F429028
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 381 | 189 | 260 | 305 |
Family's Representative Sequence
| Representative Sequence | 3300044693|Ga0466961_0090182|Ga0466961_0090182_651_1754 |
| Length | 367 |
| Sequence | VADQKLGQRQLNYGNDELRKAPANVACFPQLPLKPLPHGRQEEWAMAGAPEIMQSNRSAAAAVTKASVYKRMLGQKQLMLMSLPVLVYVVIFSYYPIWGWTMAFQNYVPGKPFSQQQWVGFKQFKFLFSDDTFLNVLRNTIAMSFINMVSGFVTAIVFAILLNEIKSRLYKRAIQTISYLPHFLSWIIVTGIVANTLSVDNGIVNVLLMKLGLIQEPIMWLSVPKYFWGIVAASHVWKEVGWNAIIYLAAITSIDPSLYEAAEIDGANRYQKMLYVTLPGIKSIVIILLIMNLGWILEAGFEVQYLLGNGVVVDWSQTIDIFVLKYGLQVGNYSLATAAGIFKTTVSIVLIFAANTIAKRFGEDRLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 2 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 3 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 4 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 5 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 6 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 7 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 8 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 9 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 10 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 11 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 12 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 13 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 14 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 15 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 16 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 17 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 18 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 19 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 20 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 21 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 22 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 23 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 24 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 25 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 26 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 27 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 28 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 29 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 30 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 31 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 32 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 33 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 34 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 35 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 36 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 37 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 38 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 39 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 40 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 41 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 42 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 43 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 44 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 45 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 48 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 49 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 50 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 51 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 142 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 145 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 146 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 147 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 148 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 149 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 153 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 154 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 155 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 156 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 166 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 167 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 168 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 169 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 170 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 171 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 172 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 173 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 174 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 175 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 176 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 181 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 183 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 187 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 188 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 189 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 66.14 |
| Metatranscriptomes | 3.15 |
| Isolates | 30.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.05 |
| Bulb | 0 |
| Endosphere | 5.25 |
| Nodule | 0.52 |
| Rhizoplane | 1.57 |
| Rhizosphere | 52.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 38.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1009611 | 3300002737 | Bacteria | 1280 |
| 2 | JGI25151J46595_10052168 | 3300003187 | Bacteria | 1378 |
| 3 | rootH1_10005399 | 3300003316 | Bacteria | 4284 |
| 4 | Ga0055538_1000259 | 3300003751 | Bacteria | 28019 |
| 5 | Ga0055538_1001509 | 3300003751 | Bacteria | 4376 |
| 6 | Ga0055535_1005258 | 3300003761 | Bacteria | 2889 |
| 7 | Ga0055541_1002344 | 3300003841 | Bacteria | 3810 |
| 8 | Ga0058863_10021277 | 3300004799 | Bacteria | 2847 |
| 9 | Ga0058861_10115392 | 3300004800 | Bacteria | 1546 |
| 10 | Ga0058860_10007270 | 3300004801 | Bacteria | 2415 |
| 11 | Ga0070676_10172296 | 3300005328 | Bacteria | 1401 |
| 12 | Ga0070683_100055849 | 3300005329 | Bacteria | 3665 |
| 13 | Ga0070680_100113231 | 3300005336 | Bacteria | 2259 |
| 14 | Ga0070682_100055022 | 3300005337 | Bacteria | 2498 |
| 15 | Ga0070660_100189089 | 3300005339 | Bacteria | 1667 |
