F428837

General Info

Members Datasets Scaffolds Average Seq Length
380 189 760 117

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939647034|2939650825
Length 135
Sequence VHNGYMDSPQTLQLLHADELPAVDRPASAGDEACCEPSAQPSLDAYEAQVRASVFKALADPNRLRLLSIVKSAHSGEACVCDLTEPLDLGQPTVSHHLKILVDAGLLHREKRGTWAYYSLVPGAIERTSGLLETL

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
3 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
86 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
87 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
88 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
91 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
92 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
93 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
94 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
95 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
96 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
97 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
98 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
99 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
100 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
101 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
164 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
170 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
171 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
172 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
173 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
174 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
175 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
176 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
177 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
178 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
179 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
180 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
181 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
182 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
183 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
184 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
185 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
186 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
187 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
188 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
189 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.68
Metatranscriptomes 0.79
Isolates 5.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.21
Nodule 0
Rhizoplane 11.32
Rhizosphere 82.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000684 3300000549 Bacteria 5397
2 LJQas_1001169 3300000549 Bacteria 3959
3 Ga0055532_1004259 3300003758 Bacteria 2200
4 Ga0055527_1000005 3300003760 Bacteria 504776
5 Ga0055535_1021830 3300003761 Bacteria 772
6 Ga0055542_1000006 3300003762 Bacteria 504776
7 Ga0055542_1005479 3300003762 Bacteria 2862
8 Ga0055529_1000013 3300003763 Bacteria 373267
9 Ga0065714_10117718 3300005288 Bacteria 1388
10 Ga0065714_10159126 3300005288 Bacteria 1057
11 Ga0065714_10332856 3300005288 Bacteria 655
12 Ga0065712_10114067 3300005290 Bacteria 1772
13 Ga0070676_10001684 3300005328 Bacteria 11221
14 Ga0070670_100046629 3300005331 Bacteria 3727
15 Ga0070670_100936879 3300005331 Bacteria 786
16 Ga0070677_10009663 3300005333 Bacteria 3277
17 Ga0070677_10014177 3300005333 Bacteria 2801
18 Ga0070666_10002892 3300005335 Bacteria 10367
19 Ga0070666_10168254 3300005335 Bacteria 1534
20 Ga0070668_100172740 3300005347 Bacteria 1760
21 Ga0070669_100045035 3300005353 Bacteria 3214
22 Ga0070675_100003219 3300005354 Bacteria 12367
23 Ga0070675_101502956 3300005354 Bacteria 621
24 Ga0070674_100144469 3300005356 Bacteria 1789
25 Ga0070673_100018812 3300005364 Bacteria 4947
26 Ga0070673_102168158 3300005364 Bacteria 528
