F429028

General Info

Members Datasets Scaffolds Average Seq Length
381 189 260 305

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0090182|Ga0466961_0090182_651_1754
Length 367
Sequence VADQKLGQRQLNYGNDELRKAPANVACFPQLPLKPLPHGRQEEWAMAGAPEIMQSNRSAAAAVTKASVYKRMLGQKQLMLMSLPVLVYVVIFSYYPIWGWTMAFQNYVPGKPFSQQQWVGFKQFKFLFSDDTFLNVLRNTIAMSFINMVSGFVTAIVFAILLNEIKSRLYKRAIQTISYLPHFLSWIIVTGIVANTLSVDNGIVNVLLMKLGLIQEPIMWLSVPKYFWGIVAASHVWKEVGWNAIIYLAAITSIDPSLYEAAEIDGANRYQKMLYVTLPGIKSIVIILLIMNLGWILEAGFEVQYLLGNGVVVDWSQTIDIFVLKYGLQVGNYSLATAAGIFKTTVSIVLIFAANTIAKRFGEDRLI

Samples

Sample ID Description Type Environment
1 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
2 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
3 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
4 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
5 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
6 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
7 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
8 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
9 2671180694 Paenibacillus sp. A3 Isolate Unclassified
10 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
11 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
12 2818991441 Niallia circulans 3243 Isolate Rhizosphere
13 2818991459 Paenibacillus sp. 597 Isolate Unclassified
14 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
15 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
16 2857472729 Cohnella sp. R-74144 Isolate Unclassified
17 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
18 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
19 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
20 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
21 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
22 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
23 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
24 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
25 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
26 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
27 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
28 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
29 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
30 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
31 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
32 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
33 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
34 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
35 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
36 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
37 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
38 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
39 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
40 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
41 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
42 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
45 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
46 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
47 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
48 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
51 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
52 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
187 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
188 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
189 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 66.14
Metatranscriptomes 3.15
Isolates 30.71

Biome Distribution

Category Percentage (%)
Aerial Root 1.05
Bulb 0
Endosphere 5.25
Nodule 0.52
Rhizoplane 1.57
Rhizosphere 52.76
Stem 0
Stem Tuber 0
Unclassified 38.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1009611 3300002737 Bacteria 1280
2 JGI25151J46595_10052168 3300003187 Bacteria 1378
3 rootH1_10005399 3300003316 Bacteria 4284
4 Ga0055538_1000259 3300003751 Bacteria 28019
5 Ga0055538_1001509 3300003751 Bacteria 4376
6 Ga0055535_1005258 3300003761 Bacteria 2889
7 Ga0055541_1002344 3300003841 Bacteria 3810
8 Ga0058863_10021277 3300004799 Bacteria 2847
9 Ga0058861_10115392 3300004800 Bacteria 1546
10 Ga0058860_10007270 3300004801 Bacteria 2415
11 Ga0070676_10172296 3300005328 Bacteria 1401
12 Ga0070683_100055849 3300005329 Bacteria 3665
13 Ga0070680_100113231 3300005336 Bacteria 2259
14 Ga0070682_100055022 3300005337 Bacteria 2498
15 Ga0070660_100189089 3300005339 Bacteria 1667
16 Ga0070689_100035294 3300005340 Bacteria 3820
17 Ga0070691_10096972 3300005341 Bacteria 1460
18 Ga0070668_100224828 3300005347 Bacteria 1549
19 Ga0070674_100216626 3300005356 Bacteria 1487
20 Ga0070703_10012723 3300005406 Bacteria 2384
21 Ga0070709_10042002 3300005434 Bacteria 2821
22 Ga0070714_100150427 3300005435 Bacteria 2097
23 Ga0070694_100052252 3300005444 Bacteria 2761
24 Ga0070708_100338017 3300005445 Bacteria 1419