| 16 | Ga0070689_100035294 | 3300005340 | Bacteria | 3820 |
| 17 | Ga0070691_10096972 | 3300005341 | Bacteria | 1460 |
| 18 | Ga0070668_100224828 | 3300005347 | Bacteria | 1549 |
| 19 | Ga0070674_100216626 | 3300005356 | Bacteria | 1487 |
| 20 | Ga0070703_10012723 | 3300005406 | Bacteria | 2384 |
| 21 | Ga0070709_10042002 | 3300005434 | Bacteria | 2821 |
| 22 | Ga0070714_100150427 | 3300005435 | Bacteria | 2097 |
| 23 | Ga0070694_100052252 | 3300005444 | Bacteria | 2761 |
| 24 | Ga0070708_100338017 | 3300005445 | Bacteria | 1419 |
| 25 | Ga0070681_10443883 | 3300005458 | Bacteria | 1209 |
| 26 | Ga0070679_100040735 | 3300005530 | Bacteria | 4621 |
| 27 | Ga0070672_100270235 | 3300005543 | Bacteria | 1435 |
| 28 | Ga0068855_100057494 | 3300005563 | Bacteria | 4559 |
| 29 | Ga0068854_100043110 | 3300005578 | Bacteria | 3196 |
| 30 | Ga0070702_100271026 | 3300005615 | Bacteria | 1161 |
| 31 | Ga0068852_100148607 | 3300005616 | Bacteria | 2176 |
| 32 | Ga0068859_100317951 | 3300005617 | Bacteria | 1650 |
| 33 | Ga0068866_10189763 | 3300005718 | Bacteria | 1220 |
| 34 | Ga0068861_100269880 | 3300005719 | Bacteria | 1460 |
| 35 | Ga0070716_100082079 | 3300006173 | Bacteria | 1927 |
| 36 | Ga0068871_100295069 | 3300006358 | Bacteria | 1422 |
| 37 | Ga0068865_100345979 | 3300006881 | Bacteria | 1203 |
| 38 | Ga0097620_100317948 | 3300006931 | Bacteria | 1650 |
| 39 | Ga0079104_1002340 | 3300006946 | Bacteria | 10411 |
| 40 | Ga0105251_10072204 | 3300009011 | Bacteria | 1605 |
| 41 | Ga0105244_10004161 | 3300009036 | Bacteria | 10071 |
| 42 | Ga0105244_10010454 | 3300009036 | Bacteria | 5628 |
| 43 | Ga0105244_10010943 | 3300009036 | Bacteria | 5471 |
| 44 | Ga0105244_10020230 | 3300009036 | Bacteria | 3700 |
| 45 | Ga0105244_10037448 | 3300009036 | Bacteria | 2535 |
| 46 | Ga0105240_10260179 | 3300009093 | Bacteria | 2002 |
| 47 | Ga0105245_10165598 | 3300009098 | Bacteria | 2101 |
| 48 | Ga0105247_10086301 | 3300009101 | Bacteria | 1986 |
| 49 | Ga0105243_10059367 | 3300009148 | Bacteria | 3052 |
| 50 | Ga0105242_10065649 | 3300009176 | Bacteria | 2994 |
| 51 | Ga0105248_10067649 | 3300009177 | Bacteria | 4011 |
| 52 | Ga0105237_10022554 | 3300009545 | Bacteria | 6459 |
| 53 | Ga0105238_10016034 | 3300009551 | Bacteria | 7578 |
| 54 | Ga0105249_10032016 | 3300009553 | Bacteria | 4756 |
| 55 | Ga0105239_10399257 | 3300010375 | Bacteria | 1556 |
| 56 | Ga0105246_10000948 | 3300011119 | Bacteria | 16588 |
| 57 | Ga0105246_10023185 | 3300011119 | Bacteria | 4014 |
| 58 | Ga0105246_10031727 | 3300011119 | Bacteria | 3498 |
| 59 | Ga0157371_10018598 | 3300013102 | Bacteria | 5133 |
| 60 | Ga0157371_10109963 | 3300013102 | Bacteria | 1956 |
| 61 | Ga0157370_10067560 | 3300013104 | Bacteria | 3379 |
| 62 | Ga0157369_10037287 | 3300013105 | Bacteria | 5322 |
| 63 | Ga0157374_10031504 | 3300013296 | Bacteria | 4820 |
| 64 | Ga0157378_10333837 | 3300013297 | Bacteria | 1476 |
| 65 | Ga0157372_10049996 | 3300013307 | Bacteria | 4651 |
| 66 | Ga0157379_10096108 | 3300014968 | Bacteria | 2659 |
| 67 | Ga0163161_10052606 | 3300017792 | Bacteria | 2952 |
| 68 | Ga0197907_11116098 | 3300020069 | Bacteria | 2256 |
| 69 | Ga0206356_10470479 | 3300020070 | Bacteria | 4041 |
| 70 | Ga0206352_10213290 | 3300020078 | Bacteria | 2944 |
| 71 | Ga0206350_11337958 | 3300020080 | Bacteria | 2231 |
| 72 | Ga0206354_11072404 | 3300020081 | Bacteria | 3735 |
| 73 | Ga0206353_10644318 | 3300020082 | Bacteria | 3603 |
| 74 | Ga0224712_10020294 | 3300022467 | Bacteria | 2253 |
| 75 | Ga0209784_100117 | 3300025224 | Bacteria | 85907 |
| 76 | Ga0209784_100149 | 3300025224 | Bacteria | 63832 |
| 77 | Ga0209566_100041 | 3300025225 | Bacteria | 289634 |
| 78 | Ga0209566_100139 | 3300025225 | Bacteria | 89273 |
| 79 | Ga0209566_100147 | 3300025225 | Bacteria | 82642 |
| 80 | Ga0209566_100377 | 3300025225 | Bacteria | 36595 |
| 81 | Ga0209437_100325 | 3300025233 | Bacteria | 60773 |
| 82 | Ga0209437_100807 | 3300025233 | Bacteria | 14215 |
| 83 | Ga0209258_106940 | 3300025242 | Bacteria | 1720 |
| 84 | Ga0209675_1002015 | 3300025291 | Bacteria | 10881 |
| 85 | Ga0209025_1001311 | 3300025294 | Bacteria | 33888 |
| 86 | Ga0209025_1045421 | 3300025294 | Bacteria | 1821 |
| 87 | Ga0209025_1076607 | 3300025294 | Bacteria | 1158 |
| 88 | Ga0207655_1014473 | 3300025728 | Bacteria | 4456 |
| 89 | Ga0207655_1030517 | 3300025728 | Bacteria | 2505 |
| 90 | Ga0207655_1030957 | 3300025728 | Bacteria | 2477 |
| 91 | Ga0207688_10037218 | 3300025901 | Bacteria | 2698 |
| 92 | Ga0207705_10012687 | 3300025909 | Bacteria | 6081 |
| 93 | Ga0207707_10005776 | 3300025912 | Bacteria | 10818 |
| 94 | Ga0207660_10136918 | 3300025917 | Bacteria | 1869 |
| 95 | Ga0207662_10042258 | 3300025918 | Bacteria | 2686 |
| 96 | Ga0207657_10007118 | 3300025919 | Bacteria | 11486 |
| 97 | Ga0207652_10008280 | 3300025921 | Bacteria | 8360 |
| 98 | Ga0207650_10237360 | 3300025925 | Bacteria | 1472 |
| 99 | Ga0207687_10149200 | 3300025927 | Bacteria | 1782 |
| 100 | Ga0207700_10096587 | 3300025928 | Bacteria | 2346 |
| 101 | Ga0207664_10141666 | 3300025929 | Bacteria | 2035 |
| 102 | Ga0207706_10047456 | 3300025933 | Bacteria | 3799 |
| 103 | Ga0207670_10093224 | 3300025936 | Bacteria | 2133 |
| 104 | Ga0207704_10041902 | 3300025938 | Bacteria | 2690 |
| 105 | Ga0207665_10179183 | 3300025939 | Bacteria | 1534 |
| 106 | Ga0207691_10073728 | 3300025940 | Bacteria | 3079 |
| 107 | Ga0207661_10003061 | 3300025944 | Bacteria | 11578 |
| 108 | Ga0207667_10069993 | 3300025949 | Bacteria | 3652 |
| 109 | Ga0207640_10044114 | 3300025981 | Bacteria | 2855 |
| 110 | Ga0207639_10151723 | 3300026041 | Bacteria | 1941 |
| 111 | Ga0207708_10018267 | 3300026075 | Bacteria | 5279 |
| 112 | Ga0207641_10201142 | 3300026088 | Bacteria | 1837 |
| 113 | Ga0207676_10356391 | 3300026095 | Bacteria | 1354 |
| 114 | Ga0207674_10182311 | 3300026116 | Bacteria | 2051 |
| 115 | Ga0207675_100008111 | 3300026118 | Bacteria | 9896 |
| 116 | Ga0207698_10185244 | 3300026142 | Bacteria | 1848 |
| 117 | Ga0209281_1003383 | 3300027111 | Bacteria | 5316 |