27 Ga0070667_100022662 3300005367 Bacteria 5207
28 Ga0070678_100602607 3300005456 Bacteria 981
29 Ga0070698_101397289 3300005471 Bacteria 651
30 Ga0070672_100064550 3300005543 Bacteria 2893
31 Ga0070672_100770505 3300005543 Bacteria 845
32 Ga0068864_101186088 3300005618 Bacteria 762
33 Ga0068870_11431297 3300005840 Bacteria 507
34 Ga0068863_101089246 3300005841 Bacteria 803
35 Ga0075364_10345294 3300006051 Bacteria 1014
36 Ga0075432_10001429 3300006058 Bacteria 7783
37 Ga0075432_10259790 3300006058 Bacteria 707
38 Ga0075367_10402564 3300006178 Bacteria 866
39 Ga0105251_10016957 3300009011 Bacteria 3915
40 Ga0105244_10015759 3300009036 Bacteria 4327
41 Ga0105244_10036369 3300009036 Bacteria 2580
42 Ga0105244_10041218 3300009036 Bacteria 2393
43 Ga0105244_10137328 3300009036 Bacteria 1177
44 Ga0105243_10113227 3300009148 Bacteria 2275
45 Ga0105243_10163685 3300009148 Bacteria 1920
46 Ga0105243_10821877 3300009148 Bacteria 918
47 Ga0105242_10065471 3300009176 Bacteria 2998
48 Ga0105248_10011701 3300009177 Bacteria 9673
49 Ga0105238_10329792 3300009551 Bacteria 1513
50 Ga0105246_10007180 3300011119 Bacteria 6824
51 Ga0105246_10007805 3300011119 Bacteria 6564
52 Ga0105246_10103699 3300011119 Bacteria 2076
53 Ga0105246_11262022 3300011119 Bacteria 683
54 Ga0157373_10029196 3300013100 Bacteria 3975
55 Ga0157371_10038200 3300013102 Bacteria 3435
56 Ga0157371_10065379 3300013102 Bacteria 2576
57 Ga0157370_10007935 3300013104 Bacteria 11494
58 Ga0157369_10033455 3300013105 Bacteria 5648
59 Ga0157369_10058864 3300013105 Bacteria 4144
60 Ga0157374_11069876 3300013296 Bacteria 827
61 Ga0163162_10007835 3300013306 Bacteria 10410
62 Ga0163162_10123336 3300013306 Bacteria 2696
63 Ga0163162_10191279 3300013306 Bacteria 2174
64 Ga0157375_10052499 3300013308 Bacteria 4008
65 Ga0157375_10515993 3300013308 Bacteria 1359
66 Ga0157375_10720340 3300013308 Bacteria 1150
67 Ga0157375_10820604 3300013308 Bacteria 1078
68 Ga0209672_100003 3300025228 Bacteria 1560476
69 Ga0209147_101008 3300025229 Bacteria 12172
70 Ga0209258_106034 3300025242 Bacteria 1953
71 Ga0209148_1000004 3300025254 Bacteria 1844481
72 Ga0209148_1005178 3300025254 Bacteria 3042
73 Ga0209455_1000046 3300025272 Bacteria 382681
74 Ga0209051_1001084 3300025303 Bacteria 25237
75 Ga0207697_10000359 3300025315 Bacteria 25470
76 Ga0207697_10010187 3300025315 Bacteria 4029
77 Ga0207655_1026521 3300025728 Bacteria 2782
78 Ga0207655_1039899 3300025728 Bacteria 2034
79 Ga0207655_1119058 3300025728 Bacteria 878
80 Ga0207655_1132878 3300025728 Bacteria 809
81 Ga0207682_10000797 3300025893 Bacteria 14552
82 Ga0207688_10168630 3300025901 Bacteria 1301
83 Ga0207680_10492128 3300025903 Bacteria 873
84 Ga0207680_11187829 3300025903 Bacteria 544
85 Ga0207645_10004818 3300025907 Bacteria 9914
86 Ga0207645_10288078 3300025907 Bacteria 1092
87 Ga0207643_10081200 3300025908 Bacteria 1879
88 Ga0207681_10087184 3300025923 Bacteria 2220
89 Ga0207650_10003553 3300025925 Bacteria 10700
90 Ga0207650_11558760 3300025925 Bacteria 561
91 Ga0207644_10382808 3300025931 Bacteria 1147
92 Ga0207686_10102206 3300025934 Bacteria 1916
93 Ga0207709_10004550 3300025935 Bacteria 7993
94 Ga0207709_10809114 3300025935 Bacteria 757
95 Ga0207669_10066505 3300025937 Bacteria 2241
96 Ga0207691_10050929 3300025940 Bacteria 3789
97 Ga0207711_10103140 3300025941 Bacteria 2525
98 Ga0207651_10201744 3300025960 Bacteria 1594
99 Ga0207668_10042482 3300025972 Bacteria 3079
100 Ga0207658_10140662 3300025986 Bacteria 1952
101 Ga0207641_10398765 3300026088 Bacteria 1321
102 Ga0207683_10003098 3300026121 Bacteria 14529
103 Ga0207683_10184233 3300026121 Bacteria 1894
104 Ga0207683_10400109 3300026121 Bacteria 1263
105 Ga0207428_10437278 3300027907 Bacteria 955
106 Ga0307408_100018702 3300031548 Bacteria 4655
107 Ga0307408_100054144 3300031548 Bacteria 2900
