F428888

General Info

Members Datasets Scaffolds Average Seq Length
381 200 762 132

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100956746|Ga0070713_1009567461
Length 158
Sequence VTVPWDSHWNRSGEDSRIYPGPVRLFLVRHAEAEPGEPDELRALTARGRQQARELGARLAAEGANGAAVVTSPLLRARETAAEIGRALGTTPAPDDRLAPGATADGVRDALSEHTGAADRVVAIGHQPDCGRIAATLTDGPEPDFPTAGVVVIDLPGL

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
67 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
68 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
69 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.91
Rhizosphere 85.3
Stem 0
Stem Tuber 0
Unclassified 8.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100956746 3300005436 Bacteria 825
2 Ga0070658_10002978 3300005327 Bacteria 14025
3 Ga0070658_10014266 3300005327 Bacteria 6376
4 Ga0070683_100166147 3300005329 Bacteria 2094
5 Ga0070683_100837735 3300005329 Bacteria 882
6 Ga0068869_100255448 3300005334 Unclassified 1401
7 Ga0070680_100851582 3300005336 Bacteria 786
8 Ga0068868_100032049 3300005338 Bacteria 4041
9 Ga0068868_101076576 3300005338 Unclassified 739
10 Ga0070660_100002646 3300005339 Bacteria 12312
11 Ga0070660_100024254 3300005339 Bacteria 4500
12 Ga0070660_101188058 3300005339 Bacteria 647
13 Ga0070691_10029374 3300005341 Bacteria 2571
14 Ga0070661_100249157 3300005344 Unclassified 1370
15 Ga0070661_100744347 3300005344 Bacteria 801
16 Ga0070692_11392882 3300005345 Bacteria 506
17 Ga0070668_100004587 3300005347 Bacteria 10238
18 Ga0070669_101023212 3300005353 Bacteria 709
19 Ga0070675_100323806 3300005354 Bacteria 1362
20 Ga0070688_100862112 3300005365 Unclassified 712
21 Ga0070659_101338148 3300005366 Bacteria 636
22 Ga0070709_10440739 3300005434 Bacteria 980
23 Ga0070709_10552887 3300005434 Bacteria 881
24 Ga0070714_100014775 3300005435 Bacteria 6274
25 Ga0070714_100372219 3300005435 Bacteria 1345
26 Ga0070714_100518793 3300005435 Bacteria 1138
27 Ga0070714_101831745 3300005435 Bacteria 592
28 Ga0070714_102282282 3300005435 Bacteria 526
29 Ga0070713_101639003 3300005436 Bacteria 624
30 Ga0070713_101639004 3300005436 Bacteria 624
31 Ga0070711_100065263 3300005439 Bacteria 2545
32 Ga0070711_100694671 3300005439 Bacteria 856
33 Ga0070705_100308484 3300005440 Unclassified 1137
34 Ga0070705_100695205 3300005440 Unclassified 798
35 Ga0070700_101498169 3300005441 Bacteria 573
36 Ga0070694_100326031 3300005444 Bacteria 1183
37 Ga0070708_100344253 3300005445 Bacteria 1405
38 Ga0070708_100768947 3300005445 Bacteria 906
39 Ga0070708_101645158 3300005445 Unclassified 597
40 Ga0070663_100953319 3300005455 Bacteria 744
41 Ga0070662_100300641 3300005457 Bacteria 1304
42 Ga0070662_100446691 3300005457 Bacteria 1073
43 Ga0070681_10050724 3300005458 Bacteria 4140
44 Ga0070681_10057662 3300005458 Bacteria 3864
45 Ga0070681_11365549 3300005458 Bacteria 632
46 Ga0068867_100608994 3300005459 Bacteria 953
47 Ga0070706_100214090 3300005467 Bacteria 1799
48 Ga0070706_101107641 3300005467 Bacteria 729
49 Ga0070707_100012248 3300005468 Bacteria 8009
50 Ga0070698_100043593 3300005471 Bacteria 4599
51 Ga0070698_101001998 3300005471 Bacteria 783
52 Ga0070699_100021499 3300005518 Bacteria 5564
53 Ga0070699_100481217 3300005518 Bacteria 1127
54 Ga0070699_100769273 3300005518 Bacteria 881
55 Ga0070699_100793164 3300005518 Bacteria 867
56 Ga0070679_100038293 3300005530 Bacteria 4766
57 Ga0070679_100180735 3300005530 Bacteria 2082
58 Ga0070684_100481202 3300005535 Bacteria 1149
59 Ga0070684_100496574 3300005535 Bacteria 1130
60 Ga0068853_100397272 3300005539 Bacteria 1290
61 Ga0070696_100025706 3300005546 Bacteria 4005
62 Ga0070696_100513831 3300005546 Bacteria 955