| 118 | Ga0307409_100064288 | 3300031995 | Bacteria | 2882 |
| 119 | Ga0307416_100146241 | 3300032002 | Bacteria | 2158 |
| 120 | Ga0395899_0049781 | 3300037312 | Bacteria | 3113 |
| 121 | Ga0439439_0002073 | 3300041406 | Bacteria | 4179 |
| 122 | Ga0439433_0007158 | 3300041999 | Bacteria | 2408 |
| 123 | Ga0439433_0025340 | 3300041999 | Bacteria | 1339 |
| 124 | Ga0439449_0002172 | 3300042007 | Bacteria | 7709 |
| 125 | Ga0439449_0018328 | 3300042007 | Bacteria | 2627 |
| 126 | Ga0439449_0028319 | 3300042007 | Bacteria | 2088 |
| 127 | Ga0439462_0019410 | 3300042015 | Bacteria | 1769 |
| 128 | Ga0466969_0001502 | 3300044656 | Bacteria | 12538 |
| 129 | Ga0466966_0036242 | 3300044684 | Bacteria | 3186 |
| 130 | Ga0466961_0090182 | 3300044693 | Bacteria | 1936 |
| 131 | Ga0466961_0102024 | 3300044693 | Bacteria | 1807 |
| 132 | Ga0453684_0005962 | 3300044712 | Bacteria | 23627 |
| 133 | Ga0466968_0006397 | 3300044735 | Bacteria | 4440 |
| 134 | Ga0466968_0013378 | 3300044735 | Bacteria | 3226 |
| 135 | Ga0466968_0016256 | 3300044735 | Bacteria | 2961 |
| 136 | Ga0466960_0005139 | 3300044901 | Bacteria | 5179 |
| 137 | Ga0466959_0002475 | 3300045049 | Bacteria | 11824 |
| 138 | Ga0466959_0004766 | 3300045049 | Bacteria | 9144 |
| 139 | Ga0466959_0071093 | 3300045049 | Bacteria | 2520 |
| 140 | Ga0495668_0001082 | 3300046616 | Bacteria | 28417 |
| 141 | Ga0495625_0001615 | 3300046660 | Bacteria | 26589 |
| 142 | Ga0495661_0054522 | 3300046665 | Bacteria | 2400 |
| 143 | Ga0495660_0012482 | 3300046810 | Bacteria | 4932 |
| 144 | Ga0495626_0000553 | 3300048091 | Bacteria | 37152 |
| 145 | Ga0495626_0018501 | 3300048091 | Bacteria | 3498 |
| 146 | Ga0496101_0216722 | 3300048904 | Bacteria | 1485 |
| 147 | Ga0496108_0219608 | 3300048911 | Bacteria | 1651 |
| 148 | Ga0496109_0408684 | 3300048912 | Bacteria | 1283 |
| 149 | Ga0496110_0313171 | 3300048913 | Bacteria | 1429 |
| 150 | Ga0496116_0000687 | 3300048919 | Bacteria | 43932 |
| 151 | Ga0496116_0002448 | 3300048919 | Bacteria | 19483 |
| 152 | Ga0496116_0004053 | 3300048919 | Bacteria | 14161 |
| 153 | Ga0496116_0005684 | 3300048919 | Bacteria | 11476 |
| 154 | Ga0496116_0009798 | 3300048919 | Bacteria | 8123 |
| 155 | Ga0496116_0010716 | 3300048919 | Bacteria | 7653 |
| 156 | Ga0496116_0013028 | 3300048919 | Bacteria | 6744 |
| 157 | Ga0496116_0013583 | 3300048919 | Bacteria | 6550 |
| 158 | Ga0496116_0021585 | 3300048919 | Bacteria | 4850 |
| 159 | Ga0496116_0027084 | 3300048919 | Bacteria | 4177 |
| 160 | Ga0496116_0033687 | 3300048919 | Bacteria | 3629 |
| 161 | Ga0496116_0035960 | 3300048919 | Bacteria | 3474 |
| 162 | Ga0496116_0049693 | 3300048919 | Bacteria | 2801 |
| 163 | Ga0496116_0074588 | 3300048919 | Bacteria | 2133 |
| 164 | Ga0496116_0084619 | 3300048919 | Bacteria | 1953 |
| 165 | Ga0496117_0000150 | 3300048920 | Bacteria | 148465 |
| 166 | Ga0496117_0000161 | 3300048920 | Bacteria | 141379 |
| 167 | Ga0496117_0022587 | 3300048920 | Bacteria | 5041 |
| 168 | Ga0496117_0047712 | 3300048920 | Bacteria | 3068 |
| 169 | Ga0496117_0056537 | 3300048920 | Bacteria | 2732 |
| 170 | Ga0496118_0020678 | 3300048921 | Bacteria | 5828 |
| 171 | Ga0496118_0029028 | 3300048921 | Bacteria | 4646 |
| 172 | Ga0496119_0000042 | 3300048922 | Bacteria | 200701 |
| 173 | Ga0496119_0000088 | 3300048922 | Bacteria | 135581 |
| 174 | Ga0496119_0000369 | 3300048922 | Bacteria | 62502 |
| 175 | Ga0496119_0000453 | 3300048922 | Bacteria | 56116 |
| 176 | Ga0496119_0000702 | 3300048922 | Bacteria | 44864 |
| 177 | Ga0496119_0004952 | 3300048922 | Bacteria | 13017 |
| 178 | Ga0496119_0011450 | 3300048922 | Bacteria | 7342 |
| 179 | Ga0496119_0040429 | 3300048922 | Bacteria | 2982 |
| 180 | Ga0496119_0082380 | 3300048922 | Bacteria | 1850 |
| 181 | Ga0496119_0209997 | 3300048922 | Bacteria | 1002 |
| 182 | Ga0496120_0000006 | 3300048923 | Bacteria | 445068 |
| 183 | Ga0496120_0000083 | 3300048923 | Bacteria | 157876 |
| 184 | Ga0496120_0000089 | 3300048923 | Bacteria | 151805 |
| 185 | Ga0496120_0000368 | 3300048923 | Bacteria | 73340 |
| 186 | Ga0496120_0000516 | 3300048923 | Bacteria | 59973 |
| 187 | Ga0496120_0001003 | 3300048923 | Bacteria | 38112 |
| 188 | Ga0496120_0002475 | 3300048923 | Bacteria | 18598 |
| 189 | Ga0496120_0003342 | 3300048923 | Bacteria | 14731 |
| 190 | Ga0496120_0006795 | 3300048923 | Bacteria | 8672 |
| 191 | Ga0496120_0058392 | 3300048923 | Bacteria | 2167 |
| 192 | Ga0496121_0068761 | 3300048924 | Bacteria | 2863 |
| 193 | Ga0496121_0096724 | 3300048924 | Bacteria | 2290 |
| 194 | Ga0496121_0108097 | 3300048924 | Bacteria | 2128 |
| 195 | Ga0496121_0109338 | 3300048924 | Bacteria | 2113 |
| 196 | Ga0496121_0397141 | 3300048924 | Bacteria | 904 |
| 197 | Ga0496122_0000028 | 3300048925 | Bacteria | 347194 |
| 198 | Ga0496122_0000035 | 3300048925 | Bacteria | 318098 |
| 199 | Ga0496122_0000040 | 3300048925 | Bacteria | 285095 |
| 200 | Ga0496122_0000325 | 3300048925 | Bacteria | 103742 |
| 201 | Ga0496122_0000824 | 3300048925 | Bacteria | 59275 |
| 202 | Ga0496122_0001304 | 3300048925 | Bacteria | 41137 |
| 203 | Ga0496122_0002120 | 3300048925 | Bacteria | 29206 |
| 204 | Ga0496122_0004419 | 3300048925 | Bacteria | 17493 |
| 205 | Ga0496122_0010328 | 3300048925 | Bacteria | 9654 |
| 206 | Ga0496122_0011539 | 3300048925 | Bacteria | 8934 |
| 207 | Ga0496122_0013837 | 3300048925 | Bacteria | 7856 |
| 208 | Ga0496122_0013933 | 3300048925 | Bacteria | 7819 |
| 209 | Ga0496122_0025226 | 3300048925 | Bacteria | 5171 |
| 210 | Ga0496122_0040140 | 3300048925 | Bacteria | 3724 |
| 211 | Ga0496122_0054015 | 3300048925 | Bacteria | 3022 |
| 212 | Ga0496122_0073327 | 3300048925 | Bacteria | 2428 |
| 213 | Ga0496122_0084000 | 3300048925 | Bacteria | 2205 |
| 214 | Ga0496122_0178174 | 3300048925 | Bacteria | 1272 |
| 215 | Ga0496123_0000399 | 3300048926 | Bacteria | 80610 |
| 216 | Ga0496123_0000640 | 3300048926 | Bacteria | 58520 |
| 217 | Ga0496123_0003253 | 3300048926 | Bacteria | 18456 |
| 218 | Ga0496123_0005476 | 3300048926 | Bacteria | 12771 |
| 219 | Ga0496123_0007260 | 3300048926 | Bacteria | 10515 |