25 Ga0070681_10443883 3300005458 Bacteria 1209
26 Ga0070679_100040735 3300005530 Bacteria 4621
27 Ga0070672_100270235 3300005543 Bacteria 1435
28 Ga0068855_100057494 3300005563 Bacteria 4559
29 Ga0068854_100043110 3300005578 Bacteria 3196
30 Ga0070702_100271026 3300005615 Bacteria 1161
31 Ga0068852_100148607 3300005616 Bacteria 2176
32 Ga0068859_100317951 3300005617 Bacteria 1650
33 Ga0068866_10189763 3300005718 Bacteria 1220
34 Ga0068861_100269880 3300005719 Bacteria 1460
35 Ga0070716_100082079 3300006173 Bacteria 1927
36 Ga0068871_100295069 3300006358 Bacteria 1422
37 Ga0068865_100345979 3300006881 Bacteria 1203
38 Ga0097620_100317948 3300006931 Bacteria 1650
39 Ga0079104_1002340 3300006946 Bacteria 10411
40 Ga0105251_10072204 3300009011 Bacteria 1605
41 Ga0105244_10004161 3300009036 Bacteria 10071
42 Ga0105244_10010454 3300009036 Bacteria 5628
43 Ga0105244_10010943 3300009036 Bacteria 5471
44 Ga0105244_10020230 3300009036 Bacteria 3700
45 Ga0105244_10037448 3300009036 Bacteria 2535
46 Ga0105240_10260179 3300009093 Bacteria 2002
47 Ga0105245_10165598 3300009098 Bacteria 2101
48 Ga0105247_10086301 3300009101 Bacteria 1986
49 Ga0105243_10059367 3300009148 Bacteria 3052
50 Ga0105242_10065649 3300009176 Bacteria 2994
51 Ga0105248_10067649 3300009177 Bacteria 4011
52 Ga0105237_10022554 3300009545 Bacteria 6459
53 Ga0105238_10016034 3300009551 Bacteria 7578
54 Ga0105249_10032016 3300009553 Bacteria 4756
55 Ga0105239_10399257 3300010375 Bacteria 1556
56 Ga0105246_10000948 3300011119 Bacteria 16588
57 Ga0105246_10023185 3300011119 Bacteria 4014
58 Ga0105246_10031727 3300011119 Bacteria 3498
59 Ga0157371_10018598 3300013102 Bacteria 5133
60 Ga0157371_10109963 3300013102 Bacteria 1956
61 Ga0157370_10067560 3300013104 Bacteria 3379
62 Ga0157369_10037287 3300013105 Bacteria 5322
63 Ga0157374_10031504 3300013296 Bacteria 4820
64 Ga0157378_10333837 3300013297 Bacteria 1476
65 Ga0157372_10049996 3300013307 Bacteria 4651
66 Ga0157379_10096108 3300014968 Bacteria 2659
67 Ga0163161_10052606 3300017792 Bacteria 2952
68 Ga0197907_11116098 3300020069 Bacteria 2256
69 Ga0206356_10470479 3300020070 Bacteria 4041
70 Ga0206352_10213290 3300020078 Bacteria 2944
71 Ga0206350_11337958 3300020080 Bacteria 2231
72 Ga0206354_11072404 3300020081 Bacteria 3735
73 Ga0206353_10644318 3300020082 Bacteria 3603
74 Ga0224712_10020294 3300022467 Bacteria 2253
75 Ga0209784_100117 3300025224 Bacteria 85907
76 Ga0209784_100149 3300025224 Bacteria 63832
77 Ga0209566_100041 3300025225 Bacteria 289634
78 Ga0209566_100139 3300025225 Bacteria 89273
79 Ga0209566_100147 3300025225 Bacteria 82642
80 Ga0209566_100377 3300025225 Bacteria 36595
81 Ga0209437_100325 3300025233 Bacteria 60773
82 Ga0209437_100807 3300025233 Bacteria 14215
83 Ga0209258_106940 3300025242 Bacteria 1720
84 Ga0209675_1002015 3300025291 Bacteria 10881
85 Ga0209025_1001311 3300025294 Bacteria 33888
86 Ga0209025_1045421 3300025294 Bacteria 1821
87 Ga0209025_1076607 3300025294 Bacteria 1158
88 Ga0207655_1014473 3300025728 Bacteria 4456
89 Ga0207655_1030517 3300025728 Bacteria 2505
90 Ga0207655_1030957 3300025728 Bacteria 2477
91 Ga0207688_10037218 3300025901 Bacteria 2698
92 Ga0207705_10012687 3300025909 Bacteria 6081
93 Ga0207707_10005776 3300025912 Bacteria 10818
94 Ga0207660_10136918 3300025917 Bacteria 1869
95 Ga0207662_10042258 3300025918 Bacteria 2686
96 Ga0207657_10007118 3300025919 Bacteria 11486
97 Ga0207652_10008280 3300025921 Bacteria 8360
98 Ga0207650_10237360 3300025925 Bacteria 1472
99 Ga0207687_10149200 3300025927 Bacteria 1782
100 Ga0207700_10096587 3300025928 Bacteria 2346
101 Ga0207664_10141666 3300025929 Bacteria 2035
102 Ga0207706_10047456 3300025933 Bacteria 3799
103 Ga0207670_10093224 3300025936 Bacteria 2133
104 Ga0207704_10041902 3300025938 Bacteria 2690
105 Ga0207665_10179183 3300025939 Bacteria 1534
106 Ga0207691_10073728 3300025940 Bacteria 3079
107 Ga0207661_10003061 3300025944 Bacteria 11578
108 Ga0207667_10069993 3300025949 Bacteria 3652
109 Ga0207640_10044114 3300025981 Bacteria 2855
110 Ga0207639_10151723 3300026041 Bacteria 1941
111 Ga0207708_10018267 3300026075 Bacteria 5279
112 Ga0207641_10201142 3300026088 Bacteria 1837
113 Ga0207676_10356391 3300026095 Bacteria 1354
114 Ga0207674_10182311 3300026116 Bacteria 2051
115 Ga0207675_100008111 3300026118 Bacteria 9896
116 Ga0207698_10185244 3300026142 Bacteria 1848
117 Ga0209281_1003383 3300027111 Bacteria 5316
118 Ga0307409_100064288 3300031995 Bacteria 2882
119 Ga0307416_100146241 3300032002 Bacteria 2158
120 Ga0395899_0049781 3300037312 Bacteria 3113
121 Ga0439439_0002073 3300041406 Bacteria 4179
122 Ga0439433_0007158 3300041999 Bacteria 2408
123 Ga0439433_0025340 3300041999 Bacteria 1339
124 Ga0439449_0002172 3300042007 Bacteria 7709
125 Ga0439449_0018328 3300042007 Bacteria 2627
126 Ga0439449_0028319 3300042007 Bacteria 2088
127 Ga0439462_0019410 3300042015 Bacteria 1769
128 Ga0466969_0001502 3300044656 Bacteria 12538