63 Ga0070696_100517281 3300005546 Bacteria 952
64 Ga0070704_100472973 3300005549 Unclassified 1083
65 Ga0070704_100627815 3300005549 Bacteria 947
66 Ga0068855_100030414 3300005563 Bacteria 6460
67 Ga0068855_100109642 3300005563 Bacteria 3169
68 Ga0068855_100123305 3300005563 Bacteria 2965
69 Ga0068855_100227406 3300005563 Bacteria 2090
70 Ga0068854_100553303 3300005578 Unclassified 976
71 Ga0068856_100010876 3300005614 Bacteria 8836
72 Ga0068866_10985097 3300005718 Bacteria 598
73 Ga0068861_100010835 3300005719 Bacteria 6337
74 Ga0068851_10090487 3300005834 Bacteria 1610
75 Ga0068870_10051515 3300005840 Bacteria 2179
76 Ga0081455_10036615 3300005937 Bacteria 4366
77 Ga0081455_10042824 3300005937 Bacteria 3967
78 Ga0081538_10046569 3300005981 Bacteria 2673
79 Ga0070717_10232485 3300006028 Bacteria 1623
80 Ga0075432_10022297 3300006058 Bacteria 2166
81 Ga0075428_100020392 3300006844 Bacteria 7339
82 Ga0075431_100377896 3300006847 Bacteria 1421
83 Ga0075431_100973042 3300006847 Bacteria 816
84 Ga0075433_10001902 3300006852 Bacteria 15706
85 Ga0075434_100010976 3300006871 Bacteria 8521
86 Ga0075434_100033548 3300006871 Bacteria 5067
87 Ga0075434_100814167 3300006871 Bacteria 950
88 Ga0068865_100849058 3300006881 Bacteria 791
89 Ga0075436_101276783 3300006914 Bacteria 555
90 Ga0075435_100022114 3300007076 Bacteria 4903
91 Ga0075435_100033158 3300007076 Bacteria 4081
92 Ga0075435_100064283 3300007076 Bacteria 2981
93 Ga0075435_100789889 3300007076 Bacteria 826
94 Ga0099794_10659372 3300007265 Bacteria 556
95 Ga0105240_10065518 3300009093 Bacteria 4509
96 Ga0111539_10347564 3300009094 Unclassified 1726
97 Ga0105245_10023879 3300009098 Bacteria 5366
98 Ga0105245_10927562 3300009098 Unclassified 913
99 Ga0105245_11326626 3300009098 Bacteria 769
100 Ga0114129_10024775 3300009147 Bacteria 8505
101 Ga0114129_10092604 3300009147 Bacteria 4187
102 Ga0114129_10105197 3300009147 Bacteria 3900
103 Ga0114129_10140167 3300009147 Bacteria 3315
104 Ga0114129_13052207 3300009147 Bacteria 549
105 Ga0105243_10338147 3300009148 Bacteria 1378
106 Ga0105243_11505115 3300009148 Bacteria 697
107 Ga0105241_10728702 3300009174 Bacteria 907
108 Ga0105242_10259469 3300009176 Bacteria 1569
109 Ga0105242_11104294 3300009176 Bacteria 807
110 Ga0105238_10184118 3300009551 Bacteria 2065
111 Ga0105249_10028829 3300009553 Bacteria 5011
112 Ga0105239_10012162 3300010375 Bacteria 9595
113 Ga0105239_10061963 3300010375 Bacteria 4106
114 Ga0105239_10404993 3300010375 Bacteria 1544
115 Ga0105239_10565549 3300010375 Bacteria 1295
116 Ga0105246_11207693 3300011119 Bacteria 696
117 Ga0157340_1016111 3300012473 Archaea 588
118 Ga0157341_1025502 3300012494 Bacteria 610
119 Ga0157342_1000948 3300012507 Bacteria 1990
120 Ga0157326_1003939 3300012513 Bacteria 1560
121 Ga0157373_10122668 3300013100 Bacteria 1826
122 Ga0157371_10619873 3300013102 Bacteria 806
123 Ga0157370_10005267 3300013104 Bacteria 14538
124 Ga0157369_10024309 3300013105 Bacteria 6743
125 Ga0157374_10230781 3300013296 Bacteria 1818
126 Ga0163162_10177656 3300013306 Bacteria 2255
127 Ga0163162_10638675 3300013306 Bacteria 1189
128 Ga0157372_10003201 3300013307 Bacteria 17676
129 Ga0157372_10910772 3300013307 Bacteria 1020
130 Ga0163163_10814130 3300014325 Unclassified 997
131 Ga0182008_10204210 3300014497 Bacteria 1006
132 Ga0182008_10237184 3300014497 Bacteria 937
133 Ga0157377_10252501 3300014745 Bacteria 1144
134 Ga0157377_10801541 3300014745 Unclassified 694
135 Ga0163161_10090377 3300017792 Bacteria 2266
136 Ga0207642_10606623 3300025899 Bacteria 682
137 Ga0207688_10159246 3300025901 Bacteria 1337
138 Ga0207699_10111177 3300025906 Bacteria 1756