| 220 | Ga0496123_0011099 | 3300048926 | Bacteria | 7857 |
| 221 | Ga0496123_0025586 | 3300048926 | Bacteria | 4446 |
| 222 | Ga0496123_0041106 | 3300048926 | Bacteria | 3210 |
| 223 | Ga0496123_0047866 | 3300048926 | Bacteria | 2883 |
| 224 | Ga0496123_0207652 | 3300048926 | Bacteria | 998 |
| 225 | Ga0496124_0000242 | 3300048927 | Bacteria | 105814 |
| 226 | Ga0496124_0000527 | 3300048927 | Bacteria | 65126 |
| 227 | Ga0496124_0001287 | 3300048927 | Bacteria | 38093 |
| 228 | Ga0496124_0005031 | 3300048927 | Bacteria | 15110 |
| 229 | Ga0496124_0022856 | 3300048927 | Bacteria | 5725 |
| 230 | Ga0496124_0032822 | 3300048927 | Bacteria | 4579 |
| 231 | Ga0496124_0085164 | 3300048927 | Bacteria | 2591 |
| 232 | Ga0496125_0000010 | 3300048928 | Bacteria | 671167 |
| 233 | Ga0496125_0001240 | 3300048928 | Bacteria | 38181 |
| 234 | Ga0496125_0012334 | 3300048928 | Bacteria | 8491 |
| 235 | Ga0496125_0179503 | 3300048928 | Bacteria | 1413 |
| 236 | Ga0496126_0000002 | 3300048929 | Bacteria | 1001703 |
| 237 | Ga0496126_0000205 | 3300048929 | Bacteria | 132210 |
| 238 | Ga0496126_0000210 | 3300048929 | Bacteria | 131214 |
| 239 | Ga0496126_0000401 | 3300048929 | Bacteria | 88294 |
| 240 | Ga0496126_0000481 | 3300048929 | Bacteria | 79161 |
| 241 | Ga0496126_0000569 | 3300048929 | Bacteria | 70647 |
| 242 | Ga0496126_0000742 | 3300048929 | Bacteria | 59052 |
| 243 | Ga0496126_0001306 | 3300048929 | Bacteria | 39713 |
| 244 | Ga0496126_0002294 | 3300048929 | Bacteria | 26361 |
| 245 | Ga0496126_0003339 | 3300048929 | Bacteria | 20399 |
| 246 | Ga0496126_0010895 | 3300048929 | Bacteria | 9472 |
| 247 | Ga0496126_0019979 | 3300048929 | Bacteria | 6581 |
| 248 | Ga0496126_0039278 | 3300048929 | Bacteria | 4392 |
| 249 | Ga0496126_0114147 | 3300048929 | Bacteria | 2350 |
| 250 | Ga0501040_0099317 | 3300049576 | Bacteria | 2029 |
| 251 | Ga0501042_0176690 | 3300049578 | Bacteria | 1540 |
| 252 | Ga0501067_0099305 | 3300049583 | Bacteria | 1617 |
| 253 | Ga0501071_0042605 | 3300049587 | Bacteria | 3254 |
| 254 | Ga0501217_000806 | 3300049661 | Bacteria | 5471 |
| 255 | Ga0501217_004886 | 3300049661 | Bacteria | 2777 |
| 256 | Ga0501079_0255458 | 3300049741 | Bacteria | 1370 |
| 257 | Ga0501279_002325 | 3300049775 | Bacteria | 2497 |
| 258 | Ga0501084_0064617 | 3300054114 | Bacteria | 3062 |
| 259 | Ga0587093_002460 | 3300059478 | Bacteria | 1725 |
| 260 | Ga0587067_000358 | 3300059640 | Bacteria | 3818 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300054114 | Ga0501084_0064617 | Ga0501084_0064617_110_1015 | 252 |
| 2 | 3300049576 | Ga0501040_0099317 | Ga0501040_0099317_33_938 | 253 |
| 3 | 3300048904 | Ga0496101_0216722 | Ga0496101_0216722_475_1419 | 258 |
| 4 | 3300006173 | Ga0070716_100082079 | Ga0070716_1000820792 | 259 |
| 5 | 3300005434 | Ga0070709_10042002 | Ga0070709_100420022 | 260 |
| 6 | 3300004799 | Ga0058863_10021277 | Ga0058863_100212773 | 261 |
| 7 | 3300004800 | Ga0058861_10115392 | Ga0058861_101153922 | 261 |
| 8 | 3300005329 | Ga0070683_100055849 | Ga0070683_1000558494 | 261 |
| 9 | 3300005336 | Ga0070680_100113231 | Ga0070680_1001132312 | 261 |
| 10 | 3300005337 | Ga0070682_100055022 | Ga0070682_1000550222 | 261 |
| 11 | 3300005339 | Ga0070660_100189089 | Ga0070660_1001890892 | 261 |
| 12 | 3300005340 | Ga0070689_100035294 | Ga0070689_1000352942 | 261 |
| 13 | 3300005458 | Ga0070681_10443883 | Ga0070681_104438831 | 261 |
| 14 | 3300005530 | Ga0070679_100040735 | Ga0070679_1000407355 | 261 |
| 15 | 3300005563 | Ga0068855_100057494 | Ga0068855_1000574945 | 261 |
| 16 | 3300009545 | Ga0105237_10022554 | Ga0105237_100225542 | 261 |
| 17 | 3300010375 | Ga0105239_10399257 | Ga0105239_103992572 | 261 |
| 18 | 3300013102 | Ga0157371_10109963 | Ga0157371_101099632 | 261 |
| 19 | 3300013104 | Ga0157370_10067560 | Ga0157370_100675602 | 261 |
| 20 | 3300013296 | Ga0157374_10031504 | Ga0157374_100315042 | 261 |
| 21 | 3300013297 | Ga0157378_10333837 | Ga0157378_103338372 | 261 |
| 22 | 3300020069 | Ga0197907_11116098 | Ga0197907_111160982 | 261 |
| 23 | 3300020070 | Ga0206356_10470479 | Ga0206356_104704794 | 261 |
| 24 | 3300020078 | Ga0206352_10213290 | Ga0206352_102132903 | 261 |
| 25 | 3300020081 | Ga0206354_11072404 | Ga0206354_110724042 | 261 |
| 26 | 3300020082 | Ga0206353_10644318 | Ga0206353_106443183 | 261 |
| 27 | 3300022467 | Ga0224712_10020294 | Ga0224712_100202942 | 261 |
| 28 | 3300025909 | Ga0207705_10012687 | Ga0207705_100126872 | 261 |
| 29 | 3300025912 | Ga0207707_10005776 | Ga0207707_100057767 | 261 |
| 30 | 3300025917 | Ga0207660_10136918 | Ga0207660_101369182 | 261 |
| 31 | 3300025921 | Ga0207652_10008280 | Ga0207652_100082805 | 261 |
| 32 | 3300025925 | Ga0207650_10237360 | Ga0207650_102373601 | 261 |
| 33 | 3300025944 | Ga0207661_10003061 | Ga0207661_100030616 | 261 |
| 34 | 3300048912 | Ga0496109_0408684 | Ga0496109_0408684_221_1273 | 261 |
| 35 | iso_pu_bacteria | 2904162308 | 2904164413 | 261 |
| 36 | 3300005328 | Ga0070676_10172296 | Ga0070676_101722961 | 262 |
| 37 | 3300009176 | Ga0105242_10065649 | Ga0105242_100656493 | 262 |
| 38 | 3300013105 | Ga0157369_10037287 | Ga0157369_100372875 | 262 |
| 39 | 3300014968 | Ga0157379_10096108 | Ga0157379_100961082 | 262 |
| 40 | 3300025939 | Ga0207665_10179183 | Ga0207665_101791831 | 262 |
| 41 | 3300025949 | Ga0207667_10069993 | Ga0207667_100699934 | 262 |
| 42 | 3300009551 | Ga0105238_10016034 | Ga0105238_100160345 | 263 |
| 43 | 3300026095 | Ga0207676_10356391 | Ga0207676_103563912 | 263 |
| 44 | 3300026116 | Ga0207674_10182311 | Ga0207674_101823112 | 263 |
| 45 | 3300048911 | Ga0496108_0219608 | Ga0496108_0219608_61_1131 | 263 |
| 46 | 3300003316 | rootH1_10005399 | rootH1_100053995 | 264 |
| 47 | 3300004801 | Ga0058860_10007270 | Ga0058860_100072702 | 264 |
| 48 | 3300005341 | Ga0070691_10096972 | Ga0070691_100969722 | 264 |
| 49 | 3300005347 | Ga0070668_100224828 | Ga0070668_1002248282 | 264 |
| 50 | 3300005356 | Ga0070674_100216626 | Ga0070674_1002166262 | 264 |
| 51 | 3300005435 | Ga0070714_100150427 | Ga0070714_1001504272 | 264 |
