F428896

General Info

Members Datasets Scaffolds Average Seq Length
381 212 762 131

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100629702|Ga0070708_1006297022
Length 144
Sequence MAEASFLAHTSSRVSNLEEIWIPLVDEPIGSIVAEIQHQNVDIDALVSTPHRVLAFRTFAYIRVGLLLGQLLFDNDVPPYDGSETWVDALLRDPAHHDALTREVRAVAEEIAADPSYADEERLGPDDGARDRFREFARRRLEGG

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
123 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
124 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
127 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
132 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
133 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
134 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
135 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.44
Rhizosphere 83.99
Stem 0
Stem Tuber 0
Unclassified 18.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100629702 3300005445 Unclassified 1011
2 Ga0070690_100207209 3300005330 Bacteria 1367
3 Ga0070682_100183946 3300005337 Unclassified 1462
4 Ga0068868_100505178 3300005338 Bacteria 1059
5 Ga0070668_100590590 3300005347 Bacteria 970
6 Ga0070668_101285585 3300005347 Unclassified 665
7 Ga0070668_102076493 3300005347 Unclassified 524
8 Ga0070675_100337793 3300005354 Bacteria 1334
9 Ga0070674_100094585 3300005356 Bacteria 2164
10 Ga0070674_100387646 3300005356 Bacteria 1138
11 Ga0070659_100547246 3300005366 Bacteria 991
12 Ga0070667_100008415 3300005367 Bacteria 8559
13 Ga0070703_10130923 3300005406 Bacteria 921
14 Ga0070714_101400243 3300005435 Bacteria 683
15 Ga0070713_101768454 3300005436 Unclassified 600
16 Ga0070711_100053189 3300005439 Bacteria 2789
17 Ga0070711_100185067 3300005439 Bacteria 1597
18 Ga0070711_101700521 3300005439 Unclassified 553
19 Ga0070705_100093566 3300005440 Bacteria 1879
20 Ga0070705_100175209 3300005440 Bacteria 1447
21 Ga0070694_100424199 3300005444 Bacteria 1045
22 Ga0070694_101669450 3300005444 Unclassified 541
23 Ga0070708_100030797 3300005445 Bacteria 4641
24 Ga0070708_100564017 3300005445 Unclassified 1074
25 Ga0070708_100718692 3300005445 Bacteria 940
26 Ga0068867_101138964 3300005459 Bacteria 714
27 Ga0070706_100171028 3300005467 Bacteria 2029
28 Ga0070706_100241051 3300005467 Bacteria 1688
29 Ga0070706_100586900 3300005467 Unclassified 1036
30 Ga0070706_100750525 3300005467 Unclassified 904
31 Ga0070707_100085998 3300005468 Bacteria 3040
32 Ga0070707_100094738 3300005468 Bacteria 2891
33 Ga0070707_100127010 3300005468 Bacteria 2478
34 Ga0070707_100371311 3300005468 Bacteria 1390
35 Ga0070707_100827812 3300005468 Bacteria 890
36 Ga0070698_100003934 3300005471 Bacteria 16335
37 Ga0070698_100178522 3300005471 Bacteria 2062
38 Ga0070698_100509044 3300005471 Unclassified 1142
39 Ga0070698_101291583 3300005471 Bacteria 680
40 Ga0070698_101481132 3300005471 Unclassified 630
41 Ga0070699_100037161 3300005518 Bacteria 4214
42 Ga0070699_100166322 3300005518 Bacteria 1953
43 Ga0070699_100543814 3300005518 Unclassified 1057
44 Ga0070679_100461570 3300005530 Unclassified 1215
45 Ga0070679_101078059 3300005530 Unclassified 748
46 Ga0070684_100134310 3300005535 Bacteria 2234
47 Ga0070697_100777750 3300005536 Bacteria 846
48 Ga0070697_101676532 3300005536 Unclassified 569
49 Ga0070686_100174974 3300005544 Bacteria 1521
50 Ga0070695_100246850 3300005545 Bacteria 1297
51 Ga0070695_100482645 3300005545 Bacteria 955
52 Ga0070696_100242254 3300005546 Bacteria 1361
53 Ga0070704_100295038 3300005549 Bacteria 1348
54 Ga0070704_100877704 3300005549 Unclassified 805
55 Ga0070704_101038058 3300005549 Bacteria 743
56 Ga0068855_101521519 3300005563 Bacteria 686
57 Ga0070702_100241778 3300005615 Bacteria 1219