139 Ga0207705_10157351 3300025909 Bacteria 1705
140 Ga0207684_10182653 3300025910 Bacteria 1809
141 Ga0207707_10008812 3300025912 Bacteria 8758
142 Ga0207707_10050116 3300025912 Bacteria 3638
143 Ga0207707_10203996 3300025912 Bacteria 1723
144 Ga0207707_11106771 3300025912 Bacteria 645
145 Ga0207695_10049853 3300025913 Bacteria 4408
146 Ga0207695_10945766 3300025913 Bacteria 741
147 Ga0207660_10041400 3300025917 Bacteria 3228
148 Ga0207660_10062237 3300025917 Bacteria 2688
149 Ga0207657_10004543 3300025919 Bacteria 14660
150 Ga0207657_10004993 3300025919 Bacteria 13945
151 Ga0207649_10172976 3300025920 Unclassified 1506
152 Ga0207649_10797199 3300025920 Bacteria 737
153 Ga0207652_10068304 3300025921 Bacteria 3083
154 Ga0207652_10110518 3300025921 Bacteria 2437
155 Ga0207646_10052442 3300025922 Bacteria 3650
156 Ga0207646_10218403 3300025922 Bacteria 1722
157 Ga0207646_10647180 3300025922 Bacteria 947
158 Ga0207659_10267665 3300025926 Bacteria 1393
159 Ga0207659_10676159 3300025926 Unclassified 883
160 Ga0207687_10088150 3300025927 Bacteria 2257
161 Ga0207664_10045955 3300025929 Bacteria 3426
162 Ga0207664_10113860 3300025929 Bacteria 2253
163 Ga0207690_10313780 3300025932 Bacteria 1230
164 Ga0207690_10772863 3300025932 Bacteria 793
165 Ga0207706_10039818 3300025933 Bacteria 4167
166 Ga0207706_10635743 3300025933 Bacteria 915
167 Ga0207686_10271842 3300025934 Bacteria 1247
168 Ga0207709_10010699 3300025935 Bacteria 5053
169 Ga0207704_10156504 3300025938 Bacteria 1616
170 Ga0207704_10752326 3300025938 Bacteria 811
171 Ga0207689_10126329 3300025942 Unclassified 2104
172 Ga0207661_10002631 3300025944 Bacteria 12355
173 Ga0207661_10085944 3300025944 Bacteria 2609
174 Ga0207661_10531059 3300025944 Bacteria 1077
175 Ga0207661_10817985 3300025944 Bacteria 858
176 Ga0207679_10017050 3300025945 Bacteria 4834
177 Ga0207667_10082700 3300025949 Bacteria 3325
178 Ga0207712_10009692 3300025961 Bacteria 6105
179 Ga0207668_10057826 3300025972 Bacteria 2707
180 Ga0207677_10072021 3300026023 Bacteria 2442
181 Ga0207677_10160575 3300026023 Bacteria 1746
182 Ga0207677_10542085 3300026023 Bacteria 1012
183 Ga0207708_11433160 3300026075 Bacteria 606
184 Ga0207702_10006607 3300026078 Bacteria 9973
185 Ga0207702_10560990 3300026078 Bacteria 1118
186 Ga0207648_10206424 3300026089 Bacteria 1744
187 Ga0207648_10408533 3300026089 Bacteria 1231
188 Ga0207676_10493315 3300026095 Bacteria 1162
189 Ga0207676_11251012 3300026095 Unclassified 736
190 Ga0207675_100002514 3300026118 Bacteria 18148
191 Ga0207683_10002893 3300026121 Bacteria 14970
192 Ga0207698_10576215 3300026142 Bacteria 1107
193 Ga0207428_10255659 3300027907 Bacteria 1305
194 Ga0307405_11150061 3300031731 Bacteria 669
195 Ga0307409_100182519 3300031995 Bacteria 1859
196 Ga0307416_100039675 3300032002 Bacteria 3649
197 Ga0373948_0111833 3300034817 Unclassified 653
198 Ga0373943_0091962 3300035170 Bacteria 1573
199 Ga0373961_0131545 3300035241 Bacteria 838
200 Ga0373947_0161123 3300035725 Bacteria 1451
201 Ga0395899_0002345 3300037312 Bacteria 15412
202 Ga0395899_0003491 3300037312 Bacteria 12458
203 Ga0395899_0010989 3300037312 Bacteria 6934
204 Ga0395899_0826465 3300037312 Unclassified 570
205 Ga0395900_0009571 3300037418 Bacteria 9933
206 Ga0395900_0021032 3300037418 Bacteria 6667
207 Ga0395900_0029574 3300037418 Bacteria 5620
208 Ga0395900_0100869 3300037418 Bacteria 2965
209 Ga0395900_0127100 3300037418 Bacteria 2614
210 Ga0395900_0127420 3300037418 Bacteria 2610
211 Ga0395900_0339979 3300037418 Bacteria 1477
212 Ga0395900_0360643 3300037418 Bacteria 1425
213 Ga0395898_0008414 3300037466 Bacteria 10908