| 52 | 3300005616 | Ga0068852_100148607 | Ga0068852_1001486072 | 264 |
| 53 | 3300009093 | Ga0105240_10260179 | Ga0105240_102601792 | 264 |
| 54 | 3300009098 | Ga0105245_10165598 | Ga0105245_101655982 | 264 |
| 55 | 3300009177 | Ga0105248_10067649 | Ga0105248_100676493 | 264 |
| 56 | 3300013307 | Ga0157372_10049996 | Ga0157372_100499962 | 264 |
| 57 | 3300020080 | Ga0206350_11337958 | Ga0206350_113379582 | 264 |
| 58 | 3300025919 | Ga0207657_10007118 | Ga0207657_100071188 | 264 |
| 59 | 3300025927 | Ga0207687_10149200 | Ga0207687_101492002 | 264 |
| 60 | 3300025928 | Ga0207700_10096587 | Ga0207700_100965872 | 264 |
| 61 | 3300025929 | Ga0207664_10141666 | Ga0207664_101416662 | 264 |
| 62 | 3300026041 | Ga0207639_10151723 | Ga0207639_101517232 | 264 |
| 63 | 3300026075 | Ga0207708_10018267 | Ga0207708_100182674 | 264 |
| 64 | 3300026118 | Ga0207675_100008111 | Ga0207675_1000081113 | 264 |
| 65 | 3300026142 | Ga0207698_10185244 | Ga0207698_101852442 | 264 |
| 66 | 3300059478 | Ga0587093_002460 | Ga0587093_002460_536_1606 | 264 |
| 67 | 3300005406 | Ga0070703_10012723 | Ga0070703_100127233 | 265 |
| 68 | 3300005444 | Ga0070694_100052252 | Ga0070694_1000522522 | 265 |
| 69 | 3300005543 | Ga0070672_100270235 | Ga0070672_1002702352 | 265 |
| 70 | 3300009148 | Ga0105243_10059367 | Ga0105243_100593674 | 265 |
| 71 | 3300011119 | Ga0105246_10031727 | Ga0105246_100317272 | 265 |
| 72 | 3300025918 | Ga0207662_10042258 | Ga0207662_100422582 | 265 |
| 73 | 3300025936 | Ga0207670_10093224 | Ga0207670_100932242 | 265 |
| 74 | 3300025981 | Ga0207640_10044114 | Ga0207640_100441143 | 265 |
| 75 | 3300026088 | Ga0207641_10201142 | Ga0207641_102011421 | 265 |
| 76 | 3300046616 | Ga0495668_0001082 | Ga0495668_0001082_24128_25180 | 265 |
| 77 | 3300046660 | Ga0495625_0001615 | Ga0495625_0001615_13380_14432 | 265 |
| 78 | 3300048091 | Ga0495626_0000553 | Ga0495626_0000553_24129_25181 | 265 |
| 79 | 3300048913 | Ga0496110_0313171 | Ga0496110_0313171_29_1081 | 265 |
| 80 | 3300048922 | Ga0496119_0209997 | Ga0496119_0209997_10_813 | 265 |
| 81 | 3300048924 | Ga0496121_0397141 | Ga0496121_0397141_40_840 | 265 |
| 82 | 3300049583 | Ga0501067_0099305 | Ga0501067_0099305_12_1064 | 265 |
| 83 | 3300049741 | Ga0501079_0255458 | Ga0501079_0255458_63_1139 | 265 |
| 84 | 3300017792 | Ga0163161_10052606 | Ga0163161_100526061 | 266 |
| 85 | 3300005719 | Ga0068861_100269880 | Ga0068861_1002698801 | 267 |
| 86 | 3300009101 | Ga0105247_10086301 | Ga0105247_100863011 | 267 |
| 87 | 3300025940 | Ga0207691_10073728 | Ga0207691_100737282 | 267 |
| 88 | 3300048922 | Ga0496119_0082380 | Ga0496119_0082380_81_887 | 267 |
| 89 | 3300009553 | Ga0105249_10032016 | Ga0105249_100320161 | 268 |
| 90 | 3300025901 | Ga0207688_10037218 | Ga0207688_100372182 | 268 |
| 91 | 3300025938 | Ga0207704_10041902 | Ga0207704_100419022 | 268 |
| 92 | 3300005578 | Ga0068854_100043110 | Ga0068854_1000431102 | 269 |
| 93 | 3300005615 | Ga0070702_100271026 | Ga0070702_1002710261 | 269 |
| 94 | 3300006881 | Ga0068865_100345979 | Ga0068865_1003459791 | 269 |
| 95 | 3300005445 | Ga0070708_100338017 | Ga0070708_1003380172 | 270 |
| 96 | 3300005617 | Ga0068859_100317951 | Ga0068859_1003179511 | 270 |
| 97 | 3300006358 | Ga0068871_100295069 | Ga0068871_1002950692 | 270 |
| 98 | 3300006931 | Ga0097620_100317948 | Ga0097620_1003179481 | 270 |
| 99 | 3300044901 | Ga0466960_0005139 | Ga0466960_0005139_50_1102 | 270 |
| 100 | 3300005718 | Ga0068866_10189763 | Ga0068866_101897631 | 272 |
| 101 | 3300049578 | Ga0501042_0176690 | Ga0501042_0176690_14_1090 | 275 |
| 102 | 3300025933 | Ga0207706_10047456 | Ga0207706_100474562 | 276 |
| 103 | 3300048925 | Ga0496122_0084000 | Ga0496122_0084000_1326_2195 | 277 |
| 104 | 3300049587 | Ga0501071_0042605 | Ga0501071_0042605_766_1842 | 277 |
| 105 | 3300048921 | Ga0496118_0020678 | Ga0496118_0020678_67_921 | 283 |
| 106 | 3300048919 | Ga0496116_0027084 | Ga0496116_0027084_2232_3212 | 284 |
| 107 | 3300048920 | Ga0496117_0056537 | Ga0496117_0056537_860_1840 | 284 |
| 108 | 3300048922 | Ga0496119_0000453 | Ga0496119_0000453_7924_8904 | 284 |
| 109 | 3300048923 | Ga0496120_0000516 | Ga0496120_0000516_50942_51922 | 284 |
| 110 | 3300048925 | Ga0496122_0013933 | Ga0496122_0013933_1704_2684 | 284 |
| 111 | 3300048925 | Ga0496122_0025226 | Ga0496122_0025226_1172_2152 | 284 |
| 112 | 3300048927 | Ga0496124_0000242 | Ga0496124_0000242_39775_40755 | 284 |
| 113 | 3300048929 | Ga0496126_0000569 | Ga0496126_0000569_46340_47320 | 284 |
| 114 | 3300048929 | Ga0496126_0010895 | Ga0496126_0010895_104_1084 | 284 |
| 115 | 3300003751 | Ga0055538_1001509 | Ga0055538_10015093 | 285 |
| 116 | 3300048919 | Ga0496116_0084619 | Ga0496116_0084619_547_1407 | 286 |
| 117 | 3300048924 | Ga0496121_0068761 | Ga0496121_0068761_143_1003 | 286 |
| 118 | 3300048925 | Ga0496122_0178174 | Ga0496122_0178174_175_1038 | 286 |
| 119 | 3300048926 | Ga0496123_0207652 | Ga0496123_0207652_117_980 | 286 |
| 120 | 3300037312 | Ga0395899_0049781 | Ga0395899_0049781_1733_2608 | 290 |
| 121 | iso_pu_bacteria | 8057473075 | 8057473535 | 293 |
| 122 | iso_pu_bacteria | 8057473075 | 8057475985 | 293 |
| 123 | 3300048919 | Ga0496116_0021585 | Ga0496116_0021585_352_1251 | 295 |
| 124 | 3300048927 | Ga0496124_0032822 | Ga0496124_0032822_2341_3240 | 295 |
| 125 | iso_pu_bacteria | 2671180694 | 2673817278 | 295 |
| 126 | iso_pu_bacteria | 2818991459 | 2819675186 | 296 |
| 127 | iso_pu_bacteria | 2857453340 | 2857459516 | 296 |
| 128 | iso_pu_bacteria | 2593339198 | 2595318506 | 297 |
| 129 | iso_pu_bacteria | 2857453340 | 2857454583 | 297 |
| 130 | iso_pu_bacteria | 2971410472 | 2971410970 | 297 |
| 131 | iso_pu_bacteria | 8056533031 | 8056540434 | 297 |
| 132 | 3300041406 | Ga0439439_0002073 | Ga0439439_0002073_2533_3435 | 298 |
| 133 | 3300041999 | Ga0439433_0025340 | Ga0439433_0025340_267_1169 | 298 |
| 134 | 3300042007 | Ga0439449_0002172 | Ga0439449_0002172_4265_5167 | 298 |
| 135 | 3300042015 | Ga0439462_0019410 | Ga0439462_0019410_739_1641 | 298 |
| 136 | 3300003187 | JGI25151J46595_10052168 | JGI25151J46595_100521682 | 299 |
| 137 | 3300003761 | Ga0055535_1005258 | Ga0055535_10052582 | 299 |