108 Ga0307408_100060959 3300031548 Bacteria 2752
109 Ga0307408_100115912 3300031548 Bacteria 2067
110 Ga0307408_100129573 3300031548 Bacteria 1966
111 Ga0307408_100248111 3300031548 Bacteria 1467
112 Ga0307408_100253953 3300031548 Bacteria 1451
113 Ga0307408_100308755 3300031548 Bacteria 1328
114 Ga0307408_100399975 3300031548 Bacteria 1179
115 Ga0307408_100539544 3300031548 Bacteria 1027
116 Ga0307408_100960432 3300031548 Bacteria 785
117 Ga0307408_101061460 3300031548 Bacteria 749
118 Ga0307405_10065445 3300031731 Bacteria 2314
119 Ga0307405_10088375 3300031731 Bacteria 2044
120 Ga0307405_10113356 3300031731 Bacteria 1841
121 Ga0307405_10124920 3300031731 Bacteria 1767
122 Ga0307405_10271654 3300031731 Bacteria 1271
123 Ga0307405_10275566 3300031731 Bacteria 1263
124 Ga0307405_10374374 3300031731 Bacteria 1106
125 Ga0307405_10738001 3300031731 Bacteria 819
126 Ga0307413_10042740 3300031824 Bacteria 2665
127 Ga0307413_10055326 3300031824 Bacteria 2414
128 Ga0307413_10148919 3300031824 Bacteria 1628
129 Ga0307413_10262067 3300031824 Bacteria 1289
130 Ga0307413_10278701 3300031824 Bacteria 1256
131 Ga0307413_10476342 3300031824 Bacteria 997
132 Ga0307413_10478749 3300031824 Bacteria 995
133 Ga0307413_10612037 3300031824 Bacteria 893
134 Ga0307413_11045444 3300031824 Bacteria 702
135 Ga0307410_10034332 3300031852 Bacteria 3284
136 Ga0307410_10037022 3300031852 Bacteria 3183
137 Ga0307410_10079367 3300031852 Bacteria 2299
138 Ga0307410_10134888 3300031852 Bacteria 1818
139 Ga0307410_10140147 3300031852 Bacteria 1788
140 Ga0307410_10438102 3300031852 Bacteria 1063
141 Ga0307410_10463635 3300031852 Bacteria 1036
142 Ga0307410_10584806 3300031852 Bacteria 929
143 Ga0307410_10652792 3300031852 Bacteria 883
144 Ga0307410_10665854 3300031852 Bacteria 874
145 Ga0307410_11420861 3300031852 Bacteria 609
146 Ga0307410_11638950 3300031852 Bacteria 569
147 Ga0307406_10067295 3300031901 Bacteria 2335
148 Ga0307406_10679533 3300031901 Bacteria 857
149 Ga0307406_10930122 3300031901 Bacteria 742
150 Ga0307406_10961819 3300031901 Bacteria 730
151 Ga0307406_11232885 3300031901 Bacteria 651
152 Ga0307407_10075315 3300031903 Bacteria 2023
153 Ga0307407_10102667 3300031903 Bacteria 1778
154 Ga0307407_10244158 3300031903 Bacteria 1227
155 Ga0307407_10303320 3300031903 Bacteria 1114
156 Ga0307407_10436285 3300031903 Bacteria 947
157 Ga0307407_10493365 3300031903 Bacteria 896
158 Ga0307412_10000949 3300031911 Bacteria 16588
159 Ga0307412_10048943 3300031911 Bacteria 2782
160 Ga0307412_10123471 3300031911 Bacteria 1868
161 Ga0307412_10133437 3300031911 Bacteria 1807
162 Ga0307412_10152777 3300031911 Bacteria 1706
163 Ga0307412_10178610 3300031911 Bacteria 1594
164 Ga0307412_10220538 3300031911 Bacteria 1453
165 Ga0307412_10228789 3300031911 Bacteria 1430
166 Ga0307412_10261865 3300031911 Bacteria 1348
167 Ga0307412_10432614 3300031911 Bacteria 1079
168 Ga0307412_10454975 3300031911 Bacteria 1055
169 Ga0307412_10455642 3300031911 Bacteria 1055
170 Ga0307412_10545494 3300031911 Bacteria 973
171 Ga0307409_100050029 3300031995 Bacteria 3189
172 Ga0307409_100057818 3300031995 Bacteria 3008
173 Ga0307409_100063873 3300031995 Bacteria 2889
174 Ga0307409_100078236 3300031995 Bacteria 2660
175 Ga0307409_100093832 3300031995 Bacteria 2467
176 Ga0307409_100167005 3300031995 Bacteria 1932
177 Ga0307409_100328340 3300031995 Bacteria 1434
178 Ga0307409_100474824 3300031995 Bacteria 1212
179 Ga0307409_101428013 3300031995 Bacteria 719
180 Ga0307409_102307571 3300031995 Bacteria 567
181 Ga0307409_102343908 3300031995 Bacteria 563
182 Ga0307416_100161099 3300032002 Bacteria 2074
183 Ga0307416_100173557 3300032002 Bacteria 2011
184 Ga0307416_100174591 3300032002 Bacteria 2005
185 Ga0307416_100176770 3300032002 Bacteria 1995
186 Ga0307416_100235702 3300032002 Bacteria 1768