214 Ga0395898_0010080 3300037466 Bacteria 9890
215 Ga0395898_0013069 3300037466 Bacteria 8557
216 Ga0395898_0028833 3300037466 Bacteria 5564
217 Ga0395898_0054177 3300037466 Bacteria 3915
218 Ga0395898_0134625 3300037466 Bacteria 2366
219 Ga0395898_1494556 3300037466 Unclassified 602
220 Ga0395898_1705100 3300037466 Bacteria 553
221 Ga0395905_0002978 3300037471 Bacteria 18388
222 Ga0395905_0003417 3300037471 Bacteria 16981
223 Ga0395905_0022285 3300037471 Bacteria 5993
224 Ga0395905_0527937 3300037471 Bacteria 1081
225 Ga0395905_1559594 3300037471 Unclassified 565
226 Ga0395901_0000717 3300038443 Bacteria 37735
227 Ga0395901_0004515 3300038443 Bacteria 14036
228 Ga0395901_0022624 3300038443 Bacteria 6443
229 Ga0395901_0026873 3300038443 Bacteria 5909
230 Ga0395901_0033107 3300038443 Bacteria 5333
231 Ga0395901_0039679 3300038443 Bacteria 4873
232 Ga0395901_0247302 3300038443 Bacteria 1859
233 Ga0395901_0353912 3300038443 Bacteria 1515
234 Ga0395901_0395956 3300038443 Bacteria 1419
235 Ga0395901_0936969 3300038443 Bacteria 846
236 Ga0395901_1085197 3300038443 Bacteria 772
237 Ga0395901_1107332 3300038443 Unclassified 762
238 Ga0395901_1156646 3300038443 Bacteria 742
239 Ga0451839_1557787 3300041496 Bacteria 917
240 Ga0451853_0068445 3300041512 Bacteria 2082
241 Ga0451853_2252194 3300041512 Bacteria 519
242 Ga0439448_0293907 3300042005 Bacteria 576
243 Ga0466963_0118858 3300044694 Bacteria 1818
244 Ga0466964_0004692 3300044706 Bacteria 5051
245 Ga0466964_0159614 3300044706 Bacteria 1053
246 Ga0466957_0069139 3300044842 Bacteria 2181
247 Ga0466960_0216776 3300044901 Bacteria 1052
248 Ga0466960_0977787 3300044901 Bacteria 519
249 Ga0451576_0094219 3300045051 Bacteria 3114
250 Ga0451576_1395042 3300045051 Bacteria 729
251 Ga0451576_1501854 3300045051 Bacteria 700
252 Ga0466967_0261812 3300045976 Bacteria 1655
253 Ga0466967_0376264 3300045976 Bacteria 1378
254 Ga0466967_0572572 3300045976 Bacteria 1113
255 Ga0466967_2370510 3300045976 Bacteria 526
256 Ga0495592_0167162 3300046454 Bacteria 1509
257 Ga0495641_0196843 3300046461 Bacteria 903
258 Ga0495651_0097705 3300046462 Bacteria 2192
259 Ga0495653_0203554 3300046463 Bacteria 1342
260 Ga0495664_0562395 3300046477 Bacteria 679
261 Ga0495584_0132438 3300046491 Bacteria 1265
262 Ga0495596_0133427 3300046500 Unclassified 964
263 Ga0495596_0166179 3300046500 Bacteria 858
264 Ga0495607_0306755 3300046501 Bacteria 745
265 Ga0495583_0437133 3300046506 Unclassified 513
266 Ga0495608_0082471 3300046511 Bacteria 2088
267 Ga0495618_0074131 3300046514 Bacteria 2167
268 Ga0495618_0357863 3300046514 Bacteria 899
269 Ga0495628_0069045 3300046516 Bacteria 2756
270 Ga0495628_0188925 3300046516 Bacteria 1556
271 Ga0495630_1044062 3300046517 Unclassified 620
272 Ga0495644_0460670 3300046523 Bacteria 507
273 Ga0495663_0053757 3300046525 Bacteria 1253
274 Ga0495663_0120741 3300046525 Bacteria 877
275 Ga0495652_0072646 3300046529 Bacteria 2866
276 Ga0495652_0548991 3300046529 Unclassified 795
277 Ga0495609_0137692 3300046538 Bacteria 1043
278 Ga0495609_0158948 3300046538 Bacteria 959
279 Ga0495621_0406897 3300046539 Bacteria 578
280 Ga0495597_0324588 3300046542 Bacteria 594
281 Ga0495645_0056371 3300046543 Bacteria 2853
282 Ga0495647_0185332 3300046681 Bacteria 907
283 Ga0495658_1026002 3300046683 Bacteria 526
284 Ga0495613_0236593 3300046689 Bacteria 1278
285 Ga0495660_0217081 3300046810 Bacteria 904
286 Ga0495674_0137952 3300047319 Bacteria 2051
287 Ga0495674_0218038 3300047319 Bacteria 1578
288 Ga0495676_0162825 3300047321 Bacteria 1577
289 Ga0495676_0419941 3300047321 Bacteria 885
290 Ga0495676_1106103 3300047321 Bacteria 504