| 138 | 3300003841 | Ga0055541_1002344 | Ga0055541_10023444 | 299 |
| 139 | 3300025225 | Ga0209566_100147 | Ga0209566_10014763 | 299 |
| 140 | 3300025225 | Ga0209566_100377 | Ga0209566_10037726 | 299 |
| 141 | 3300025242 | Ga0209258_106940 | Ga0209258_1069403 | 299 |
| 142 | 3300025294 | Ga0209025_1045421 | Ga0209025_10454213 | 299 |
| 143 | 3300025294 | Ga0209025_1076607 | Ga0209025_10766072 | 299 |
| 144 | 3300048925 | Ga0496122_0000028 | Ga0496122_0000028_217505_218410 | 300 |
| 145 | 3300048926 | Ga0496123_0011099 | Ga0496123_0011099_221_1126 | 300 |
| 146 | 3300048929 | Ga0496126_0000002 | Ga0496126_0000002_128785_129690 | 300 |
| 147 | 3300046665 | Ga0495661_0054522 | Ga0495661_0054522_914_1909 | 301 |
| 148 | iso_pu_bacteria | 2971410472 | 2971413055 | 301 |
| 149 | 3300013102 | Ga0157371_10018598 | Ga0157371_100185981 | 302 |
| 150 | iso_pu_bacteria | 2818991459 | 2819671082 | 303 |
| 151 | iso_pu_bacteria | 2904755435 | 2904755897 | 303 |
| 152 | 3300048925 | Ga0496122_0000040 | Ga0496122_0000040_50146_51081 | 304 |
| 153 | 3300048926 | Ga0496123_0005476 | Ga0496123_0005476_11572_12507 | 304 |
| 154 | 3300048929 | Ga0496126_0000210 | Ga0496126_0000210_50146_51081 | 304 |
| 155 | iso_pu_bacteria | 2907202186 | 2907204377 | 304 |
| 156 | 3300009036 | Ga0105244_10004161 | Ga0105244_100041612 | 306 |
| 157 | 3300011119 | Ga0105246_10000948 | Ga0105246_100009487 | 306 |
| 158 | 3300048919 | Ga0496116_0005684 | Ga0496116_0005684_7085_8050 | 306 |
| 159 | 3300048927 | Ga0496124_0022856 | Ga0496124_0022856_2748_3713 | 306 |
| 160 | iso_pu_bacteria | 2593339198 | 2595315128 | 306 |
| 161 | 3300009036 | Ga0105244_10010943 | Ga0105244_100109433 | 307 |
| 162 | 3300025233 | Ga0209437_100325 | Ga0209437_10032534 | 307 |
| 163 | 3300025728 | Ga0207655_1030517 | Ga0207655_10305172 | 307 |
| 164 | 3300048924 | Ga0496121_0096724 | Ga0496121_0096724_473_1438 | 307 |
| 165 | iso_pu_bacteria | 2548877040 | 2550901340 | 307 |
| 166 | iso_pu_bacteria | 2548877040 | 2550903427 | 307 |
| 167 | iso_pu_bacteria | 2548877040 | 2550904229 | 307 |
| 168 | iso_pu_bacteria | 2571042143 | 2571528073 | 307 |
| 169 | iso_pu_bacteria | 2571042143 | 2571529051 | 307 |
| 170 | iso_pu_bacteria | 2571042143 | 2571529400 | 307 |
| 171 | iso_pu_bacteria | 2571042143 | 2571533316 | 307 |
| 172 | iso_pu_bacteria | 2728368933 | 2728533324 | 307 |
| 173 | iso_pu_bacteria | 2728368933 | 2728533891 | 307 |
| 174 | iso_pu_bacteria | 2728368933 | 2728534499 | 307 |
| 175 | iso_pu_bacteria | 2728368933 | 2728534855 | 307 |
| 176 | iso_pu_bacteria | 2857472729 | 2857474073 | 307 |
| 177 | iso_pu_bacteria | 2885526491 | 2885528685 | 307 |
| 178 | iso_pu_bacteria | 2904113452 | 2904116839 | 307 |
| 179 | iso_pu_bacteria | 2904113452 | 2904118792 | 307 |
| 180 | iso_pu_bacteria | 2904162308 | 2904164233 | 307 |
| 181 | iso_pu_bacteria | 2907202186 | 2907203706 | 307 |
| 182 | iso_pu_bacteria | 2925326138 | 2925331296 | 307 |
| 183 | iso_pu_bacteria | 2938649242 | 2938649346 | 307 |
| 184 | iso_pu_bacteria | 2938649242 | 2938649945 | 307 |
| 185 | iso_pu_bacteria | 2938649242 | 2938650056 | 307 |
| 186 | iso_pu_bacteria | 2968558590 | 2968562558 | 307 |
| 187 | iso_pu_bacteria | 2968558590 | 2968563951 | 307 |
| 188 | iso_pu_bacteria | 2968558590 | 2968564869 | 307 |
| 189 | iso_pu_bacteria | 2971403814 | 2971408148 | 307 |
| 190 | iso_pu_bacteria | 2971403814 | 2971408509 | 307 |
| 191 | iso_pu_bacteria | 2988225383 | 2988231148 | 307 |
| 192 | iso_pu_bacteria | 2988225383 | 2988231500 | 307 |
| 193 | iso_pu_bacteria | 2996632988 | 2996633589 | 307 |
| 194 | iso_pu_bacteria | 2996632988 | 2996635785 | 307 |
| 195 | iso_pu_bacteria | 2996632988 | 2996635896 | 307 |
| 196 | iso_pu_bacteria | 8002317523 | 8002324041 | 307 |
| 197 | iso_pu_bacteria | 8054465665 | 8054468350 | 307 |
| 198 | iso_pu_bacteria | 8054465665 | 8054469917 | 307 |
| 199 | iso_pu_bacteria | 8057473075 | 8057475044 | 307 |
| 200 | 3300009011 | Ga0105251_10072204 | Ga0105251_100722041 | 308 |
| 201 | 3300009036 | Ga0105244_10020230 | Ga0105244_100202302 | 308 |
| 202 | 3300009036 | Ga0105244_10037448 | Ga0105244_100374481 | 308 |
| 203 | 3300025728 | Ga0207655_1014473 | Ga0207655_10144733 | 308 |
| 204 | 3300048919 | Ga0496116_0033687 | Ga0496116_0033687_1031_2005 | 308 |
| 205 | 3300048928 | Ga0496125_0012334 | Ga0496125_0012334_2242_3216 | 308 |
| 206 | iso_pu_bacteria | 2512564039 | 2512732256 | 308 |
| 207 | 3300025225 | Ga0209566_100139 | Ga0209566_1001394 | 309 |
| 208 | 3300025233 | Ga0209437_100807 | Ga0209437_1008078 | 309 |
| 209 | 3300048925 | Ga0496122_0010328 | Ga0496122_0010328_6397_7350 | 309 |
| 210 | iso_pu_bacteria | 2889049205 | 2889053593 | 309 |
| 211 | 3300025224 | Ga0209784_100149 | Ga0209784_10014926 | 310 |
| 212 | 3300025291 | Ga0209675_1002015 | Ga0209675_10020152 | 310 |
| 213 | 3300025294 | Ga0209025_1001311 | Ga0209025_100131113 | 310 |
| 214 | 3300048919 | Ga0496116_0000687 | Ga0496116_0000687_36225_37160 | 310 |
| 215 | 3300048919 | Ga0496116_0013028 | Ga0496116_0013028_1968_2903 | 310 |
| 216 | 3300048919 | Ga0496116_0013583 | Ga0496116_0013583_1296_2231 | 310 |
| 217 | 3300048919 | Ga0496116_0049693 | Ga0496116_0049693_1367_2329 | 310 |
| 218 | 3300048919 | Ga0496116_0074588 | Ga0496116_0074588_167_1144 | 310 |
| 219 | 3300048920 | Ga0496117_0000150 | Ga0496117_0000150_102423_103358 | 310 |
| 220 | 3300048920 | Ga0496117_0000161 | Ga0496117_0000161_3254_4189 | 310 |
| 221 | 3300048921 | Ga0496118_0029028 | Ga0496118_0029028_1143_2078 | 310 |
| 222 | 3300048922 | Ga0496119_0000042 | Ga0496119_0000042_108200_109135 | 310 |
| 223 | 3300048922 | Ga0496119_0000088 | Ga0496119_0000088_19963_20898 | 310 |
| 224 | 3300048922 | Ga0496119_0004952 | Ga0496119_0004952_3268_4203 | 310 |
| 225 | 3300048922 | Ga0496119_0011450 | Ga0496119_0011450_131_1066 | 310 |
| 226 | 3300048922 | Ga0496119_0040429 | Ga0496119_0040429_1774_2709 | 310 |
| 227 | 3300048923 | Ga0496120_0000006 | Ga0496120_0000006_110790_111725 | 310 |
| 228 | 3300048923 | Ga0496120_0000083 | Ga0496120_0000083_112269_113204 | 310 |