58 Ga0068859_100131031 3300005617 Bacteria 2579
59 Ga0068861_100230301 3300005719 Unclassified 1571
60 Ga0068858_101281080 3300005842 Bacteria 721
61 Ga0068860_101139396 3300005843 Bacteria 800
62 Ga0081455_10007807 3300005937 Bacteria 11208
63 Ga0081539_10005141 3300005985 Bacteria 13634
64 Ga0075432_10425336 3300006058 Bacteria 578
65 Ga0070712_100008184 3300006175 Bacteria 6567
66 Ga0070712_100152534 3300006175 Bacteria 1775
67 Ga0070712_100464494 3300006175 Bacteria 1056
68 Ga0070712_101337340 3300006175 Bacteria 625
69 Ga0075428_100439405 3300006844 Bacteria 1398
70 Ga0075431_101348839 3300006847 Bacteria 674
71 Ga0075433_10464971 3300006852 Unclassified 1115
72 Ga0105240_10465146 3300009093 Bacteria 1412
73 Ga0111539_11649535 3300009094 Unclassified 743
74 Ga0105245_11663932 3300009098 Bacteria 690
75 Ga0105245_11791011 3300009098 Unclassified 667
76 Ga0105245_12566281 3300009098 Bacteria 563
77 Ga0105247_11251457 3300009101 Unclassified 593
78 Ga0114129_10137532 3300009147 Bacteria 3351
79 Ga0105243_10193388 3300009148 Bacteria 1779
80 Ga0105243_11709583 3300009148 Bacteria 658
81 Ga0105242_10329063 3300009176 Bacteria 1404
82 Ga0105242_11451771 3300009176 Bacteria 715
83 Ga0105242_12176647 3300009176 Bacteria 599
84 Ga0105249_10274199 3300009553 Bacteria 1682
85 Ga0105239_11046113 3300010375 Bacteria 939
86 Ga0105239_11190010 3300010375 Bacteria 878
87 Ga0105239_13477776 3300010375 Bacteria 512
88 Ga0157343_1013375 3300012488 Bacteria 662
89 Ga0157369_10796813 3300013105 Unclassified 971
90 Ga0157374_10603310 3300013296 Bacteria 1108
91 Ga0157378_10103748 3300013297 Unclassified 2598
92 Ga0157375_10848505 3300013308 Bacteria 1060
93 Ga0163163_10294823 3300014325 Bacteria 1674
94 Ga0163163_10981271 3300014325 Unclassified 908
95 Ga0157380_10192975 3300014326 Unclassified 1800
96 Ga0157379_11075044 3300014968 Bacteria 770
97 Ga0207653_10080106 3300025885 Bacteria 1129
98 Ga0207642_10112543 3300025899 Bacteria 1389
99 Ga0207688_10045533 3300025901 Bacteria 2447
100 Ga0207699_10273321 3300025906 Bacteria 1172
101 Ga0207699_10277099 3300025906 Bacteria 1164
102 Ga0207705_10719040 3300025909 Bacteria 776
103 Ga0207684_10032783 3300025910 Bacteria 4418
104 Ga0207684_10118141 3300025910 Bacteria 2272
105 Ga0207684_10228190 3300025910 Bacteria 1607
106 Ga0207684_10477608 3300025910 Bacteria 1069
107 Ga0207684_10553890 3300025910 Bacteria 984
108 Ga0207695_10114900 3300025913 Bacteria 2666
109 Ga0207693_10002067 3300025915 Bacteria 17543
110 Ga0207693_10031878 3300025915 Bacteria 4164
111 Ga0207693_10271257 3300025915 Bacteria 1329
112 Ga0207693_10416416 3300025915 Archaea 1050
113 Ga0207693_10629974 3300025915 Bacteria 834
114 Ga0207693_10678016 3300025915 Bacteria 799
115 Ga0207663_10100381 3300025916 Bacteria 1942
116 Ga0207662_10107452 3300025918 Bacteria 1736
117 Ga0207657_10856634 3300025919 Bacteria 701
118 Ga0207652_11310485 3300025921 Unclassified 627
119 Ga0207646_10011935 3300025922 Bacteria 8378
120 Ga0207646_10160855 3300025922 Bacteria 2026
121 Ga0207646_10304658 3300025922 Bacteria 1439
122 Ga0207646_10322697 3300025922 Bacteria 1395
123 Ga0207646_10549505 3300025922 Unclassified 1038
124 Ga0207646_11572017 3300025922 Bacteria 568
125 Ga0207646_11669625 3300025922 Unclassified 548
126 Ga0207659_10279355 3300025926 Bacteria 1365
127 Ga0207687_10107566 3300025927 Unclassified 2064
128 Ga0207687_11391187 3300025927 Bacteria 603
129 Ga0207700_11085739 3300025928 Unclassified 716
130 Ga0207664_10022812 3300025929 Bacteria 4681
131 Ga0207664_10059739 3300025929 Bacteria 3037
132 Ga0207664_10972709 3300025929 Bacteria 761
133 Ga0207664_11111137 3300025929 Bacteria 706
134 Ga0207644_10343614 3300025931 Bacteria 1211
135 Ga0207706_10080151 3300025933 Bacteria 2871
136 Ga0207686_11276773 3300025934 Bacteria 602
137 Ga0207686_11608928 3300025934 Bacteria 536
138 Ga0207669_10028941 3300025937 Bacteria 3056
139 Ga0207669_10366156 3300025937 Bacteria 1119
140 Ga0207704_10128335 3300025938 Bacteria 1750
141 Ga0207665_10001954 3300025939 Bacteria 13866
142 Ga0207665_10330465 3300025939 Bacteria 1146
143 Ga0207711_11482312 3300025941 Bacteria 621
144 Ga0207679_10587929 3300025945 Bacteria 1002
145 Ga0207712_10064611 3300025961 Bacteria 2610
146 Ga0207668_10229794 3300025972 Bacteria 1495
147 Ga0207658_10004795 3300025986 Bacteria 9360
148 Ga0207677_10128831 3300026023 Bacteria 1917
149 Ga0207678_10315821 3300026067 Unclassified 1344
150 Ga0207702_11822110 3300026078 Bacteria 600
151 Ga0207648_10329400 3300026089 Bacteria 1373
152 Ga0207675_100023323 3300026118 Bacteria 5755
153 Ga0268265_10523156 3300028380 Bacteria 1122
154 Ga0265319_1001269 3300028563 Bacteria 15335
155 Ga0265319_1092288 3300028563 Bacteria 955
156 Ga0265318_10002578 3300028577 Bacteria 9601
157 Ga0265322_10032908 3300028654 Bacteria 1478
158 Ga0265338_10223104 3300028800 Bacteria 1406
159 Ga0265330_10122547 3300031235 Bacteria 1107
160 Ga0265320_10022368 3300031240 Bacteria 3383
161 Ga0265329_10116688 3300031242 Bacteria 855
162 Ga0265339_10105639 3300031249 Bacteria 1462
163 Ga0265327_10040184 3300031251 Bacteria 2532
164 Ga0265316_10005504 3300031344 Bacteria 12296
165 Ga0307408_100405303 3300031548 Bacteria 1172
166 Ga0307408_101052924 3300031548 Bacteria 752
167 Ga0307408_101524247 3300031548 Unclassified 633
168 Ga0265314_10072160 3300031711 Bacteria 2307
169 Ga0265342_10066700 3300031712 Bacteria 2107
170 Ga0307410_10267574 3300031852 Bacteria 1336
171 Ga0307406_10254418 3300031901 Bacteria 1325
172 Ga0307406_10431370 3300031901 Bacteria 1053
173 Ga0307407_10186860 3300031903 Bacteria 1378
174 Ga0307409_100015093 3300031995 Bacteria 5054
175 Ga0307409_100233913 3300031995 Bacteria 1668
176 Ga0307409_100592763 3300031995 Unclassified 1094
177 Ga0307409_100796544 3300031995 Bacteria 952
178 Ga0307416_100022650 3300032002 Bacteria 4539
179 Ga0307416_100096111 3300032002 Unclassified 2561
180 Ga0307416_100389511 3300032002 Bacteria 1427
181 Ga0307416_100434943 3300032002 Unclassified 1360
182 Ga0307416_101237173 3300032002 Bacteria 852
183 Ga0307416_101913446 3300032002 Unclassified 696
184 Ga0307411_10955183 3300032005 Bacteria 765
185 Ga0307415_100046562 3300032126 Bacteria 2914
186 Ga0307415_101777068 3300032126 Bacteria 596
187 Ga0373955_0508820 3300035172 Bacteria 736
188 Ga0373931_0574506 3300035691 Unclassified 735
189 Ga0373925_1744226 3300037068 Unclassified 508
190 Ga0395899_0001850 3300037312 Bacteria 17517
191 Ga0395899_0015127 3300037312 Bacteria 5882
192 Ga0395899_0204986 3300037312 Bacteria 1373
193 Ga0395899_0239926 3300037312 Bacteria 1248
194 Ga0395899_0421614 3300037312 Bacteria 879
195 Ga0395900_0024884 3300037418 Bacteria 6127
196 Ga0395900_0027953 3300037418 Bacteria 5776
197 Ga0395900_0034075 3300037418 Bacteria 5242
198 Ga0395900_0038485 3300037418 Bacteria 4930
199 Ga0395900_0053378 3300037418 Bacteria 4160
200 Ga0395900_0114430 3300037418 Bacteria 2768
201 Ga0395900_0145319 3300037418 Bacteria 2425
202 Ga0395900_0502942 3300037418 Bacteria 1162
203 Ga0395900_0512316 3300037418 Unclassified 1149
204 Ga0395900_0705694 3300037418 Bacteria 942
205 Ga0395898_0003001 3300037466 Bacteria 19133
206 Ga0395898_0037254 3300037466 Bacteria 4826
207 Ga0395898_0153457 3300037466 Bacteria 2203
208 Ga0395898_0159219 3300037466 Bacteria 2159
209 Ga0395898_0298447 3300037466 Bacteria 1537
210 Ga0395898_0403128 3300037466 Bacteria 1304
211 Ga0395898_1875444 3300037466 Bacteria 520
212 Ga0395905_0006030 3300037471 Bacteria 12272
213 Ga0395905_0024190 3300037471 Bacteria 5733
214 Ga0395905_0037920 3300037471 Bacteria 4522
215 Ga0395905_0046287 3300037471 Bacteria 4079
216 Ga0395905_0055699 3300037471 Bacteria 3701
217 Ga0395905_0235379 3300037471 Bacteria 1712
218 Ga0395905_0573871 3300037471 Bacteria 1029
219 Ga0395905_0898126 3300037471 Bacteria 789
220 Ga0395905_1256721 3300037471 Bacteria 644
221 Ga0395901_0009240 3300038443 Bacteria 9991
222 Ga0395901_0026265 3300038443 Bacteria 5978
223 Ga0395901_0033143 3300038443 Bacteria 5330
224 Ga0395901_0044878 3300038443 Bacteria 4584
225 Ga0395901_0080202 3300038443 Bacteria 3407
226 Ga0395901_0148511 3300038443 Bacteria 2463
227 Ga0395901_0161622 3300038443 Bacteria 2352
228 Ga0395901_0219578 3300038443 Bacteria 1987
229 Ga0395901_0328377 3300038443 Unclassified 1582
230 Ga0395901_0352235 3300038443 Bacteria 1519
231 Ga0395901_0670566 3300038443 Bacteria 1038
232 Ga0395901_0954569 3300038443 Bacteria 836
233 Ga0395901_1041390 3300038443 Bacteria 792
234 Ga0395901_1058462 3300038443 Bacteria 784
235 Ga0436365_1753302 3300039437 Bacteria 1400
236 Ga0436360_0975496 3300039438 Bacteria 2482
237 Ga0439439_0029812 3300041406 Bacteria 1385
238 Ga0439439_0136828 3300041406 Bacteria 690
239 Ga0451787_474597 3300041441 Unclassified 738
240 Ga0451789_0149836 3300041443 Unclassified 946
241 Ga0451793_0733006 3300041452 Bacteria 1431
242 Ga0451795_0776507 3300041456 Bacteria 569
243 Ga0451800_1250976 3300041459 Bacteria 1179
244 Ga0451802_0117802 3300041460 Bacteria 6693
245 Ga0451804_0402182 3300041463 Bacteria 1922
246 Ga0451807_0927454 3300041486 Unclassified 822
247 Ga0451839_1210833 3300041496 Bacteria 3070
248 Ga0451845_0833134 3300041501 Bacteria 627
249 Ga0451847_0596086 3300041503 Bacteria 3991
250 Ga0451851_1155420 3300041507 Bacteria 636
251 Ga0451855_1678119 3300041511 Unclassified 1087
252 Ga0439431_0010478 3300041997 Bacteria 2104
253 Ga0439445_0036651 3300042004 Bacteria 1291
254 Ga0439449_0028188 3300042007 Bacteria 2093
255 Ga0439457_023395 3300042014 Bacteria 1367
256 Ga0439462_0003151 3300042015 Bacteria 3929
257 Ga0450920_013666 3300042122 Bacteria 1530
258 Ga0450920_023799 3300042122 Bacteria 1188
259 Ga0450920_024743 3300042122 Bacteria 1167
260 Ga0439446_0005415 3300042156 Bacteria 3283
261 Ga0439446_0026343 3300042156 Bacteria 1665
262 Ga0450909_047773 3300042185 Bacteria 665
263 Ga0439434_0006817 3300042435 Bacteria 3338
264 Ga0450918_009671 3300042531 Bacteria 1687
265 Ga0466963_0025377 3300044694 Bacteria 3779
266 Ga0466964_0004188 3300044706 Bacteria 5306
267 Ga0466971_0024818 3300044719 Bacteria 2676
268 Ga0466968_0050745 3300044735 Bacteria 1771
269 Ga0466957_0097870 3300044842 Unclassified 1846
270 Ga0466960_0004037 3300044901 Bacteria 5703
271 Ga0466959_0154997 3300045049 Unclassified 1613
272 Ga0451576_0407508 3300045051 Bacteria 1426
273 Ga0451576_0547386 3300045051 Bacteria 1216
274 Ga0451576_1769728 3300045051 Bacteria 639
275 Ga0466958_0011649 3300045836 Bacteria 4957
276 Ga0466958_0034402 3300045836 Bacteria 3023
277 Ga0466967_0020339 3300045976 Bacteria 5362
278 Ga0466967_0025009 3300045976 Bacteria 4917
279 Ga0466967_0041018 3300045976 Bacteria 3987
280 Ga0466967_0045914 3300045976 Bacteria 3800
281 Ga0466967_0090183 3300045976 Bacteria 2784
282 Ga0466967_1258331 3300045976 Unclassified 737
283 Ga0466967_1484536 3300045976 Bacteria 675
284 Ga0495592_0141461 3300046454 Bacteria 1673
285 Ga0495592_0598113 3300046454 Unclassified 673
286 Ga0495629_0524623 3300046459 Bacteria 797
287 Ga0495638_0644185 3300046460 Bacteria 516
288 Ga0495651_0421325 3300046462 Unclassified 868
289 Ga0495585_0418931 3300046492 Bacteria 643
290 Ga0495594_0818006 3300046499 Bacteria 525
291 Ga0495596_0097601 3300046500 Bacteria 1141
292 Ga0495607_0056128 3300046501 Bacteria 2262
293 Ga0495620_0351431 3300046515 Bacteria 559
294 Ga0495628_0149850 3300046516 Bacteria 1777
295 Ga0495628_0393324 3300046516 Bacteria 1014
296 Ga0495628_0419737 3300046516 Unclassified 975
297 Ga0495630_0543177 3300046517 Unclassified 891
298 Ga0495630_1325541 3300046517 Unclassified 542
299 Ga0495631_0086532 3300046518 Bacteria 1350
300 Ga0495598_0084579 3300046537 Bacteria 1024
301 Ga0495621_0162561 3300046539 Bacteria 884
302 Ga0495667_0841998 3300046559 Bacteria 564
303 Ga0495656_0129591 3300046615 Bacteria 1199
304 Ga0495634_0356641 3300046642 Unclassified 875
305 Ga0495635_0655183 3300046663 Bacteria 683
306 Ga0495657_0181413 3300046675 Bacteria 1292
307 Ga0495599_0563866 3300046678 Bacteria 666
308 Ga0495647_0348555 3300046681 Unclassified 674
309 Ga0495604_0323750 3300047317 Bacteria 1030
310 Ga0495636_0296142 3300047318 Unclassified 756
311 Ga0495680_0094853 3300047322 Bacteria 2232
312 Ga0495680_0290918 3300047322 Unclassified 1149
313 Ga0495680_0389152 3300047322 Bacteria 964
314 Ga0495684_0185431 3300047471 Unclassified 1541
315 Ga0496100_0802056 3300048903 Bacteria 738
316 Ga0496100_0966539 3300048903 Bacteria 670
317 Ga0496101_0017428 3300048904 Bacteria 4872
318 Ga0496102_0308677 3300048905 Bacteria 1491
319 Ga0496102_0783074 3300048905 Bacteria 876
320 Ga0496102_1617527 3300048905 Bacteria 566
321 Ga0496103_0162319 3300048906 Bacteria 1433
322 Ga0496103_0237987 3300048906 Bacteria 1171
323 Ga0496104_0822684 3300048907 Bacteria 835
324 Ga0496104_1193572 3300048907 Bacteria 664
325 Ga0496105_0667180 3300048908 Unclassified 801
326 Ga0496105_0697296 3300048908 Bacteria 780
327 Ga0496106_0195408 3300048909 Bacteria 1609
328 Ga0496107_0555926 3300048910 Bacteria 850
329 Ga0496108_0015467 3300048911 Bacteria 6224
330 Ga0496108_0360861 3300048911 Bacteria 1268
331 Ga0496108_0741833 3300048911 Unclassified 850
332 Ga0496108_1614411 3300048911 Bacteria 536
333 Ga0496109_0028814 3300048912 Bacteria 4970
334 Ga0496109_0119432 3300048912 Bacteria 2455
335 Ga0496109_0131762 3300048912 Bacteria 2334
336 Ga0496109_0151025 3300048912 Bacteria 2175
337 Ga0496109_0239202 3300048912 Bacteria 1708
338 Ga0496109_1322336 3300048912 Bacteria 657
339 Ga0496110_0072436 3300048913 Unclassified 3057
340 Ga0496110_0074805 3300048913 Bacteria 3009
341 Ga0496110_0146657 3300048913 Bacteria 2135
342 Ga0496110_0341158 3300048913 Bacteria 1365
343 Ga0496110_0984229 3300048913 Bacteria 751
344 Ga0496111_0033370 3300048914 Bacteria 3671
345 Ga0496111_0054699 3300048914 Bacteria 2886
346 Ga0496111_0888095 3300048914 Unclassified 642
347 Ga0496112_0023913 3300048915 Bacteria 5845
348 Ga0496112_0034278 3300048915 Bacteria 4939
349 Ga0496112_0119109 3300048915 Bacteria 2610
350 Ga0496112_0625259 3300048915 Bacteria 1008
351 Ga0496112_0671865 3300048915 Unclassified 965
352 Ga0496112_0858937 3300048915 Unclassified 831
353 Ga0496112_1112043 3300048915 Bacteria 708
354 Ga0496113_0182905 3300048916 Bacteria 1662
355 Ga0496113_0273830 3300048916 Bacteria 1349
356 Ga0496113_0524578 3300048916 Bacteria 951
357 Ga0496114_0121665 3300048917 Bacteria 2245
358 Ga0496114_1216743 3300048917 Unclassified 639
359 Ga0496114_1471193 3300048917 Bacteria 569
360 Ga0496115_0398252 3300048918 Bacteria 1117
361 Ga0496115_0833152 3300048918 Unclassified 716
362 Ga0501031_0009877 3300049568 Bacteria 6212
363 Ga0501031_0212342 3300049568 Bacteria 1261
364 Ga0501038_0988888 3300049574 Bacteria 618
365 Ga0501067_0122474 3300049583 Unclassified 1447