291 Ga0495680_0215307 3300047322 Bacteria 1373
292 Ga0495680_0706131 3300047322 Bacteria 666
293 Ga0495684_0024605 3300047471 Bacteria 4633
294 Ga0496100_0000833 3300048903 Bacteria 14813
295 Ga0496100_0015564 3300048903 Bacteria 4444
296 Ga0496100_0033346 3300048903 Bacteria 3222
297 Ga0496100_0163203 3300048903 Bacteria 1599
298 Ga0496100_1243307 3300048903 Bacteria 588
299 Ga0496101_0046845 3300048904 Bacteria 3102
300 Ga0496101_0058168 3300048904 Bacteria 2798
301 Ga0496101_1119811 3300048904 Bacteria 618
302 Ga0496101_1300606 3300048904 Bacteria 568
303 Ga0496102_0002009 3300048905 Bacteria 17567
304 Ga0496102_0341033 3300048905 Bacteria 1411
305 Ga0496102_0384611 3300048905 Bacteria 1320
306 Ga0496102_1241285 3300048905 Bacteria 665
307 Ga0496103_1024481 3300048906 Unclassified 513
308 Ga0496104_0010179 3300048907 Bacteria 8394
309 Ga0496104_0018652 3300048907 Bacteria 6333
310 Ga0496104_0119211 3300048907 Bacteria 2534
311 Ga0496104_1666089 3300048907 Bacteria 540
312 Ga0496105_0000105 3300048908 Bacteria 56991
313 Ga0496105_0010539 3300048908 Bacteria 7271
314 Ga0496105_0246715 3300048908 Bacteria 1448
315 Ga0496105_0800341 3300048908 Bacteria 717
316 Ga0496106_0050041 3300048909 Bacteria 3149
317 Ga0496106_0550013 3300048909 Unclassified 926
318 Ga0496107_0117812 3300048910 Unclassified 1955
319 Ga0496107_0136522 3300048910 Bacteria 1812
320 Ga0496107_0299100 3300048910 Bacteria 1198
321 Ga0496107_0600281 3300048910 Bacteria 814
322 Ga0496107_1015244 3300048910 Unclassified 601
323 Ga0496108_0004529 3300048911 Bacteria 11192
324 Ga0496108_0288114 3300048911 Unclassified 1430
325 Ga0496108_0617131 3300048911 Bacteria 944
326 Ga0496109_0000298 3300048912 Bacteria 46751
327 Ga0496109_0314321 3300048912 Bacteria 1478
328 Ga0496109_0391758 3300048912 Bacteria 1313
329 Ga0496109_0557440 3300048912 Bacteria 1081
330 Ga0496110_0000644 3300048913 Bacteria 23907
331 Ga0496110_0022514 3300048913 Bacteria 5352
332 Ga0496110_0032997 3300048913 Bacteria 4476
333 Ga0496111_0003006 3300048914 Bacteria 10326
334 Ga0496111_0076253 3300048914 Bacteria 2444
335 Ga0496111_0110630 3300048914 Unclassified 2023
336 Ga0496111_0350100 3300048914 Bacteria 1093
337 Ga0496112_0003803 3300048915 Bacteria 12617
338 Ga0496112_0069661 3300048915 Bacteria 3475
339 Ga0496112_0653638 3300048915 Bacteria 981
340 Ga0496113_0118145 3300048916 Bacteria 2071
341 Ga0496113_1016151 3300048916 Bacteria 653
342 Ga0496114_0000566 3300048917 Bacteria 27443
343 Ga0496114_0000952 3300048917 Bacteria 21669
344 Ga0496114_0047378 3300048917 Bacteria 3576
345 Ga0496115_0193525 3300048918 Unclassified 1680
346 Ga0496115_0225748 3300048918 Bacteria 1545
347 Ga0501040_0150614 3300049576 Bacteria 1641
348 Ga0501046_0101933 3300049580 Bacteria 2201
349 Ga0501067_0003969 3300049583 Bacteria 8163
350 Ga0501068_0100691 3300049584 Bacteria 1791
351 Ga0501069_0001253 3300049585 Bacteria 12430
352 Ga0501076_0376748 3300049592 Bacteria 1166
353 Ga0501079_1604213 3300049741 Bacteria 512
354 Ga0501080_1018286 3300049742 Bacteria 718
355 Ga0501081_0247536 3300049743 Bacteria 1301
356 nmdc:mga05p37_1013964_c1 3300050507 Bacteria 880
357 nmdc:mga05p37_125974_c1 3300050507 Bacteria 1319
358 nmdc:mga05p37_169723_c1 3300050507 Bacteria 2661
359 nmdc:mga05p37_1996107_c1 3300050507 Bacteria 549
360 nmdc:mga05p37_82271_c1 3300050507 Bacteria 3967
361 nmdc:mga06r32_299784_c1 3300050510 Bacteria 1593
362 nmdc:mga06r32_942361_c1 3300050510 Bacteria 818
363 nmdc:mga08y16_148874_c1 3300050511 Bacteria 2433
364 nmdc:mga08y16_238431_c1 3300050511 Bacteria 1880
365 nmdc:mga08y16_547880_c1 3300050511 Bacteria 1171
366 nmdc:mga0n895_5512_c1 3300050512 Bacteria 10594
367 nmdc:mga0rr50_148189_c1 3300050513 Bacteria 1894
368 nmdc:mga0rr50_17926_c1 3300050513 Bacteria 4742
369 nmdc:mga0rr50_758199_c1 3300050513 Bacteria 828
370 nmdc:mga08x19_404208_c1 3300050514 Unclassified 958
371 nmdc:mga0a205_147663_c1 3300050515 Bacteria 2251
372 nmdc:mga0a205_221681_c1 3300050515 Bacteria 1776
373 nmdc:mga0a205_48_c1 3300050515 Bacteria 44125
374 Ga0495612_0084094 3300053078 Bacteria 1340
375 Ga0495595_0082022 3300053084 Bacteria 1537
376 Ga0495595_0238346 3300053084 Bacteria 910
377 Ga0495595_0383787 3300053084 Bacteria 711
378 Ga0495619_0030644 3300053085 Bacteria 3482
379 Ga0495619_0074519 3300053085 Bacteria 2276
380 Ga0495619_0110784 3300053085 Bacteria 1876
381 Ga0501082_0157508 3300060353 Bacteria 1973
382 Ga0070713_100956746
383 Ga0070658_10002978
384 Ga0070658_10014266
385 Ga0070683_100166147
386 Ga0070683_100837735
387 Ga0068869_100255448
388 Ga0070680_100851582
389 Ga0068868_100032049
390 Ga0068868_101076576
391 Ga0070660_100002646
392 Ga0070660_100024254
393 Ga0070660_101188058
394 Ga0070691_10029374
395 Ga0070661_100249157
396 Ga0070661_100744347
397 Ga0070692_11392882
398 Ga0070668_100004587
399 Ga0070669_101023212
400 Ga0070675_100323806
401 Ga0070688_100862112
402 Ga0070659_101338148
403 Ga0070709_10440739
404 Ga0070709_10552887
405 Ga0070714_100014775
406 Ga0070714_100372219
407 Ga0070714_100518793
408 Ga0070714_101831745
409 Ga0070714_102282282
410 Ga0070713_101639003
411 Ga0070713_101639004
412 Ga0070711_100065263
413 Ga0070711_100694671
414 Ga0070705_100308484
415 Ga0070705_100695205
416 Ga0070700_101498169
417 Ga0070694_100326031
418 Ga0070708_100344253
419 Ga0070708_100768947
420 Ga0070708_101645158
421 Ga0070663_100953319
422 Ga0070662_100300641
423 Ga0070662_100446691
424 Ga0070681_10050724
425 Ga0070681_10057662
426 Ga0070681_11365549
427 Ga0068867_100608994
428 Ga0070706_100214090
429 Ga0070706_101107641
430 Ga0070707_100012248
431 Ga0070698_100043593
432 Ga0070698_101001998
433 Ga0070699_100021499
434 Ga0070699_100481217
435 Ga0070699_100769273
436 Ga0070699_100793164
437 Ga0070679_100038293
438 Ga0070679_100180735
439 Ga0070684_100481202
440 Ga0070684_100496574
441 Ga0068853_100397272
442 Ga0070696_100025706
443 Ga0070696_100513831
444 Ga0070696_100517281
445 Ga0070704_100472973
446 Ga0070704_100627815
447 Ga0068855_100030414
448 Ga0068855_100109642
449 Ga0068855_100123305
450 Ga0068855_100227406
451 Ga0068854_100553303
452 Ga0068856_100010876
453 Ga0068866_10985097
454 Ga0068861_100010835
455 Ga0068851_10090487
456 Ga0068870_10051515
457 Ga0081455_10036615
458 Ga0081455_10042824
459 Ga0081538_10046569
460 Ga0070717_10232485
461 Ga0075432_10022297
462 Ga0075428_100020392
463 Ga0075431_100377896
464 Ga0075431_100973042
465 Ga0075433_10001902
466 Ga0075434_100010976
467 Ga0075434_100033548
468 Ga0075434_100814167
469 Ga0068865_100849058
470 Ga0075436_101276783
471 Ga0075435_100022114
472 Ga0075435_100033158
473 Ga0075435_100064283
474 Ga0075435_100789889
475 Ga0099794_10659372
476 Ga0105240_10065518
477 Ga0111539_10347564
478 Ga0105245_10023879
479 Ga0105245_10927562
480 Ga0105245_11326626
481 Ga0114129_10024775
482 Ga0114129_10092604
483 Ga0114129_10105197
484 Ga0114129_10140167
485 Ga0114129_13052207
486 Ga0105243_10338147
487 Ga0105243_11505115
488 Ga0105241_10728702
489 Ga0105242_10259469
490 Ga0105242_11104294
491 Ga0105238_10184118
492 Ga0105249_10028829
493 Ga0105239_10012162
494 Ga0105239_10061963
495 Ga0105239_10404993
496 Ga0105239_10565549
497 Ga0105246_11207693
498 Ga0157340_1016111
499 Ga0157341_1025502
500 Ga0157342_1000948
501 Ga0157326_1003939
502 Ga0157373_10122668