| 229 | 3300048923 | Ga0496120_0001003 | Ga0496120_0001003_12023_12958 | 310 |
| 230 | 3300048923 | Ga0496120_0002475 | Ga0496120_0002475_937_1872 | 310 |
| 231 | 3300048923 | Ga0496120_0003342 | Ga0496120_0003342_461_1396 | 310 |
| 232 | 3300048923 | Ga0496120_0006795 | Ga0496120_0006795_2277_3212 | 310 |
| 233 | 3300048923 | Ga0496120_0058392 | Ga0496120_0058392_1216_2151 | 310 |
| 234 | 3300048925 | Ga0496122_0000824 | Ga0496122_0000824_50818_51753 | 310 |
| 235 | 3300048925 | Ga0496122_0002120 | Ga0496122_0002120_21055_21990 | 310 |
| 236 | 3300048925 | Ga0496122_0004419 | Ga0496122_0004419_648_1601 | 310 |
| 237 | 3300048926 | Ga0496123_0000399 | Ga0496123_0000399_71110_72045 | 310 |
| 238 | 3300048926 | Ga0496123_0000640 | Ga0496123_0000640_50423_51358 | 310 |
| 239 | 3300048927 | Ga0496124_0085164 | Ga0496124_0085164_50_985 | 310 |
| 240 | 3300048928 | Ga0496125_0000010 | Ga0496125_0000010_277934_278869 | 310 |
| 241 | 3300048928 | Ga0496125_0000010 | Ga0496125_0000010_592708_593643 | 310 |
| 242 | 3300048929 | Ga0496126_0000401 | Ga0496126_0000401_85611_86546 | 310 |
| 243 | 3300048929 | Ga0496126_0002294 | Ga0496126_0002294_3955_4890 | 310 |
| 244 | 3300048929 | Ga0496126_0039278 | Ga0496126_0039278_1679_2614 | 310 |
| 245 | 3300048929 | Ga0496126_0114147 | Ga0496126_0114147_1131_2066 | 310 |
| 246 | iso_pu_bacteria | 2984527788 | 2984531208 | 310 |
| 247 | iso_pu_bacteria | 2984532647 | 2984537318 | 310 |
| 248 | 3300042007 | Ga0439449_0028319 | Ga0439449_0028319_899_1855 | 311 |
| 249 | 3300044712 | Ga0453684_0005962 | Ga0453684_0005962_9793_10734 | 311 |
| 250 | 3300048091 | Ga0495626_0018501 | Ga0495626_0018501_2391_3347 | 311 |
| 251 | 3300048925 | Ga0496122_0001304 | Ga0496122_0001304_33510_34466 | 311 |
| 252 | 3300049661 | Ga0501217_000806 | Ga0501217_000806_1794_2765 | 311 |
| 253 | iso_pu_bacteria | 8002317523 | 8002323307 | 311 |
| 254 | 3300003751 | Ga0055538_1000259 | Ga0055538_100025915 | 312 |
| 255 | 3300025224 | Ga0209784_100117 | Ga0209784_10011736 | 312 |
| 256 | 3300044693 | Ga0466961_0102024 | Ga0466961_0102024_600_1559 | 312 |
| 257 | 3300044735 | Ga0466968_0016256 | Ga0466968_0016256_493_1452 | 312 |
| 258 | 3300045049 | Ga0466959_0071093 | Ga0466959_0071093_291_1250 | 312 |
| 259 | 3300049661 | Ga0501217_004886 | Ga0501217_004886_968_1927 | 312 |
| 260 | 3300049775 | Ga0501279_002325 | Ga0501279_002325_718_1677 | 312 |
| 261 | iso_pu_bacteria | 2512564039 | 2512733262 | 312 |
| 262 | iso_pu_bacteria | 2643221543 | 2643740421 | 312 |
| 263 | iso_pu_bacteria | 2864733723 | 2864736930 | 312 |
| 264 | iso_pu_bacteria | 2884994152 | 2884995269 | 312 |
| 265 | iso_pu_bacteria | 2889042446 | 2889045585 | 312 |
| 266 | iso_pu_bacteria | 2889049205 | 2889054210 | 312 |
| 267 | iso_pu_bacteria | 2904490793 | 2904492459 | 312 |
| 268 | iso_pu_bacteria | 2919160200 | 2919161684 | 312 |
| 269 | iso_pu_bacteria | 2931384279 | 2931389018 | 312 |
| 270 | iso_pu_bacteria | 2939679117 | 2939679290 | 312 |
| 271 | iso_pu_bacteria | 2945991243 | 2945992406 | 312 |
| 272 | iso_pu_bacteria | 2946053406 | 2946055156 | 312 |
| 273 | 3300044656 | Ga0466969_0001502 | Ga0466969_0001502_5059_6021 | 313 |
| 274 | 3300044684 | Ga0466966_0036242 | Ga0466966_0036242_1100_2062 | 313 |
| 275 | 3300044735 | Ga0466968_0013378 | Ga0466968_0013378_349_1311 | 313 |
| 276 | 3300045049 | Ga0466959_0002475 | Ga0466959_0002475_5273_6235 | 313 |
| 277 | 3300048925 | Ga0496122_0000040 | Ga0496122_0000040_12224_13168 | 313 |
| 278 | 3300048925 | Ga0496122_0073327 | Ga0496122_0073327_572_1546 | 313 |
| 279 | 3300048926 | Ga0496123_0003253 | Ga0496123_0003253_12223_13167 | 313 |
| 280 | 3300048929 | Ga0496126_0000210 | Ga0496126_0000210_12224_13168 | 313 |
| 281 | iso_pu_bacteria | 2818991441 | 2819566928 | 313 |
| 282 | iso_pu_bacteria | 2512564039 | 2512730865 | 315 |
| 283 | iso_pu_bacteria | 2548877040 | 2550905886 | 315 |
| 284 | iso_pu_bacteria | 2571042143 | 2571526931 | 315 |
| 285 | iso_pu_bacteria | 2600255286 | 2601641242 | 315 |
| 286 | iso_pu_bacteria | 2643221676 | 2644426217 | 315 |
| 287 | iso_pu_bacteria | 2728368933 | 2728531369 | 315 |
| 288 | iso_pu_bacteria | 2857453340 | 2857456399 | 315 |
| 289 | iso_pu_bacteria | 2864733723 | 2864737095 | 315 |
| 290 | iso_pu_bacteria | 2889042446 | 2889043347 | 315 |
| 291 | iso_pu_bacteria | 2904490793 | 2904496353 | 315 |
| 292 | iso_pu_bacteria | 2904755435 | 2904758034 | 315 |
| 293 | iso_pu_bacteria | 2919160200 | 2919165986 | 315 |
| 294 | iso_pu_bacteria | 2931384279 | 2931386806 | 315 |
| 295 | iso_pu_bacteria | 2938649242 | 2938652237 | 315 |
| 296 | iso_pu_bacteria | 2939679117 | 2939683283 | 315 |
| 297 | iso_pu_bacteria | 2945991243 | 2945994594 | 315 |
| 298 | iso_pu_bacteria | 2946053406 | 2946057391 | 315 |
| 299 | iso_pu_bacteria | 2968558590 | 2968564466 | 315 |
| 300 | iso_pu_bacteria | 2984527788 | 2984531063 | 315 |
| 301 | iso_pu_bacteria | 2984532647 | 2984537172 | 315 |
| 302 | iso_pu_bacteria | 2988225383 | 2988229620 | 315 |
| 303 | iso_pu_bacteria | 2996632988 | 2996635240 | 315 |
| 304 | iso_pu_bacteria | 8054465665 | 8054471016 | 315 |
| 305 | iso_pu_bacteria | 8056533031 | 8056538768 | 315 |
| 306 | 3300025225 | Ga0209566_100041 | Ga0209566_1000413 | 316 |
| 307 | 3300048924 | Ga0496121_0108097 | Ga0496121_0108097_154_1140 | 316 |
| 308 | 3300048925 | Ga0496122_0000325 | Ga0496122_0000325_34284_35237 | 316 |
| 309 | 3300048929 | Ga0496126_0000742 | Ga0496126_0000742_16787_17740 | 316 |
| 310 | iso_pu_bacteria | 2791355222 | 2793183680 | 316 |
| 311 | iso_pu_bacteria | 2964375228 | 2964376043 | 316 |
| 312 | iso_pu_bacteria | 2585428059 | 2587739502 | 317 |
| 313 | iso_pu_bacteria | 2600255286 | 2601640883 | 317 |
| 314 | iso_pu_bacteria | 2938649242 | 2938650561 | 317 |
| 315 | iso_pu_bacteria | 2968558590 | 2968559910 | 317 |
| 316 | iso_pu_bacteria | 2988225383 | 2988231418 | 317 |
| 317 | iso_pu_bacteria | 2996632988 | 2996633872 | 317 |
| 318 | 3300006946 | Ga0079104_1002340 | Ga0079104_10023404 | 318 |
| 319 | 3300027111 | Ga0209281_1003383 | Ga0209281_10033835 | 318 |