129 Ga0466966_0036242 3300044684 Bacteria 3186
130 Ga0466961_0090182 3300044693 Bacteria 1936
131 Ga0466961_0102024 3300044693 Bacteria 1807
132 Ga0453684_0005962 3300044712 Bacteria 23627
133 Ga0466968_0006397 3300044735 Bacteria 4440
134 Ga0466968_0013378 3300044735 Bacteria 3226
135 Ga0466968_0016256 3300044735 Bacteria 2961
136 Ga0466960_0005139 3300044901 Bacteria 5179
137 Ga0466959_0002475 3300045049 Bacteria 11824
138 Ga0466959_0004766 3300045049 Bacteria 9144
139 Ga0466959_0071093 3300045049 Bacteria 2520
140 Ga0495668_0001082 3300046616 Bacteria 28417
141 Ga0495625_0001615 3300046660 Bacteria 26589
142 Ga0495661_0054522 3300046665 Bacteria 2400
143 Ga0495660_0012482 3300046810 Bacteria 4932
144 Ga0495626_0000553 3300048091 Bacteria 37152
145 Ga0495626_0018501 3300048091 Bacteria 3498
146 Ga0496101_0216722 3300048904 Bacteria 1485
147 Ga0496108_0219608 3300048911 Bacteria 1651
148 Ga0496109_0408684 3300048912 Bacteria 1283
149 Ga0496110_0313171 3300048913 Bacteria 1429
150 Ga0496116_0000687 3300048919 Bacteria 43932
151 Ga0496116_0002448 3300048919 Bacteria 19483
152 Ga0496116_0004053 3300048919 Bacteria 14161
153 Ga0496116_0005684 3300048919 Bacteria 11476
154 Ga0496116_0009798 3300048919 Bacteria 8123
155 Ga0496116_0010716 3300048919 Bacteria 7653
156 Ga0496116_0013028 3300048919 Bacteria 6744
157 Ga0496116_0013583 3300048919 Bacteria 6550
158 Ga0496116_0021585 3300048919 Bacteria 4850
159 Ga0496116_0027084 3300048919 Bacteria 4177
160 Ga0496116_0033687 3300048919 Bacteria 3629
161 Ga0496116_0035960 3300048919 Bacteria 3474
162 Ga0496116_0049693 3300048919 Bacteria 2801
163 Ga0496116_0074588 3300048919 Bacteria 2133
164 Ga0496116_0084619 3300048919 Bacteria 1953
165 Ga0496117_0000150 3300048920 Bacteria 148465
166 Ga0496117_0000161 3300048920 Bacteria 141379
167 Ga0496117_0022587 3300048920 Bacteria 5041
168 Ga0496117_0047712 3300048920 Bacteria 3068
169 Ga0496117_0056537 3300048920 Bacteria 2732
170 Ga0496118_0020678 3300048921 Bacteria 5828
171 Ga0496118_0029028 3300048921 Bacteria 4646
172 Ga0496119_0000042 3300048922 Bacteria 200701
173 Ga0496119_0000088 3300048922 Bacteria 135581
174 Ga0496119_0000369 3300048922 Bacteria 62502
175 Ga0496119_0000453 3300048922 Bacteria 56116
176 Ga0496119_0000702 3300048922 Bacteria 44864
177 Ga0496119_0004952 3300048922 Bacteria 13017
178 Ga0496119_0011450 3300048922 Bacteria 7342
179 Ga0496119_0040429 3300048922 Bacteria 2982
180 Ga0496119_0082380 3300048922 Bacteria 1850
181 Ga0496119_0209997 3300048922 Bacteria 1002
182 Ga0496120_0000006 3300048923 Bacteria 445068
183 Ga0496120_0000083 3300048923 Bacteria 157876
184 Ga0496120_0000089 3300048923 Bacteria 151805
185 Ga0496120_0000368 3300048923 Bacteria 73340
186 Ga0496120_0000516 3300048923 Bacteria 59973
187 Ga0496120_0001003 3300048923 Bacteria 38112
188 Ga0496120_0002475 3300048923 Bacteria 18598
189 Ga0496120_0003342 3300048923 Bacteria 14731
190 Ga0496120_0006795 3300048923 Bacteria 8672
191 Ga0496120_0058392 3300048923 Bacteria 2167
192 Ga0496121_0068761 3300048924 Bacteria 2863
193 Ga0496121_0096724 3300048924 Bacteria 2290
194 Ga0496121_0108097 3300048924 Bacteria 2128
195 Ga0496121_0109338 3300048924 Bacteria 2113
196 Ga0496121_0397141 3300048924 Bacteria 904
197 Ga0496122_0000028 3300048925 Bacteria 347194
198 Ga0496122_0000035 3300048925 Bacteria 318098
199 Ga0496122_0000040 3300048925 Bacteria 285095
200 Ga0496122_0000325 3300048925 Bacteria 103742
201 Ga0496122_0000824 3300048925 Bacteria 59275
202 Ga0496122_0001304 3300048925 Bacteria 41137
203 Ga0496122_0002120 3300048925 Bacteria 29206
204 Ga0496122_0004419 3300048925 Bacteria 17493
205 Ga0496122_0010328 3300048925 Bacteria 9654
206 Ga0496122_0011539 3300048925 Bacteria 8934
207 Ga0496122_0013837 3300048925 Bacteria 7856
208 Ga0496122_0013933 3300048925 Bacteria 7819
209 Ga0496122_0025226 3300048925 Bacteria 5171
210 Ga0496122_0040140 3300048925 Bacteria 3724
211 Ga0496122_0054015 3300048925 Bacteria 3022
212 Ga0496122_0073327 3300048925 Bacteria 2428
213 Ga0496122_0084000 3300048925 Bacteria 2205
214 Ga0496122_0178174 3300048925 Bacteria 1272
215 Ga0496123_0000399 3300048926 Bacteria 80610
216 Ga0496123_0000640 3300048926 Bacteria 58520
217 Ga0496123_0003253 3300048926 Bacteria 18456
218 Ga0496123_0005476 3300048926 Bacteria 12771
219 Ga0496123_0007260 3300048926 Bacteria 10515
220 Ga0496123_0011099 3300048926 Bacteria 7857
221 Ga0496123_0025586 3300048926 Bacteria 4446
222 Ga0496123_0041106 3300048926 Bacteria 3210
223 Ga0496123_0047866 3300048926 Bacteria 2883
224 Ga0496123_0207652 3300048926 Bacteria 998
225 Ga0496124_0000242 3300048927 Bacteria 105814
226 Ga0496124_0000527 3300048927 Bacteria 65126
227 Ga0496124_0001287 3300048927 Bacteria 38093
228 Ga0496124_0005031 3300048927 Bacteria 15110
229 Ga0496124_0022856 3300048927 Bacteria 5725
230 Ga0496124_0032822 3300048927 Bacteria 4579
231 Ga0496124_0085164 3300048927 Bacteria 2591
232 Ga0496125_0000010 3300048928 Bacteria 671167
233 Ga0496125_0001240 3300048928 Bacteria 38181
234 Ga0496125_0012334 3300048928 Bacteria 8491
235 Ga0496125_0179503 3300048928 Bacteria 1413
236 Ga0496126_0000002 3300048929 Bacteria 1001703
237 Ga0496126_0000205 3300048929 Bacteria 132210
238 Ga0496126_0000210 3300048929 Bacteria 131214
239 Ga0496126_0000401 3300048929 Bacteria 88294
240 Ga0496126_0000481 3300048929 Bacteria 79161
241 Ga0496126_0000569 3300048929 Bacteria 70647
242 Ga0496126_0000742 3300048929 Bacteria 59052
243 Ga0496126_0001306 3300048929 Bacteria 39713
244 Ga0496126_0002294 3300048929 Bacteria 26361
245 Ga0496126_0003339 3300048929 Bacteria 20399
246 Ga0496126_0010895 3300048929 Bacteria 9472
247 Ga0496126_0019979 3300048929 Bacteria 6581
248 Ga0496126_0039278 3300048929 Bacteria 4392
249 Ga0496126_0114147 3300048929 Bacteria 2350
250 Ga0501040_0099317 3300049576 Bacteria 2029
251 Ga0501042_0176690 3300049578 Bacteria 1540
252 Ga0501067_0099305 3300049583 Bacteria 1617
253 Ga0501071_0042605 3300049587 Bacteria 3254
254 Ga0501217_000806 3300049661 Bacteria 5471
255 Ga0501217_004886 3300049661 Bacteria 2777
256 Ga0501079_0255458 3300049741 Bacteria 1370
257 Ga0501279_002325 3300049775 Bacteria 2497
258 Ga0501084_0064617 3300054114 Bacteria 3062
259 Ga0587093_002460 3300059478 Bacteria 1725
260 Ga0587067_000358 3300059640 Bacteria 3818

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0064617 Ga0501084_0064617_110_1015 252
2 3300049576 Ga0501040_0099317 Ga0501040_0099317_33_938 253
3 3300048904 Ga0496101_0216722 Ga0496101_0216722_475_1419 258
4 3300006173 Ga0070716_100082079 Ga0070716_1000820792 259
5 3300005434 Ga0070709_10042002 Ga0070709_100420022 260
6 3300004799 Ga0058863_10021277 Ga0058863_100212773 261
7 3300004800 Ga0058861_10115392 Ga0058861_101153922 261
8 3300005329 Ga0070683_100055849 Ga0070683_1000558494 261
9 3300005336 Ga0070680_100113231 Ga0070680_1001132312 261
10 3300005337 Ga0070682_100055022 Ga0070682_1000550222 261
11 3300005339 Ga0070660_100189089 Ga0070660_1001890892 261
12 3300005340 Ga0070689_100035294 Ga0070689_1000352942 261
13 3300005458 Ga0070681_10443883 Ga0070681_104438831 261
14 3300005530 Ga0070679_100040735 Ga0070679_1000407355 261
15 3300005563 Ga0068855_100057494 Ga0068855_1000574945 261
16 3300009545 Ga0105237_10022554 Ga0105237_100225542 261
17 3300010375 Ga0105239_10399257 Ga0105239_103992572 261
18 3300013102 Ga0157371_10109963 Ga0157371_101099632 261
19 3300013104 Ga0157370_10067560 Ga0157370_100675602 261
20 3300013296 Ga0157374_10031504 Ga0157374_100315042 261
21 3300013297 Ga0157378_10333837 Ga0157378_103338372 261
22 3300020069 Ga0197907_11116098 Ga0197907_111160982 261
23 3300020070 Ga0206356_10470479 Ga0206356_104704794 261
24 3300020078 Ga0206352_10213290 Ga0206352_102132903 261
25 3300020081 Ga0206354_11072404 Ga0206354_110724042 261
26 3300020082 Ga0206353_10644318 Ga0206353_106443183 261
27 3300022467 Ga0224712_10020294 Ga0224712_100202942 261
28 3300025909 Ga0207705_10012687 Ga0207705_100126872 261
29 3300025912 Ga0207707_10005776 Ga0207707_100057767 261
30 3300025917 Ga0207660_10136918 Ga0207660_101369182 261
31 3300025921 Ga0207652_10008280 Ga0207652_100082805 261
32 3300025925 Ga0207650_10237360 Ga0207650_102373601 261
33 3300025944 Ga0207661_10003061 Ga0207661_100030616 261
34 3300048912 Ga0496109_0408684 Ga0496109_0408684_221_1273 261
35 iso_pu_bacteria 2904162308 2904164413 261
36 3300005328 Ga0070676_10172296 Ga0070676_101722961 262
37 3300009176 Ga0105242_10065649 Ga0105242_100656493 262
38 3300013105 Ga0157369_10037287 Ga0157369_100372875 262
39 3300014968 Ga0157379_10096108 Ga0157379_100961082 262
40 3300025939 Ga0207665_10179183 Ga0207665_101791831 262
41 3300025949 Ga0207667_10069993 Ga0207667_100699934 262
42 3300009551 Ga0105238_10016034 Ga0105238_100160345 263
43 3300026095 Ga0207676_10356391 Ga0207676_103563912 263
44 3300026116 Ga0207674_10182311 Ga0207674_101823112 263
45 3300048911 Ga0496108_0219608 Ga0496108_0219608_61_1131 263
46 3300003316 rootH1_10005399 rootH1_100053995 264
47 3300004801 Ga0058860_10007270 Ga0058860_100072702 264
48 3300005341 Ga0070691_10096972 Ga0070691_100969722 264
49 3300005347 Ga0070668_100224828 Ga0070668_1002248282 264
50 3300005356 Ga0070674_100216626 Ga0070674_1002166262 264
51 3300005435 Ga0070714_100150427 Ga0070714_1001504272 264
52 3300005616 Ga0068852_100148607 Ga0068852_1001486072 264
53 3300009093 Ga0105240_10260179 Ga0105240_102601792 264
54 3300009098 Ga0105245_10165598 Ga0105245_101655982 264
55 3300009177 Ga0105248_10067649 Ga0105248_100676493 264
56 3300013307 Ga0157372_10049996 Ga0157372_100499962 264
57 3300020080 Ga0206350_11337958 Ga0206350_113379582 264
58 3300025919 Ga0207657_10007118 Ga0207657_100071188 264
59 3300025927 Ga0207687_10149200 Ga0207687_101492002 264
60 3300025928 Ga0207700_10096587 Ga0207700_100965872 264
61 3300025929 Ga0207664_10141666 Ga0207664_101416662 264
62 3300026041 Ga0207639_10151723 Ga0207639_101517232 264
63 3300026075 Ga0207708_10018267 Ga0207708_100182674 264
64 3300026118 Ga0207675_100008111 Ga0207675_1000081113 264
65 3300026142 Ga0207698_10185244 Ga0207698_101852442 264
66 3300059478 Ga0587093_002460 Ga0587093_002460_536_1606 264
67 3300005406 Ga0070703_10012723 Ga0070703_100127233 265
68 3300005444 Ga0070694_100052252 Ga0070694_1000522522 265
69 3300005543 Ga0070672_100270235 Ga0070672_1002702352 265
70 3300009148 Ga0105243_10059367 Ga0105243_100593674 265
71 3300011119 Ga0105246_10031727 Ga0105246_100317272 265
72 3300025918 Ga0207662_10042258 Ga0207662_100422582 265
73 3300025936 Ga0207670_10093224 Ga0207670_100932242 265
74 3300025981 Ga0207640_10044114 Ga0207640_100441143 265
75 3300026088 Ga0207641_10201142 Ga0207641_102011421 265
76 3300046616 Ga0495668_0001082 Ga0495668_0001082_24128_25180 265
77 3300046660 Ga0495625_0001615 Ga0495625_0001615_13380_14432 265
78 3300048091 Ga0495626_0000553 Ga0495626_0000553_24129_25181 265
79 3300048913 Ga0496110_0313171 Ga0496110_0313171_29_1081 265
80 3300048922 Ga0496119_0209997 Ga0496119_0209997_10_813 265
81 3300048924 Ga0496121_0397141 Ga0496121_0397141_40_840 265
82 3300049583 Ga0501067_0099305 Ga0501067_0099305_12_1064 265
83 3300049741 Ga0501079_0255458 Ga0501079_0255458_63_1139 265
84 3300017792 Ga0163161_10052606 Ga0163161_100526061 266
85 3300005719 Ga0068861_100269880 Ga0068861_1002698801 267
86 3300009101 Ga0105247_10086301 Ga0105247_100863011 267
87 3300025940 Ga0207691_10073728 Ga0207691_100737282 267
88 3300048922 Ga0496119_0082380 Ga0496119_0082380_81_887 267
89 3300009553 Ga0105249_10032016 Ga0105249_100320161 268
90 3300025901 Ga0207688_10037218 Ga0207688_100372182 268
91 3300025938 Ga0207704_10041902 Ga0207704_100419022 268
92 3300005578 Ga0068854_100043110 Ga0068854_1000431102 269
93 3300005615 Ga0070702_100271026 Ga0070702_1002710261 269
94 3300006881 Ga0068865_100345979 Ga0068865_1003459791 269
95 3300005445 Ga0070708_100338017 Ga0070708_1003380172 270
96 3300005617 Ga0068859_100317951 Ga0068859_1003179511 270
97 3300006358 Ga0068871_100295069 Ga0068871_1002950692 270
98 3300006931 Ga0097620_100317948 Ga0097620_1003179481 270
99 3300044901 Ga0466960_0005139 Ga0466960_0005139_50_1102 270
100 3300005718 Ga0068866_10189763 Ga0068866_101897631 272
101 3300049578 Ga0501042_0176690 Ga0501042_0176690_14_1090 275
102 3300025933 Ga0207706_10047456 Ga0207706_100474562 276
103 3300048925 Ga0496122_0084000 Ga0496122_0084000_1326_2195 277
104 3300049587 Ga0501071_0042605 Ga0501071_0042605_766_1842 277
105 3300048921 Ga0496118_0020678 Ga0496118_0020678_67_921 283
106 3300048919 Ga0496116_0027084 Ga0496116_0027084_2232_3212 284
107 3300048920 Ga0496117_0056537 Ga0496117_0056537_860_1840 284
108 3300048922 Ga0496119_0000453 Ga0496119_0000453_7924_8904 284
109 3300048923 Ga0496120_0000516 Ga0496120_0000516_50942_51922 284
110 3300048925 Ga0496122_0013933 Ga0496122_0013933_1704_2684 284
111 3300048925 Ga0496122_0025226 Ga0496122_0025226_1172_2152 284
112 3300048927 Ga0496124_0000242 Ga0496124_0000242_39775_40755 284
113 3300048929 Ga0496126_0000569 Ga0496126_0000569_46340_47320 284
114 3300048929 Ga0496126_0010895 Ga0496126_0010895_104_1084 284
115 3300003751 Ga0055538_1001509 Ga0055538_10015093 285
116 3300048919 Ga0496116_0084619 Ga0496116_0084619_547_1407 286
117 3300048924 Ga0496121_0068761 Ga0496121_0068761_143_1003 286
118 3300048925 Ga0496122_0178174 Ga0496122_0178174_175_1038 286
119 3300048926 Ga0496123_0207652 Ga0496123_0207652_117_980 286
120 3300037312 Ga0395899_0049781 Ga0395899_0049781_1733_2608 290
121 iso_pu_bacteria 8057473075 8057473535 293
122 iso_pu_bacteria 8057473075 8057475985 293
123 3300048919 Ga0496116_0021585 Ga0496116_0021585_352_1251 295
124 3300048927 Ga0496124_0032822 Ga0496124_0032822_2341_3240 295
125 iso_pu_bacteria 2671180694 2673817278 295
126 iso_pu_bacteria 2818991459 2819675186 296
127 iso_pu_bacteria 2857453340 2857459516 296
128 iso_pu_bacteria 2593339198 2595318506 297
129 iso_pu_bacteria 2857453340 2857454583 297
130 iso_pu_bacteria 2971410472 2971410970 297
131 iso_pu_bacteria 8056533031 8056540434 297
132 3300041406 Ga0439439_0002073 Ga0439439_0002073_2533_3435 298
133 3300041999 Ga0439433_0025340 Ga0439433_0025340_267_1169 298
134 3300042007 Ga0439449_0002172 Ga0439449_0002172_4265_5167 298
135 3300042015 Ga0439462_0019410 Ga0439462_0019410_739_1641 298
136 3300003187 JGI25151J46595_10052168 JGI25151J46595_100521682 299
137 3300003761 Ga0055535_1005258 Ga0055535_10052582 299
138 3300003841 Ga0055541_1002344 Ga0055541_10023444 299
139 3300025225 Ga0209566_100147 Ga0209566_10014763 299
140 3300025225 Ga0209566_100377 Ga0209566_10037726 299
141 3300025242 Ga0209258_106940 Ga0209258_1069403 299
142 3300025294 Ga0209025_1045421 Ga0209025_10454213 299
143 3300025294 Ga0209025_1076607 Ga0209025_10766072 299
144 3300048925 Ga0496122_0000028 Ga0496122_0000028_217505_218410 300