503 Ga0157371_10619873
504 Ga0157370_10005267
505 Ga0157369_10024309
506 Ga0157374_10230781
507 Ga0163162_10177656
508 Ga0163162_10638675
509 Ga0157372_10003201
510 Ga0157372_10910772
511 Ga0163163_10814130
512 Ga0182008_10204210
513 Ga0182008_10237184
514 Ga0157377_10252501
515 Ga0157377_10801541
516 Ga0163161_10090377
517 Ga0207642_10606623
518 Ga0207688_10159246
519 Ga0207699_10111177
520 Ga0207705_10157351
521 Ga0207684_10182653
522 Ga0207707_10008812
523 Ga0207707_10050116
524 Ga0207707_10203996
525 Ga0207707_11106771
526 Ga0207695_10049853
527 Ga0207695_10945766
528 Ga0207660_10041400
529 Ga0207660_10062237
530 Ga0207657_10004543
531 Ga0207657_10004993
532 Ga0207649_10172976
533 Ga0207649_10797199
534 Ga0207652_10068304
535 Ga0207652_10110518
536 Ga0207646_10052442
537 Ga0207646_10218403
538 Ga0207646_10647180
539 Ga0207659_10267665
540 Ga0207659_10676159
541 Ga0207687_10088150
542 Ga0207664_10045955
543 Ga0207664_10113860
544 Ga0207690_10313780
545 Ga0207690_10772863
546 Ga0207706_10039818
547 Ga0207706_10635743
548 Ga0207686_10271842
549 Ga0207709_10010699
550 Ga0207704_10156504
551 Ga0207704_10752326
552 Ga0207689_10126329
553 Ga0207661_10002631
554 Ga0207661_10085944
555 Ga0207661_10531059
556 Ga0207661_10817985
557 Ga0207679_10017050
558 Ga0207667_10082700
559 Ga0207712_10009692
560 Ga0207668_10057826
561 Ga0207677_10072021
562 Ga0207677_10160575
563 Ga0207677_10542085
564 Ga0207708_11433160
565 Ga0207702_10006607
566 Ga0207702_10560990
567 Ga0207648_10206424
568 Ga0207648_10408533
569 Ga0207676_10493315
570 Ga0207676_11251012
571 Ga0207675_100002514
572 Ga0207683_10002893
573 Ga0207698_10576215
574 Ga0207428_10255659
575 Ga0307405_11150061
576 Ga0307409_100182519
577 Ga0307416_100039675
578 Ga0373948_0111833
579 Ga0373943_0091962
580 Ga0373961_0131545
581 Ga0373947_0161123
582 Ga0395899_0002345
583 Ga0395899_0003491
584 Ga0395899_0010989
585 Ga0395899_0826465
586 Ga0395900_0009571
587 Ga0395900_0021032
588 Ga0395900_0029574
589 Ga0395900_0100869
590 Ga0395900_0127100
591 Ga0395900_0127420
592 Ga0395900_0339979
593 Ga0395900_0360643
594 Ga0395898_0008414
595 Ga0395898_0010080
596 Ga0395898_0013069
597 Ga0395898_0028833
598 Ga0395898_0054177
599 Ga0395898_0134625
600 Ga0395898_1494556
601 Ga0395898_1705100
602 Ga0395905_0002978
603 Ga0395905_0003417
604 Ga0395905_0022285
605 Ga0395905_0527937
606 Ga0395905_1559594
607 Ga0395901_0000717
608 Ga0395901_0004515
609 Ga0395901_0022624
610 Ga0395901_0026873
611 Ga0395901_0033107
612 Ga0395901_0039679
613 Ga0395901_0247302
614 Ga0395901_0353912
615 Ga0395901_0395956
616 Ga0395901_0936969
617 Ga0395901_1085197
618 Ga0395901_1107332
619 Ga0395901_1156646
620 Ga0451839_1557787
621 Ga0451853_0068445
622 Ga0451853_2252194
623 Ga0439448_0293907
624 Ga0466963_0118858
625 Ga0466964_0004692
626 Ga0466964_0159614
627 Ga0466957_0069139
628 Ga0466960_0216776
629 Ga0466960_0977787
630 Ga0451576_0094219
631 Ga0451576_1395042
632 Ga0451576_1501854
633 Ga0466967_0261812
634 Ga0466967_0376264
635 Ga0466967_0572572
636 Ga0466967_2370510
637 Ga0495592_0167162
638 Ga0495641_0196843
639 Ga0495651_0097705
640 Ga0495653_0203554
641 Ga0495664_0562395
642 Ga0495584_0132438
643 Ga0495596_0133427
644 Ga0495596_0166179
645 Ga0495607_0306755
646 Ga0495583_0437133
647 Ga0495608_0082471
648 Ga0495618_0074131
649 Ga0495618_0357863
650 Ga0495628_0069045
651 Ga0495628_0188925
652 Ga0495630_1044062
653 Ga0495644_0460670
654 Ga0495663_0053757
655 Ga0495663_0120741
656 Ga0495652_0072646
657 Ga0495652_0548991
658 Ga0495609_0137692
659 Ga0495609_0158948
660 Ga0495621_0406897
661 Ga0495597_0324588
662 Ga0495645_0056371
663 Ga0495647_0185332
664 Ga0495658_1026002
665 Ga0495613_0236593
666 Ga0495660_0217081
667 Ga0495674_0137952
668 Ga0495674_0218038
669 Ga0495676_0162825
670 Ga0495676_0419941
671 Ga0495676_1106103
672 Ga0495680_0215307
673 Ga0495680_0706131
674 Ga0495684_0024605
675 Ga0496100_0000833
676 Ga0496100_0015564
677 Ga0496100_0033346
678 Ga0496100_0163203
679 Ga0496100_1243307
680 Ga0496101_0046845
681 Ga0496101_0058168
682 Ga0496101_1119811
683 Ga0496101_1300606
684 Ga0496102_0002009
685 Ga0496102_0341033
686 Ga0496102_0384611
687 Ga0496102_1241285
688 Ga0496103_1024481
689 Ga0496104_0010179
690 Ga0496104_0018652
691 Ga0496104_0119211
692 Ga0496104_1666089
693 Ga0496105_0000105
694 Ga0496105_0010539
695 Ga0496105_0246715
696 Ga0496105_0800341
697 Ga0496106_0050041
698 Ga0496106_0550013
699 Ga0496107_0117812
700 Ga0496107_0136522
701 Ga0496107_0299100
702 Ga0496107_0600281
703 Ga0496107_1015244
704 Ga0496108_0004529
705 Ga0496108_0288114
706 Ga0496108_0617131
707 Ga0496109_0000298
708 Ga0496109_0314321
709 Ga0496109_0391758
710 Ga0496109_0557440
711 Ga0496110_0000644
712 Ga0496110_0022514
713 Ga0496110_0032997
714 Ga0496111_0003006
715 Ga0496111_0076253
716 Ga0496111_0110630
717 Ga0496111_0350100
718 Ga0496112_0003803
719 Ga0496112_0069661
720 Ga0496112_0653638
721 Ga0496113_0118145
722 Ga0496113_1016151
723 Ga0496114_0000566
724 Ga0496114_0000952
725 Ga0496114_0047378
726 Ga0496115_0193525
727 Ga0496115_0225748
728 Ga0501040_0150614
729 Ga0501046_0101933
730 Ga0501067_0003969
731 Ga0501068_0100691
732 Ga0501069_0001253
733 Ga0501076_0376748
734 Ga0501079_1604213
735 Ga0501080_1018286
736 Ga0501081_0247536
737 nmdc:mga05p37_1013964_c1
738 nmdc:mga05p37_125974_c1
739 nmdc:mga05p37_169723_c1
740 nmdc:mga05p37_1996107_c1
741 nmdc:mga05p37_82271_c1
742 nmdc:mga06r32_299784_c1
743 nmdc:mga06r32_942361_c1
744 nmdc:mga08y16_148874_c1
745 nmdc:mga08y16_238431_c1
746 nmdc:mga08y16_547880_c1
747 nmdc:mga0n895_5512_c1
748 nmdc:mga0rr50_148189_c1
749 nmdc:mga0rr50_17926_c1
750 nmdc:mga0rr50_758199_c1
751 nmdc:mga08x19_404208_c1
752 nmdc:mga0a205_147663_c1
753 nmdc:mga0a205_221681_c1
754 nmdc:mga0a205_48_c1
755 Ga0495612_0084094
756 Ga0495595_0082022
757 Ga0495595_0238346
758 Ga0495595_0383787
759 Ga0495619_0030644
760 Ga0495619_0074519
761 Ga0495619_0110784
762 Ga0501082_0157508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

25

101

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.9036 1 127
2rfl-assembly5.cif.gz_E crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.885 2 124
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8775 1 127
2rfl-assembly3.cif.gz_C crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8771 2 124
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8698 2 124
ID Description Score Start End Superfamily
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9102 7 109 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9091 1 127 3.40.50.1240
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8956 2 124 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8828 1 127 3.40.50.1240
af_Q9LW33_109_250_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8803 8 73 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A538L8E2-F1-model_v4 Phosphohistidine phosphatase 0.9954 1 127
AF-A0A538L8E2-F1-model_v4 Phosphohistidine phosphatase 0.9875 1 127
AF-A0A538G9M5-F1-model_v4 Phosphohistidine phosphatase SixA 0.9805 1 130 GO:0005737
GO:0036211
GO:0101006
AF-A0A538G9M5-F1-model_v4 Phosphohistidine phosphatase SixA 0.9732 1 130 GO:0005737
GO:0036211
GO:0101006
AF-A0A3M1QMG0-F1-model_v4 Histidine phosphatase family protein 0.9448 1 124 GO:0005737
GO:0016791

Map