| 320 | 3300048919 | Ga0496116_0009798 | Ga0496116_0009798_852_1823 | 318 |
| 321 | 3300048919 | Ga0496116_0010716 | Ga0496116_0010716_1859_2821 | 318 |
| 322 | 3300048920 | Ga0496117_0047712 | Ga0496117_0047712_1357_2328 | 318 |
| 323 | 3300048922 | Ga0496119_0000702 | Ga0496119_0000702_36229_37200 | 318 |
| 324 | 3300048923 | Ga0496120_0000089 | Ga0496120_0000089_111596_112567 | 318 |
| 325 | 3300048925 | Ga0496122_0000035 | Ga0496122_0000035_41782_42744 | 318 |
| 326 | 3300048925 | Ga0496122_0013837 | Ga0496122_0013837_5250_6221 | 318 |
| 327 | 3300048925 | Ga0496122_0054015 | Ga0496122_0054015_1286_2257 | 318 |
| 328 | 3300048926 | Ga0496123_0007260 | Ga0496123_0007260_496_1458 | 318 |
| 329 | 3300048926 | Ga0496123_0025586 | Ga0496123_0025586_2261_3232 | 318 |
| 330 | 3300048927 | Ga0496124_0001287 | Ga0496124_0001287_24114_25085 | 318 |
| 331 | 3300048928 | Ga0496125_0179503 | Ga0496125_0179503_294_1265 | 318 |
| 332 | 3300048929 | Ga0496126_0000205 | Ga0496126_0000205_91149_92111 | 318 |
| 333 | 3300048929 | Ga0496126_0001306 | Ga0496126_0001306_36519_37490 | 318 |
| 334 | 3300048929 | Ga0496126_0019979 | Ga0496126_0019979_4212_5183 | 318 |
| 335 | iso_pu_bacteria | 2585428059 | 2587742634 | 318 |
| 336 | iso_pu_bacteria | 2643221676 | 2644421940 | 318 |
| 337 | 3300048920 | Ga0496117_0022587 | Ga0496117_0022587_2970_3944 | 319 |
| 338 | 3300048922 | Ga0496119_0000369 | Ga0496119_0000369_52286_53260 | 319 |
| 339 | 3300048923 | Ga0496120_0000368 | Ga0496120_0000368_8629_9603 | 319 |
| 340 | 3300048925 | Ga0496122_0011539 | Ga0496122_0011539_2405_3379 | 319 |
| 341 | 3300048926 | Ga0496123_0041106 | Ga0496123_0041106_1233_2207 | 319 |
| 342 | 3300048927 | Ga0496124_0000527 | Ga0496124_0000527_62202_63176 | 319 |
| 343 | 3300048929 | Ga0496126_0000481 | Ga0496126_0000481_68638_69612 | 319 |
| 344 | 3300048929 | Ga0496126_0003339 | Ga0496126_0003339_13339_14313 | 319 |
| 345 | 3300059640 | Ga0587067_000358 | Ga0587067_000358_1804_2778 | 319 |
| 346 | iso_pu_bacteria | 2548877040 | 2550899873 | 319 |
| 347 | iso_pu_bacteria | 2571042143 | 2571530764 | 319 |
| 348 | iso_pu_bacteria | 2643221543 | 2643735782 | 319 |
| 349 | iso_pu_bacteria | 2728368933 | 2728534363 | 319 |
| 350 | iso_pu_bacteria | 2864733723 | 2864734840 | 319 |
| 351 | iso_pu_bacteria | 2889042446 | 2889045606 | 319 |
| 352 | iso_pu_bacteria | 2904490793 | 2904492478 | 319 |
| 353 | iso_pu_bacteria | 2919160200 | 2919161700 | 319 |
| 354 | iso_pu_bacteria | 2931384279 | 2931389040 | 319 |
| 355 | iso_pu_bacteria | 2939679117 | 2939681913 | 319 |
| 356 | iso_pu_bacteria | 2945991243 | 2945992389 | 319 |
| 357 | iso_pu_bacteria | 2946053406 | 2946055141 | 319 |
| 358 | iso_pu_bacteria | 2971403814 | 2971406856 | 319 |
| 359 | iso_pu_bacteria | 8054465665 | 8054470019 | 319 |
| 360 | 3300041999 | Ga0439433_0007158 | Ga0439433_0007158_706_1683 | 320 |
| 361 | 3300042007 | Ga0439449_0018328 | Ga0439449_0018328_28_1005 | 320 |
| 362 | 3300048919 | Ga0496116_0004053 | Ga0496116_0004053_8626_9597 | 320 |
| 363 | 3300048925 | Ga0496122_0040140 | Ga0496122_0040140_1813_2784 | 320 |
| 364 | 3300048926 | Ga0496123_0047866 | Ga0496123_0047866_1657_2628 | 320 |
| 365 | 3300048927 | Ga0496124_0005031 | Ga0496124_0005031_13518_14489 | 320 |
| 366 | 3300048928 | Ga0496125_0001240 | Ga0496125_0001240_13750_14721 | 320 |
| 367 | 3300031995 | Ga0307409_100064288 | Ga0307409_1000642882 | 322 |
| 368 | 3300032002 | Ga0307416_100146241 | Ga0307416_1001462412 | 322 |
| 369 | 3300002737 | JGI25162J39368_1009611 | JGI25162J39368_10096112 | 323 |
| 370 | 3300009036 | Ga0105244_10010454 | Ga0105244_100104542 | 323 |
| 371 | 3300011119 | Ga0105246_10023185 | Ga0105246_100231852 | 323 |
| 372 | 3300025233 | Ga0209437_100325 | Ga0209437_10032521 | 323 |
| 373 | 3300025728 | Ga0207655_1030957 | Ga0207655_10309572 | 323 |
| 374 | 3300044693 | Ga0466961_0090182 | Ga0466961_0090182_651_1754 | 323 |
| 375 | 3300044735 | Ga0466968_0006397 | Ga0466968_0006397_3176_4279 | 323 |
| 376 | 3300045049 | Ga0466959_0004766 | Ga0466959_0004766_7254_8357 | 323 |
| 377 | 3300046810 | Ga0495660_0012482 | Ga0495660_0012482_2125_3105 | 323 |
| 378 | 3300048919 | Ga0496116_0002448 | Ga0496116_0002448_11813_12784 | 323 |
| 379 | 3300048919 | Ga0496116_0035960 | Ga0496116_0035960_1554_2597 | 323 |
| 380 | 3300048924 | Ga0496121_0109338 | Ga0496121_0109338_459_1430 | 323 |
| 381 | iso_pu_bacteria | 2821111986 | 2821112639 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
148
363
0.9
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4xtc-assembly1.cif.gz_M | crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein | 0.9465 | 26 | 322 |
| 4tqv-assembly4.cif.gz_M | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.9441 | 24 | 316 |
| 4xtc-assembly1.cif.gz_M | crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein | 0.9338 | 26 | 322 |
| 4tqv-assembly4.cif.gz_M | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.9282 | 24 | 316 |
| 4tqu-assembly1.cif.gz_M | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.9276 | 24 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4tquM01 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9581 | 75 | 316 | 1.10.3720.10 |
| 4tquM01 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9392 | 75 | 316 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.904 | 74 | 316 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9033 | 74 | 318 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8929 | 74 | 318 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8A7KK91-F1-model_v4 | ABC transporter permease subunit | 0.9937 | 39 | 323 |
GO:0005886
GO:0055085 |
| AF-W4C1H3-F1-model_v4 | deleted | 0.9906 | 60 | 323 |
|
| AF-A0A3P3UBD7-F1-model_v4 | Sugar ABC transporter permease | 0.9897 | 60 | 323 |
GO:0005886
GO:0055085 |
| AF-A0A329M653-F1-model_v4 | Sugar ABC transporter permease | 0.9889 | 39 | 323 |
GO:0005886
GO:0055085 |
| AF-A0A5C1QH93-F1-model_v4 | Sugar ABC transporter permease | 0.9887 | 31 | 323 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar