233 3300025728 Ga0207655_1014021 Ga0207655_10140214 248
234 3300025728 Ga0207655_1027418 Ga0207655_10274183 248
235 3300025728 Ga0207655_1057203 Ga0207655_10572031 248
236 3300025735 Ga0207713_1000001 Ga0207713_10000011139 248
237 3300025735 Ga0207713_1000002 Ga0207713_1000002711 248
238 3300025735 Ga0207713_1000003 Ga0207713_1000003268 248
239 3300025735 Ga0207713_1017140 Ga0207713_10171403 248
240 3300025735 Ga0207713_1019422 Ga0207713_10194225 248
241 3300025735 Ga0207713_1026645 Ga0207713_10266453 248
242 3300025935 Ga0207709_10238878 Ga0207709_102388782 248
243 3300025972 Ga0207668_10109002 Ga0207668_101090022 248
244 3300027111 Ga0209281_1000001 Ga0209281_1000001740 248
245 3300027111 Ga0209281_1000004 Ga0209281_10000041131 248
246 3300027111 Ga0209281_1000006 Ga0209281_1000006996 248
247 3300027111 Ga0209281_1000012 Ga0209281_100001213 248
248 3300027111 Ga0209281_1001189 Ga0209281_10011896 248
249 3300027111 Ga0209281_1003086 Ga0209281_10030862 248
250 3300027312 Ga0209371_1000002 Ga0209371_1000002332 248
251 3300027312 Ga0209371_1000041 Ga0209371_1000041310 248
252 3300027312 Ga0209371_1000075 Ga0209371_100007593 248
253 3300027312 Ga0209371_1000077 Ga0209371_100007777 248
254 3300027312 Ga0209371_1000271 Ga0209371_100027139 248
255 3300027312 Ga0209371_1000436 Ga0209371_10004366 248
256 3300027312 Ga0209371_1002538 Ga0209371_10025382 248
257 3300027312 Ga0209371_1006199 Ga0209371_10061992 248
258 3300027312 Ga0209371_1014229 Ga0209371_10142292 248
259 3300030500 Ga0268256_1000002 Ga0268256_10000021132 248
260 3300030500 Ga0268256_1000003 Ga0268256_10000031134 248
261 3300030500 Ga0268256_1000033 Ga0268256_1000033376 248
262 3300030500 Ga0268256_1000068 Ga0268256_1000068104 248
263 3300030500 Ga0268256_1000317 Ga0268256_10003177 248
264 3300030500 Ga0268256_1000376 Ga0268256_100037635 248
265 3300030500 Ga0268256_1006407 Ga0268256_10064072 248
266 3300030500 Ga0268256_1009605 Ga0268256_10096052 248
267 3300030500 Ga0268256_1013609 Ga0268256_10136092 248
268 3300039450 Ga0436363_1379572 Ga0436363_1379572_1559_2308 248
269 3300041405 Ga0439438_000001 Ga0439438_000001_788501_789247 248
270 3300041407 Ga0439447_002339 Ga0439447_002339_5230_5976 248
271 3300041407 Ga0439447_007808 Ga0439447_007808_1101_1901 248
272 3300041411 Ga0439466_0000009 Ga0439466_0000009_87310_88110 248
273 3300042006 Ga0439432_009362 Ga0439432_009362_576_1322 248
274 3300042010 Ga0439452_000028 Ga0439452_000028_98173_98922 248
275 3300042010 Ga0439452_023625 Ga0439452_023625_158_958 248
276 3300042010 Ga0439452_040894 Ga0439452_040894_294_1040 248
277 3300042146 Ga0450907_000172 Ga0450907_000172_2212_3012 248
278 3300046458 Ga0495591_000003 Ga0495591_000003_385939_386685 248
279 3300046458 Ga0495591_000007 Ga0495591_000007_60928_61674 248
280 3300046458 Ga0495591_001918 Ga0495591_001918_11146_11895 248
281 3300046460 Ga0495638_0002827 Ga0495638_0002827_12705_13454 248
282 3300046492 Ga0495585_0030732 Ga0495585_0030732_1493_2293 248
283 3300046500 Ga0495596_0021461 Ga0495596_0021461_820_1620 248
284 3300046515 Ga0495620_0002310 Ga0495620_0002310_2058_2807 248
285 3300046524 Ga0495648_0001677 Ga0495648_0001677_2933_3733 248
286 3300046530 Ga0495654_0000007 Ga0495654_0000007_95376_96122 248
287 3300046530 Ga0495654_0012677 Ga0495654_0012677_3308_4054 248
288 3300046530 Ga0495654_0023563 Ga0495654_0023563_1888_2637 248
289 3300046542 Ga0495597_0000396 Ga0495597_0000396_6397_7146 248
290 3300046616 Ga0495668_0012466 Ga0495668_0012466_3835_4581 248
291 3300046674 Ga0495588_0006734 Ga0495588_0006734_4272_5021 248
292 3300046692 Ga0495671_0056232 Ga0495671_0056232_320_1111 248
293 3300046694 Ga0495649_0000229 Ga0495649_0000229_21859_22608 248
294 3300046694 Ga0495649_0000261 Ga0495649_0000261_24423_25172 248
295 3300046810 Ga0495660_0030834 Ga0495660_0030834_2194_2994 248
296 3300047320 Ga0495672_0000034 Ga0495672_0000034_128640_129389 248
297 3300047320 Ga0495672_0000053 Ga0495672_0000053_122919_123719 248
298 3300047446 Ga0495679_000005 Ga0495679_000005_141130_141879 248
299 3300047446 Ga0495679_000484 Ga0495679_000484_8364_9113 248
300 3300047446 Ga0495679_010848 Ga0495679_010848_2459_3259 248
301 3300047446 Ga0495679_064285 Ga0495679_064285_165_914 248
302 3300047446 Ga0495679_087308 Ga0495679_087308_103_852 248
303 3300047469 Ga0495673_0000070 Ga0495673_0000070_10322_11068 248
304 3300048903 Ga0496100_0100068 Ga0496100_0100068_873_1673 248
305 3300048904 Ga0496101_0000083 Ga0496101_0000083_17128_17874 248
306 3300048904 Ga0496101_0615800 Ga0496101_0615800_84_833 248
307 3300048905 Ga0496102_0000807 Ga0496102_0000807_6228_7028 248
308 3300048907 Ga0496104_0004356 Ga0496104_0004356_2003_2752 248
309 3300048907 Ga0496104_0218281 Ga0496104_0218281_77_823 248