366 Ga0501069_0274746 3300049585 Unclassified 985
367 Ga0501070_0000256 3300049586 Bacteria 50155
368 Ga0501073_0085289 3300049589 Bacteria 2198
369 Ga0501075_0170888 3300049591 Unclassified 1659
370 Ga0501075_0391654 3300049591 Bacteria 1059
371 Ga0501080_0084149 3300049742 Bacteria 2956
372 Ga0501080_0084609 3300049742 Bacteria 2947
373 Ga0501035_0376721 3300049822 Bacteria 1184
374 Ga0501035_0771439 3300049822 Bacteria 770
375 Ga0501044_0346501 3300049823 Bacteria 1406
376 nmdc:mga05p37_710598_c1 3300050507 Unclassified 1115
377 nmdc:mga06r32_1201727_c1 3300050510 Bacteria 704
378 Ga0495601_0129798 3300053077 Bacteria 1641
379 Ga0495595_0066320 3300053084 Bacteria 1699
380 Ga0501084_1585435 3300054114 Unclassified 547
381 Ga0590075_020866 3300059424 Bacteria 1632
382 Ga0070708_100629702
383 Ga0070690_100207209
384 Ga0070682_100183946
385 Ga0068868_100505178
386 Ga0070668_100590590
387 Ga0070668_101285585
388 Ga0070668_102076493
389 Ga0070675_100337793
390 Ga0070674_100094585
391 Ga0070674_100387646
392 Ga0070659_100547246
393 Ga0070667_100008415
394 Ga0070703_10130923
395 Ga0070714_101400243
396 Ga0070713_101768454
397 Ga0070711_100053189
398 Ga0070711_100185067
399 Ga0070711_101700521
400 Ga0070705_100093566
401 Ga0070705_100175209
402 Ga0070694_100424199
403 Ga0070694_101669450
404 Ga0070708_100030797
405 Ga0070708_100564017
406 Ga0070708_100718692
407 Ga0068867_101138964
408 Ga0070706_100171028
409 Ga0070706_100241051
410 Ga0070706_100586900
411 Ga0070706_100750525
412 Ga0070707_100085998
413 Ga0070707_100094738
414 Ga0070707_100127010
415 Ga0070707_100371311
416 Ga0070707_100827812
417 Ga0070698_100003934
418 Ga0070698_100178522
419 Ga0070698_100509044
420 Ga0070698_101291583
421 Ga0070698_101481132
422 Ga0070699_100037161
423 Ga0070699_100166322
424 Ga0070699_100543814
425 Ga0070679_100461570
426 Ga0070679_101078059
427 Ga0070684_100134310
428 Ga0070697_100777750
429 Ga0070697_101676532
430 Ga0070686_100174974
431 Ga0070695_100246850
432 Ga0070695_100482645
433 Ga0070696_100242254
434 Ga0070704_100295038
435 Ga0070704_100877704
436 Ga0070704_101038058
437 Ga0068855_101521519
438 Ga0070702_100241778
439 Ga0068859_100131031
440 Ga0068861_100230301
441 Ga0068858_101281080
442 Ga0068860_101139396
443 Ga0081455_10007807
444 Ga0081539_10005141
445 Ga0075432_10425336
446 Ga0070712_100008184
447 Ga0070712_100152534
448 Ga0070712_100464494
449 Ga0070712_101337340
450 Ga0075428_100439405
451 Ga0075431_101348839
452 Ga0075433_10464971
453 Ga0105240_10465146
454 Ga0111539_11649535
455 Ga0105245_11663932
456 Ga0105245_11791011
457 Ga0105245_12566281
458 Ga0105247_11251457
459 Ga0114129_10137532
460 Ga0105243_10193388
461 Ga0105243_11709583
462 Ga0105242_10329063
463 Ga0105242_11451771
464 Ga0105242_12176647
465 Ga0105249_10274199
466 Ga0105239_11046113
467 Ga0105239_11190010
468 Ga0105239_13477776
469 Ga0157343_1013375
470 Ga0157369_10796813
471 Ga0157374_10603310
472 Ga0157378_10103748
473 Ga0157375_10848505
474 Ga0163163_10294823
475 Ga0163163_10981271
476 Ga0157380_10192975
477 Ga0157379_11075044
478 Ga0207653_10080106
479 Ga0207642_10112543
480 Ga0207688_10045533
481 Ga0207699_10273321
482 Ga0207699_10277099
483 Ga0207705_10719040
484 Ga0207684_10032783
485 Ga0207684_10118141
486 Ga0207684_10228190
487 Ga0207684_10477608
488 Ga0207684_10553890
489 Ga0207695_10114900
490 Ga0207693_10002067
491 Ga0207693_10031878
492 Ga0207693_10271257
493 Ga0207693_10416416
494 Ga0207693_10629974
495 Ga0207693_10678016
496 Ga0207663_10100381
497 Ga0207662_10107452
498 Ga0207657_10856634
499 Ga0207652_11310485
500 Ga0207646_10011935
501 Ga0207646_10160855
502 Ga0207646_10304658
503 Ga0207646_10322697
504 Ga0207646_10549505
505 Ga0207646_11572017