145 3300048926 Ga0496123_0011099 Ga0496123_0011099_221_1126 300
146 3300048929 Ga0496126_0000002 Ga0496126_0000002_128785_129690 300
147 3300046665 Ga0495661_0054522 Ga0495661_0054522_914_1909 301
148 iso_pu_bacteria 2971410472 2971413055 301
149 3300013102 Ga0157371_10018598 Ga0157371_100185981 302
150 iso_pu_bacteria 2818991459 2819671082 303
151 iso_pu_bacteria 2904755435 2904755897 303
152 3300048925 Ga0496122_0000040 Ga0496122_0000040_50146_51081 304
153 3300048926 Ga0496123_0005476 Ga0496123_0005476_11572_12507 304
154 3300048929 Ga0496126_0000210 Ga0496126_0000210_50146_51081 304
155 iso_pu_bacteria 2907202186 2907204377 304
156 3300009036 Ga0105244_10004161 Ga0105244_100041612 306
157 3300011119 Ga0105246_10000948 Ga0105246_100009487 306
158 3300048919 Ga0496116_0005684 Ga0496116_0005684_7085_8050 306
159 3300048927 Ga0496124_0022856 Ga0496124_0022856_2748_3713 306
160 iso_pu_bacteria 2593339198 2595315128 306
161 3300009036 Ga0105244_10010943 Ga0105244_100109433 307
162 3300025233 Ga0209437_100325 Ga0209437_10032534 307
163 3300025728 Ga0207655_1030517 Ga0207655_10305172 307
164 3300048924 Ga0496121_0096724 Ga0496121_0096724_473_1438 307
165 iso_pu_bacteria 2548877040 2550901340 307
166 iso_pu_bacteria 2548877040 2550903427 307
167 iso_pu_bacteria 2548877040 2550904229 307
168 iso_pu_bacteria 2571042143 2571528073 307
169 iso_pu_bacteria 2571042143 2571529051 307
170 iso_pu_bacteria 2571042143 2571529400 307
171 iso_pu_bacteria 2571042143 2571533316 307
172 iso_pu_bacteria 2728368933 2728533324 307
173 iso_pu_bacteria 2728368933 2728533891 307
174 iso_pu_bacteria 2728368933 2728534499 307
175 iso_pu_bacteria 2728368933 2728534855 307
176 iso_pu_bacteria 2857472729 2857474073 307
177 iso_pu_bacteria 2885526491 2885528685 307
178 iso_pu_bacteria 2904113452 2904116839 307
179 iso_pu_bacteria 2904113452 2904118792 307
180 iso_pu_bacteria 2904162308 2904164233 307
181 iso_pu_bacteria 2907202186 2907203706 307
182 iso_pu_bacteria 2925326138 2925331296 307
183 iso_pu_bacteria 2938649242 2938649346 307
184 iso_pu_bacteria 2938649242 2938649945 307
185 iso_pu_bacteria 2938649242 2938650056 307
186 iso_pu_bacteria 2968558590 2968562558 307
187 iso_pu_bacteria 2968558590 2968563951 307
188 iso_pu_bacteria 2968558590 2968564869 307
189 iso_pu_bacteria 2971403814 2971408148 307
190 iso_pu_bacteria 2971403814 2971408509 307
191 iso_pu_bacteria 2988225383 2988231148 307
192 iso_pu_bacteria 2988225383 2988231500 307
193 iso_pu_bacteria 2996632988 2996633589 307
194 iso_pu_bacteria 2996632988 2996635785 307
195 iso_pu_bacteria 2996632988 2996635896 307
196 iso_pu_bacteria 8002317523 8002324041 307
197 iso_pu_bacteria 8054465665 8054468350 307
198 iso_pu_bacteria 8054465665 8054469917 307
199 iso_pu_bacteria 8057473075 8057475044 307
200 3300009011 Ga0105251_10072204 Ga0105251_100722041 308
201 3300009036 Ga0105244_10020230 Ga0105244_100202302 308
202 3300009036 Ga0105244_10037448 Ga0105244_100374481 308
203 3300025728 Ga0207655_1014473 Ga0207655_10144733 308
204 3300048919 Ga0496116_0033687 Ga0496116_0033687_1031_2005 308
205 3300048928 Ga0496125_0012334 Ga0496125_0012334_2242_3216 308
206 iso_pu_bacteria 2512564039 2512732256 308
207 3300025225 Ga0209566_100139 Ga0209566_1001394 309
208 3300025233 Ga0209437_100807 Ga0209437_1008078 309
209 3300048925 Ga0496122_0010328 Ga0496122_0010328_6397_7350 309
210 iso_pu_bacteria 2889049205 2889053593 309
211 3300025224 Ga0209784_100149 Ga0209784_10014926 310
212 3300025291 Ga0209675_1002015 Ga0209675_10020152 310
213 3300025294 Ga0209025_1001311 Ga0209025_100131113 310
214 3300048919 Ga0496116_0000687 Ga0496116_0000687_36225_37160 310
215 3300048919 Ga0496116_0013028 Ga0496116_0013028_1968_2903 310
216 3300048919 Ga0496116_0013583 Ga0496116_0013583_1296_2231 310
217 3300048919 Ga0496116_0049693 Ga0496116_0049693_1367_2329 310
218 3300048919 Ga0496116_0074588 Ga0496116_0074588_167_1144 310
219 3300048920 Ga0496117_0000150 Ga0496117_0000150_102423_103358 310
220 3300048920 Ga0496117_0000161 Ga0496117_0000161_3254_4189 310
221 3300048921 Ga0496118_0029028 Ga0496118_0029028_1143_2078 310
222 3300048922 Ga0496119_0000042 Ga0496119_0000042_108200_109135 310
223 3300048922 Ga0496119_0000088 Ga0496119_0000088_19963_20898 310
224 3300048922 Ga0496119_0004952 Ga0496119_0004952_3268_4203 310
225 3300048922 Ga0496119_0011450 Ga0496119_0011450_131_1066 310
226 3300048922 Ga0496119_0040429 Ga0496119_0040429_1774_2709 310
227 3300048923 Ga0496120_0000006 Ga0496120_0000006_110790_111725 310
228 3300048923 Ga0496120_0000083 Ga0496120_0000083_112269_113204 310
229 3300048923 Ga0496120_0001003 Ga0496120_0001003_12023_12958 310
230 3300048923 Ga0496120_0002475 Ga0496120_0002475_937_1872 310
231 3300048923 Ga0496120_0003342 Ga0496120_0003342_461_1396 310
232 3300048923 Ga0496120_0006795 Ga0496120_0006795_2277_3212 310
233 3300048923 Ga0496120_0058392 Ga0496120_0058392_1216_2151 310