310 3300048908 Ga0496105_0023364 Ga0496105_0023364_2206_3006 248
311 3300048908 Ga0496105_0059894 Ga0496105_0059894_523_1272 248
312 3300048919 Ga0496116_0029594 Ga0496116_0029594_3077_3826 248
313 3300048919 Ga0496116_0032443 Ga0496116_0032443_755_1501 248
314 3300048919 Ga0496116_0118833 Ga0496116_0118833_435_1181 248
315 3300048919 Ga0496116_0222211 Ga0496116_0222211_53_853 248
316 3300048920 Ga0496117_0000022 Ga0496117_0000022_253722_254522 248
317 3300048920 Ga0496117_0000268 Ga0496117_0000268_32965_33765 248
318 3300048920 Ga0496117_0003107 Ga0496117_0003107_17030_17776 248
319 3300048920 Ga0496117_0006104 Ga0496117_0006104_7667_8458 248
320 3300048920 Ga0496117_0017399 Ga0496117_0017399_773_1519 248
321 3300048920 Ga0496117_0028484 Ga0496117_0028484_3048_3797 248
322 3300048920 Ga0496117_0037724 Ga0496117_0037724_2790_3536 248
323 3300048920 Ga0496117_0073944 Ga0496117_0073944_481_1230 248
324 3300048921 Ga0496118_0000007 Ga0496118_0000007_321876_322676 248
325 3300048921 Ga0496118_0000774 Ga0496118_0000774_20570_21370 248
326 3300048921 Ga0496118_0021689 Ga0496118_0021689_1545_2291 248
327 3300048921 Ga0496118_0045695 Ga0496118_0045695_1124_1870 248
328 3300048921 Ga0496118_0057492 Ga0496118_0057492_146_895 248
329 3300048921 Ga0496118_0066498 Ga0496118_0066498_1736_2485 248
330 3300048921 Ga0496118_0072804 Ga0496118_0072804_1619_2368 248
331 3300048921 Ga0496118_0117571 Ga0496118_0117571_913_1659 248
332 3300048922 Ga0496119_0000001 Ga0496119_0000001_682406_683155 248
333 3300048922 Ga0496119_0000015 Ga0496119_0000015_99152_99898 248
334 3300048922 Ga0496119_0000145 Ga0496119_0000145_35948_36697 248
335 3300048922 Ga0496119_0001348 Ga0496119_0001348_25863_26612 248
336 3300048922 Ga0496119_0003462 Ga0496119_0003462_12022_12771 248
337 3300048922 Ga0496119_0004216 Ga0496119_0004216_2757_3503 248
338 3300048922 Ga0496119_0011723 Ga0496119_0011723_1444_2244 248
339 3300048922 Ga0496119_0117137 Ga0496119_0117137_707_1453 248
340 3300048923 Ga0496120_0000029 Ga0496120_0000029_129962_130708 248
341 3300048923 Ga0496120_0000051 Ga0496120_0000051_152295_153044 248
342 3300048923 Ga0496120_0000107 Ga0496120_0000107_108417_109217 248
343 3300048923 Ga0496120_0000417 Ga0496120_0000417_55661_56410 248
344 3300048923 Ga0496120_0001248 Ga0496120_0001248_23445_24191 248
345 3300048923 Ga0496120_0001605 Ga0496120_0001605_4321_5103 248
346 3300048923 Ga0496120_0007780 Ga0496120_0007780_6353_7099 248
347 3300048923 Ga0496120_0015319 Ga0496120_0015319_2756_3505 248
348 3300048924 Ga0496121_0000103 Ga0496121_0000103_175337_176137 248
349 3300048924 Ga0496121_0018360 Ga0496121_0018360_6265_7011 248
350 3300048924 Ga0496121_0022171 Ga0496121_0022171_2044_2790 248
351 3300048925 Ga0496122_0000005 Ga0496122_0000005_233842_234588 248
352 3300048925 Ga0496122_0003310 Ga0496122_0003310_18153_18953 248
353 3300048925 Ga0496122_0015090 Ga0496122_0015090_2096_2842 248
354 3300048925 Ga0496122_0019457 Ga0496122_0019457_4302_5048 248
355 3300048925 Ga0496122_0059563 Ga0496122_0059563_769_1518 248
356 3300048925 Ga0496122_0094368 Ga0496122_0094368_116_916 248
357 3300048926 Ga0496123_0000008 Ga0496123_0000008_396041_396787 248
358 3300048926 Ga0496123_0001296 Ga0496123_0001296_6755_7555 248
359 3300048926 Ga0496123_0014551 Ga0496123_0014551_4552_5298 248
360 3300048926 Ga0496123_0025107 Ga0496123_0025107_3712_4461 248
361 3300048926 Ga0496123_0048871 Ga0496123_0048871_1362_2108 248
362 3300048927 Ga0496124_0000195 Ga0496124_0000195_86237_86986 248
363 3300048927 Ga0496124_0000199 Ga0496124_0000199_59181_59930 248
364 3300048927 Ga0496124_0000216 Ga0496124_0000216_6047_6847 248
365 3300048927 Ga0496124_0003316 Ga0496124_0003316_2794_3540 248
366 3300048927 Ga0496124_0040118 Ga0496124_0040118_2923_3672 248
367 3300048927 Ga0496124_0059254 Ga0496124_0059254_586_1332 248
368 3300048927 Ga0496124_0171205 Ga0496124_0171205_336_1082 248
369 3300048928 Ga0496125_0000009 Ga0496125_0000009_407089_407835 248
370 3300048928 Ga0496125_0032878 Ga0496125_0032878_2651_3397 248
371 3300048928 Ga0496125_0034566 Ga0496125_0034566_1771_2547 248
372 3300048928 Ga0496125_0068487 Ga0496125_0068487_862_1611 248
373 3300048929 Ga0496126_0013944 Ga0496126_0013944_6277_7026 248
374 3300048929 Ga0496126_0030235 Ga0496126_0030235_3808_4554 248
375 3300048929 Ga0496126_0079214 Ga0496126_0079214_1581_2330 248
376 3300048929 Ga0496126_0252678 Ga0496126_0252678_587_1333 248
377 3300048929 Ga0496126_0335132 Ga0496126_0335132_407_1153 248
378 3300049822 Ga0501035_0000392 Ga0501035_0000392_7725_8471 248
379 3300050491 nmdc:mga00v17_24502_c1 nmdc:mga00v17_24502_c1_470_1270 248
380 3300050491 nmdc:mga00v17_638_c1 nmdc:mga00v17_638_c1_14868_15614 248
381 iso_pu_bacteria 2978975091 2978979482 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

26

220

0.98

PF08659

KR

KR domain

27

206

0.91

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

32

251

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9889 1 239
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9874 1 239
3asv-assembly1.cif.gz_A the closed form of serine dehydrogenase complexed with nadp+ 0.9873 1 248
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9798 1 239
3asu-assembly1.cif.gz_A-2 crystal structure of serine dehydrogenase from escherichia coli 0.9784 1 239
ID Description Score Start End Superfamily
3asvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9866 1 248 3.40.50.720
af_O15744_2_259_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9703 3 239 3.40.50.720
af_P9WGR5_6_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9702 2 239 3.40.50.720
3rkuD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9665 2 239 3.40.50.720
af_Q9P7B4_1_257_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 3 239 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A705WUA1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 1.002 1 160 GO:0005829
GO:0016491
AF-A0A6L7A4L5-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9993 1 182 GO:0005829
GO:0016491
AF-A0A705WUA1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9955 1 160 GO:0005829
GO:0016491
AF-A0A0A2W3N6-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9948 1 236 GO:0003677
GO:0003700
GO:0005829
GO:0016491
AF-A0A6L7A4L5-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG (EC 1.1.1.298) (EC 1.1.1.381) (L-allo-threonine dehydrogenase) (Malonic semialdehyde reductase) 0.9938 1 182 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
92.19 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map