506 Ga0207646_11669625
507 Ga0207659_10279355
508 Ga0207687_10107566
509 Ga0207687_11391187
510 Ga0207700_11085739
511 Ga0207664_10022812
512 Ga0207664_10059739
513 Ga0207664_10972709
514 Ga0207664_11111137
515 Ga0207644_10343614
516 Ga0207706_10080151
517 Ga0207686_11276773
518 Ga0207686_11608928
519 Ga0207669_10028941
520 Ga0207669_10366156
521 Ga0207704_10128335
522 Ga0207665_10001954
523 Ga0207665_10330465
524 Ga0207711_11482312
525 Ga0207679_10587929
526 Ga0207712_10064611
527 Ga0207668_10229794
528 Ga0207658_10004795
529 Ga0207677_10128831
530 Ga0207678_10315821
531 Ga0207702_11822110
532 Ga0207648_10329400
533 Ga0207675_100023323
534 Ga0268265_10523156
535 Ga0265319_1001269
536 Ga0265319_1092288
537 Ga0265318_10002578
538 Ga0265322_10032908
539 Ga0265338_10223104
540 Ga0265330_10122547
541 Ga0265320_10022368
542 Ga0265329_10116688
543 Ga0265339_10105639
544 Ga0265327_10040184
545 Ga0265316_10005504
546 Ga0307408_100405303
547 Ga0307408_101052924
548 Ga0307408_101524247
549 Ga0265314_10072160
550 Ga0265342_10066700
551 Ga0307410_10267574
552 Ga0307406_10254418
553 Ga0307406_10431370
554 Ga0307407_10186860
555 Ga0307409_100015093
556 Ga0307409_100233913
557 Ga0307409_100592763
558 Ga0307409_100796544
559 Ga0307416_100022650
560 Ga0307416_100096111
561 Ga0307416_100389511
562 Ga0307416_100434943
563 Ga0307416_101237173
564 Ga0307416_101913446
565 Ga0307411_10955183
566 Ga0307415_100046562
567 Ga0307415_101777068
568 Ga0373955_0508820
569 Ga0373931_0574506
570 Ga0373925_1744226
571 Ga0395899_0001850
572 Ga0395899_0015127
573 Ga0395899_0204986
574 Ga0395899_0239926
575 Ga0395899_0421614
576 Ga0395900_0024884
577 Ga0395900_0027953
578 Ga0395900_0034075
579 Ga0395900_0038485
580 Ga0395900_0053378
581 Ga0395900_0114430
582 Ga0395900_0145319
583 Ga0395900_0502942
584 Ga0395900_0512316
585 Ga0395900_0705694
586 Ga0395898_0003001
587 Ga0395898_0037254
588 Ga0395898_0153457
589 Ga0395898_0159219
590 Ga0395898_0298447
591 Ga0395898_0403128
592 Ga0395898_1875444
593 Ga0395905_0006030
594 Ga0395905_0024190
595 Ga0395905_0037920
596 Ga0395905_0046287
597 Ga0395905_0055699
598 Ga0395905_0235379
599 Ga0395905_0573871
600 Ga0395905_0898126
601 Ga0395905_1256721
602 Ga0395901_0009240
603 Ga0395901_0026265
604 Ga0395901_0033143
605 Ga0395901_0044878
606 Ga0395901_0080202
607 Ga0395901_0148511
608 Ga0395901_0161622
609 Ga0395901_0219578
610 Ga0395901_0328377
611 Ga0395901_0352235
612 Ga0395901_0670566
613 Ga0395901_0954569
614 Ga0395901_1041390
615 Ga0395901_1058462
616 Ga0436365_1753302
617 Ga0436360_0975496
618 Ga0439439_0029812
619 Ga0439439_0136828
620 Ga0451787_474597
621 Ga0451789_0149836
622 Ga0451793_0733006
623 Ga0451795_0776507
624 Ga0451800_1250976
625 Ga0451802_0117802
626 Ga0451804_0402182
627 Ga0451807_0927454
628 Ga0451839_1210833
629 Ga0451845_0833134
630 Ga0451847_0596086
631 Ga0451851_1155420
632 Ga0451855_1678119
633 Ga0439431_0010478
634 Ga0439445_0036651
635 Ga0439449_0028188
636 Ga0439457_023395
637 Ga0439462_0003151
638 Ga0450920_013666
639 Ga0450920_023799
640 Ga0450920_024743
641 Ga0439446_0005415
642 Ga0439446_0026343
643 Ga0450909_047773
644 Ga0439434_0006817
645 Ga0450918_009671
646 Ga0466963_0025377
647 Ga0466964_0004188
648 Ga0466971_0024818
649 Ga0466968_0050745
650 Ga0466957_0097870
651 Ga0466960_0004037
652 Ga0466959_0154997
653 Ga0451576_0407508
654 Ga0451576_0547386
655 Ga0451576_1769728
656 Ga0466958_0011649
657 Ga0466958_0034402
658 Ga0466967_0020339
659 Ga0466967_0025009
660 Ga0466967_0041018
661 Ga0466967_0045914
662 Ga0466967_0090183
663 Ga0466967_1258331
664 Ga0466967_1484536
665 Ga0495592_0141461
666 Ga0495592_0598113
667 Ga0495629_0524623
668 Ga0495638_0644185
669 Ga0495651_0421325