234 3300048925 Ga0496122_0000824 Ga0496122_0000824_50818_51753 310
235 3300048925 Ga0496122_0002120 Ga0496122_0002120_21055_21990 310
236 3300048925 Ga0496122_0004419 Ga0496122_0004419_648_1601 310
237 3300048926 Ga0496123_0000399 Ga0496123_0000399_71110_72045 310
238 3300048926 Ga0496123_0000640 Ga0496123_0000640_50423_51358 310
239 3300048927 Ga0496124_0085164 Ga0496124_0085164_50_985 310
240 3300048928 Ga0496125_0000010 Ga0496125_0000010_277934_278869 310
241 3300048928 Ga0496125_0000010 Ga0496125_0000010_592708_593643 310
242 3300048929 Ga0496126_0000401 Ga0496126_0000401_85611_86546 310
243 3300048929 Ga0496126_0002294 Ga0496126_0002294_3955_4890 310
244 3300048929 Ga0496126_0039278 Ga0496126_0039278_1679_2614 310
245 3300048929 Ga0496126_0114147 Ga0496126_0114147_1131_2066 310
246 iso_pu_bacteria 2984527788 2984531208 310
247 iso_pu_bacteria 2984532647 2984537318 310
248 3300042007 Ga0439449_0028319 Ga0439449_0028319_899_1855 311
249 3300044712 Ga0453684_0005962 Ga0453684_0005962_9793_10734 311
250 3300048091 Ga0495626_0018501 Ga0495626_0018501_2391_3347 311
251 3300048925 Ga0496122_0001304 Ga0496122_0001304_33510_34466 311
252 3300049661 Ga0501217_000806 Ga0501217_000806_1794_2765 311
253 iso_pu_bacteria 8002317523 8002323307 311
254 3300003751 Ga0055538_1000259 Ga0055538_100025915 312
255 3300025224 Ga0209784_100117 Ga0209784_10011736 312
256 3300044693 Ga0466961_0102024 Ga0466961_0102024_600_1559 312
257 3300044735 Ga0466968_0016256 Ga0466968_0016256_493_1452 312
258 3300045049 Ga0466959_0071093 Ga0466959_0071093_291_1250 312
259 3300049661 Ga0501217_004886 Ga0501217_004886_968_1927 312
260 3300049775 Ga0501279_002325 Ga0501279_002325_718_1677 312
261 iso_pu_bacteria 2512564039 2512733262 312
262 iso_pu_bacteria 2643221543 2643740421 312
263 iso_pu_bacteria 2864733723 2864736930 312
264 iso_pu_bacteria 2884994152 2884995269 312
265 iso_pu_bacteria 2889042446 2889045585 312
266 iso_pu_bacteria 2889049205 2889054210 312
267 iso_pu_bacteria 2904490793 2904492459 312
268 iso_pu_bacteria 2919160200 2919161684 312
269 iso_pu_bacteria 2931384279 2931389018 312
270 iso_pu_bacteria 2939679117 2939679290 312
271 iso_pu_bacteria 2945991243 2945992406 312
272 iso_pu_bacteria 2946053406 2946055156 312
273 3300044656 Ga0466969_0001502 Ga0466969_0001502_5059_6021 313
274 3300044684 Ga0466966_0036242 Ga0466966_0036242_1100_2062 313
275 3300044735 Ga0466968_0013378 Ga0466968_0013378_349_1311 313
276 3300045049 Ga0466959_0002475 Ga0466959_0002475_5273_6235 313
277 3300048925 Ga0496122_0000040 Ga0496122_0000040_12224_13168 313
278 3300048925 Ga0496122_0073327 Ga0496122_0073327_572_1546 313
279 3300048926 Ga0496123_0003253 Ga0496123_0003253_12223_13167 313
280 3300048929 Ga0496126_0000210 Ga0496126_0000210_12224_13168 313
281 iso_pu_bacteria 2818991441 2819566928 313
282 iso_pu_bacteria 2512564039 2512730865 315
283 iso_pu_bacteria 2548877040 2550905886 315
284 iso_pu_bacteria 2571042143 2571526931 315
285 iso_pu_bacteria 2600255286 2601641242 315
286 iso_pu_bacteria 2643221676 2644426217 315
287 iso_pu_bacteria 2728368933 2728531369 315
288 iso_pu_bacteria 2857453340 2857456399 315
289 iso_pu_bacteria 2864733723 2864737095 315
290 iso_pu_bacteria 2889042446 2889043347 315
291 iso_pu_bacteria 2904490793 2904496353 315
292 iso_pu_bacteria 2904755435 2904758034 315
293 iso_pu_bacteria 2919160200 2919165986 315
294 iso_pu_bacteria 2931384279 2931386806 315
295 iso_pu_bacteria 2938649242 2938652237 315
296 iso_pu_bacteria 2939679117 2939683283 315
297 iso_pu_bacteria 2945991243 2945994594 315
298 iso_pu_bacteria 2946053406 2946057391 315
299 iso_pu_bacteria 2968558590 2968564466 315
300 iso_pu_bacteria 2984527788 2984531063 315
301 iso_pu_bacteria 2984532647 2984537172 315
302 iso_pu_bacteria 2988225383 2988229620 315
303 iso_pu_bacteria 2996632988 2996635240 315
304 iso_pu_bacteria 8054465665 8054471016 315
305 iso_pu_bacteria 8056533031 8056538768 315
306 3300025225 Ga0209566_100041 Ga0209566_1000413 316
307 3300048924 Ga0496121_0108097 Ga0496121_0108097_154_1140 316
308 3300048925 Ga0496122_0000325 Ga0496122_0000325_34284_35237 316
309 3300048929 Ga0496126_0000742 Ga0496126_0000742_16787_17740 316
310 iso_pu_bacteria 2791355222 2793183680 316
311 iso_pu_bacteria 2964375228 2964376043 316
312 iso_pu_bacteria 2585428059 2587739502 317
313 iso_pu_bacteria 2600255286 2601640883 317
314 iso_pu_bacteria 2938649242 2938650561 317
315 iso_pu_bacteria 2968558590 2968559910 317
316 iso_pu_bacteria 2988225383 2988231418 317
317 iso_pu_bacteria 2996632988 2996633872 317
318 3300006946 Ga0079104_1002340 Ga0079104_10023404 318
319 3300027111 Ga0209281_1003383 Ga0209281_10033835 318
320 3300048919 Ga0496116_0009798 Ga0496116_0009798_852_1823 318
321 3300048919 Ga0496116_0010716 Ga0496116_0010716_1859_2821 318
322 3300048920 Ga0496117_0047712 Ga0496117_0047712_1357_2328 318
323 3300048922 Ga0496119_0000702 Ga0496119_0000702_36229_37200 318
324 3300048923 Ga0496120_0000089 Ga0496120_0000089_111596_112567 318
325 3300048925 Ga0496122_0000035 Ga0496122_0000035_41782_42744 318
326 3300048925 Ga0496122_0013837 Ga0496122_0013837_5250_6221 318
327 3300048925 Ga0496122_0054015 Ga0496122_0054015_1286_2257 318
328 3300048926 Ga0496123_0007260 Ga0496123_0007260_496_1458 318
329 3300048926 Ga0496123_0025586 Ga0496123_0025586_2261_3232 318
330 3300048927 Ga0496124_0001287 Ga0496124_0001287_24114_25085 318
331 3300048928 Ga0496125_0179503 Ga0496125_0179503_294_1265 318
332 3300048929 Ga0496126_0000205 Ga0496126_0000205_91149_92111 318
333 3300048929 Ga0496126_0001306 Ga0496126_0001306_36519_37490 318
334 3300048929 Ga0496126_0019979 Ga0496126_0019979_4212_5183 318
335 iso_pu_bacteria 2585428059 2587742634 318
336 iso_pu_bacteria 2643221676 2644421940 318
337 3300048920 Ga0496117_0022587 Ga0496117_0022587_2970_3944 319
338 3300048922 Ga0496119_0000369 Ga0496119_0000369_52286_53260 319
339 3300048923 Ga0496120_0000368 Ga0496120_0000368_8629_9603 319
340 3300048925 Ga0496122_0011539 Ga0496122_0011539_2405_3379 319
341 3300048926 Ga0496123_0041106 Ga0496123_0041106_1233_2207 319
342 3300048927 Ga0496124_0000527 Ga0496124_0000527_62202_63176 319
343 3300048929 Ga0496126_0000481 Ga0496126_0000481_68638_69612 319
344 3300048929 Ga0496126_0003339 Ga0496126_0003339_13339_14313 319
345 3300059640 Ga0587067_000358 Ga0587067_000358_1804_2778 319
346 iso_pu_bacteria 2548877040 2550899873 319
347 iso_pu_bacteria 2571042143 2571530764 319
348 iso_pu_bacteria 2643221543 2643735782 319
349 iso_pu_bacteria 2728368933 2728534363 319
350 iso_pu_bacteria 2864733723 2864734840 319
351 iso_pu_bacteria 2889042446 2889045606 319
352 iso_pu_bacteria 2904490793 2904492478 319
353 iso_pu_bacteria 2919160200 2919161700 319
354 iso_pu_bacteria 2931384279 2931389040 319
355 iso_pu_bacteria 2939679117 2939681913 319
356 iso_pu_bacteria 2945991243 2945992389 319
357 iso_pu_bacteria 2946053406 2946055141 319
358 iso_pu_bacteria 2971403814 2971406856 319
359 iso_pu_bacteria 8054465665 8054470019 319
360 3300041999 Ga0439433_0007158 Ga0439433_0007158_706_1683 320
361 3300042007 Ga0439449_0018328 Ga0439449_0018328_28_1005 320
362 3300048919 Ga0496116_0004053 Ga0496116_0004053_8626_9597 320
363 3300048925 Ga0496122_0040140 Ga0496122_0040140_1813_2784 320
364 3300048926 Ga0496123_0047866 Ga0496123_0047866_1657_2628 320
365 3300048927 Ga0496124_0005031 Ga0496124_0005031_13518_14489 320
366 3300048928 Ga0496125_0001240 Ga0496125_0001240_13750_14721 320
367 3300031995 Ga0307409_100064288 Ga0307409_1000642882 322
368 3300032002 Ga0307416_100146241 Ga0307416_1001462412 322
369 3300002737 JGI25162J39368_1009611 JGI25162J39368_10096112 323
370 3300009036 Ga0105244_10010454 Ga0105244_100104542 323
371 3300011119 Ga0105246_10023185 Ga0105246_100231852 323
372 3300025233 Ga0209437_100325 Ga0209437_10032521 323
373 3300025728 Ga0207655_1030957 Ga0207655_10309572 323
374 3300044693 Ga0466961_0090182 Ga0466961_0090182_651_1754 323
375 3300044735 Ga0466968_0006397 Ga0466968_0006397_3176_4279 323
376 3300045049 Ga0466959_0004766 Ga0466959_0004766_7254_8357 323
377 3300046810 Ga0495660_0012482 Ga0495660_0012482_2125_3105 323
378 3300048919 Ga0496116_0002448 Ga0496116_0002448_11813_12784 323
379 3300048919 Ga0496116_0035960 Ga0496116_0035960_1554_2597 323
380 3300048924 Ga0496121_0109338 Ga0496121_0109338_459_1430 323
381 iso_pu_bacteria 2821111986 2821112639 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

148

363

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xtc-assembly1.cif.gz_M crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein 0.9465 26 322
4tqv-assembly4.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9441 24 316
4xtc-assembly1.cif.gz_M crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein 0.9338 26 322
4tqv-assembly4.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9282 24 316
4tqu-assembly1.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9276 24 316
ID Description Score Start End Superfamily
4tquM01 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9581 75 316 1.10.3720.10
4tquM01 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9392 75 316 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.904 74 316 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9033 74 318 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8929 74 318 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A8A7KK91-F1-model_v4 ABC transporter permease subunit 0.9937 39 323 GO:0005886
GO:0055085
AF-W4C1H3-F1-model_v4 deleted 0.9906 60 323
AF-A0A3P3UBD7-F1-model_v4 Sugar ABC transporter permease 0.9897 60 323 GO:0005886
GO:0055085
AF-A0A329M653-F1-model_v4 Sugar ABC transporter permease 0.9889 39 323 GO:0005886
GO:0055085
AF-A0A5C1QH93-F1-model_v4 Sugar ABC transporter permease 0.9887 31 323 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
86.49 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map