670 Ga0495585_0418931
671 Ga0495594_0818006
672 Ga0495596_0097601
673 Ga0495607_0056128
674 Ga0495620_0351431
675 Ga0495628_0149850
676 Ga0495628_0393324
677 Ga0495628_0419737
678 Ga0495630_0543177
679 Ga0495630_1325541
680 Ga0495631_0086532
681 Ga0495598_0084579
682 Ga0495621_0162561
683 Ga0495667_0841998
684 Ga0495656_0129591
685 Ga0495634_0356641
686 Ga0495635_0655183
687 Ga0495657_0181413
688 Ga0495599_0563866
689 Ga0495647_0348555
690 Ga0495604_0323750
691 Ga0495636_0296142
692 Ga0495680_0094853
693 Ga0495680_0290918
694 Ga0495680_0389152
695 Ga0495684_0185431
696 Ga0496100_0802056
697 Ga0496100_0966539
698 Ga0496101_0017428
699 Ga0496102_0308677
700 Ga0496102_0783074
701 Ga0496102_1617527
702 Ga0496103_0162319
703 Ga0496103_0237987
704 Ga0496104_0822684
705 Ga0496104_1193572
706 Ga0496105_0667180
707 Ga0496105_0697296
708 Ga0496106_0195408
709 Ga0496107_0555926
710 Ga0496108_0015467
711 Ga0496108_0360861
712 Ga0496108_0741833
713 Ga0496108_1614411
714 Ga0496109_0028814
715 Ga0496109_0119432
716 Ga0496109_0131762
717 Ga0496109_0151025
718 Ga0496109_0239202
719 Ga0496109_1322336
720 Ga0496110_0072436
721 Ga0496110_0074805
722 Ga0496110_0146657
723 Ga0496110_0341158
724 Ga0496110_0984229
725 Ga0496111_0033370
726 Ga0496111_0054699
727 Ga0496111_0888095
728 Ga0496112_0023913
729 Ga0496112_0034278
730 Ga0496112_0119109
731 Ga0496112_0625259
732 Ga0496112_0671865
733 Ga0496112_0858937
734 Ga0496112_1112043
735 Ga0496113_0182905
736 Ga0496113_0273830
737 Ga0496113_0524578
738 Ga0496114_0121665
739 Ga0496114_1216743
740 Ga0496114_1471193
741 Ga0496115_0398252
742 Ga0496115_0833152
743 Ga0501031_0009877
744 Ga0501031_0212342
745 Ga0501038_0988888
746 Ga0501067_0122474
747 Ga0501069_0274746
748 Ga0501070_0000256
749 Ga0501073_0085289
750 Ga0501075_0170888
751 Ga0501075_0391654
752 Ga0501080_0084149
753 Ga0501080_0084609
754 Ga0501035_0376721
755 Ga0501035_0771439
756 Ga0501044_0346501
757 nmdc:mga05p37_710598_c1
758 nmdc:mga06r32_1201727_c1
759 Ga0495601_0129798
760 Ga0495595_0066320
761 Ga0501084_1585435
762 Ga0590075_020866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8pnl-assembly2.cif.gz_C outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.4663 39 100
7sc9-assembly1.cif.gz_BR synechocystis pcc 6803 phycobilisome core, complex with ocp 0.4314 14 100
7sqc-assembly1.cif.gz_1Y ciliary c1 central pair apparatus isolated from chlamydomonas reinhardtii 0.4157 17 100
2dh4-assembly1.cif.gz_B geranylgeranyl pyrophosphate synthase 0.3655 15 98
2oig-assembly1.cif.gz_B crystal structure of rs21-c6 core segment and dm5ctp complex 0.3467 7 99
ID Description Score Start End Superfamily
af_A0A0B4KHZ9_7_104_1.10.10.400 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Polyribonucleotide nucleotidyltransferase, RNA-binding domain 0.4486 19 106 1.10.10.400
3gi7B00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4446 15 100 1.20.1270.180
af_Q9NP81_58_171_1.10.287.40 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Serine-tRNA synthetase, tRNA binding domain 0.4159 15 98 1.10.287.40
af_A0A0B4KHZ9_7_104_1.10.10.400 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Polyribonucleotide nucleotidyltransferase, RNA-binding domain 0.4118 19 106 1.10.10.400
af_Q810F5_48_317_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4064 22 99 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7V9CZR9-F1-model_v4 Uncharacterized protein 0.8156 14 128
AF-A0A537ZTZ3-F1-model_v4 Uncharacterized protein 0.8109 1 114
AF-A0A7V9CZR9-F1-model_v4 Uncharacterized protein 0.8019 14 128
AF-A0A537ZTZ3-F1-model_v4 Uncharacterized protein 0.7905 1 114
AF-A0A537TNS8-F1-model_v4 Uncharacterized protein 0.7293 3 129

Map