187 Ga0307416_100387302 3300032002 Bacteria 1430
188 Ga0307416_100388662 3300032002 Bacteria 1428
189 Ga0307416_100495093 3300032002 Bacteria 1285
190 Ga0307416_100532037 3300032002 Bacteria 1245
191 Ga0307416_100837171 3300032002 Bacteria 1018
192 Ga0307416_101049113 3300032002 Bacteria 919
193 Ga0307416_103181324 3300032002 Bacteria 549
194 Ga0307414_10164213 3300032004 Bacteria 1768
195 Ga0307414_10451713 3300032004 Bacteria 1127
196 Ga0307414_10820065 3300032004 Bacteria 849
197 Ga0307414_11026136 3300032004 Bacteria 760
198 Ga0307414_11915961 3300032004 Bacteria 553
199 Ga0307411_10803838 3300032005 Bacteria 828
200 Ga0307411_10889584 3300032005 Bacteria 790
201 Ga0307411_11498487 3300032005 Bacteria 620
202 Ga0307411_11565080 3300032005 Bacteria 607
203 Ga0307415_100304631 3300032126 Bacteria 1321
204 Ga0307415_100463918 3300032126 Bacteria 1098
205 Ga0307415_101098355 3300032126 Bacteria 744
206 Ga0373943_0593675 3300035170 Bacteria 652
207 Ga0395899_0561605 3300037312 Bacteria 732
208 Ga0395900_0075197 3300037418 Bacteria 3472
209 Ga0395901_0070353 3300038443 Bacteria 3645
210 Ga0439436_0015457 3300041404 Bacteria 2296
211 Ga0439436_0033614 3300041404 Bacteria 1484
212 Ga0439439_0019425 3300041406 Bacteria 1686
213 Ga0439447_154560 3300041407 Bacteria 528
214 Ga0439466_0009426 3300041411 Bacteria 3646
215 Ga0439466_0124261 3300041411 Bacteria 796
216 Ga0439465_0072569 3300041413 Bacteria 1156
217 Ga0439433_0001140 3300041999 Bacteria 5440
218 Ga0439433_0001557 3300041999 Bacteria 4749
219 Ga0439433_0016222 3300041999 Bacteria 1649
220 Ga0439433_0081437 3300041999 Bacteria 788
221 Ga0439442_000002 3300042002 Bacteria 85659
222 Ga0439442_000264 3300042002 Bacteria 12762
223 Ga0439442_004037 3300042002 Bacteria 2910
224 Ga0439442_004633 3300042002 Bacteria 2732
225 Ga0439442_068795 3300042002 Bacteria 753
226 Ga0439442_139928 3300042002 Bacteria 535
227 Ga0439432_077437 3300042006 Bacteria 1009
228 Ga0439449_0003948 3300042007 Bacteria 5743
229 Ga0439449_0033640 3300042007 Bacteria 1909
230 Ga0439449_0207524 3300042007 Bacteria 733
231 Ga0439449_0209211 3300042007 Bacteria 730
232 Ga0439457_005783 3300042014 Bacteria 3071
233 Ga0439457_017346 3300042014 Bacteria 1599
234 Ga0439462_0203248 3300042015 Bacteria 564
235 Ga0450911_020648 3300042115 Bacteria 860
236 Ga0450919_012613 3300042121 Bacteria 958
237 Ga0450920_000222 3300042122 Bacteria 8521
238 Ga0450920_002346 3300042122 Bacteria 3211
239 Ga0450920_055014 3300042122 Bacteria 800
240 Ga0450920_076026 3300042122 Bacteria 685
241 Ga0450923_068818 3300042125 Bacteria 782
242 Ga0450907_000013 3300042146 Bacteria 88569
243 Ga0439446_0336318 3300042156 Bacteria 536
244 Ga0439434_0084771 3300042435 Bacteria 1008
245 Ga0450918_004848 3300042531 Bacteria 2433
246 Ga0495629_0053284 3300046459 Bacteria 2831
247 Ga0495653_0109092 3300046463 Bacteria 1992
248 Ga0495580_0074542 3300046472 Bacteria 2368
249 Ga0495582_0005520 3300046473 Bacteria 7044
250 Ga0495582_0173621 3300046473 Bacteria 1227
251 Ga0495639_0172724 3300046475 Bacteria 1049
252 Ga0495662_0009758 3300046476 Bacteria 4713
253 Ga0495662_0271756 3300046476 Bacteria 834
254 Ga0495664_0900146 3300046477 Bacteria 517
255 Ga0495594_0125398 3300046499 Bacteria 1453
256 Ga0495583_0439640 3300046506 Bacteria 511
257 Ga0495630_0887445 3300046517 Bacteria 679
258 Ga0495630_1398979 3300046517 Bacteria 526
259 Ga0495643_0223352 3300046522 Bacteria 892
260 Ga0495642_0071981 3300046528 Bacteria 1447
261 Ga0495665_0006715 3300046531 Bacteria 6202
262 Ga0495665_0032014 3300046531 Bacteria 2813
263 Ga0495586_0001286 3300046535 Bacteria 14034
264 Ga0495586_0009118 3300046535 Bacteria 5277
265 Ga0495586_0178591 3300046535 Bacteria 1200
266 Ga0495587_0015817 3300046536 Bacteria 4703
267 Ga0495645_0001034 3300046543 Bacteria 18942
268 Ga0495633_0054407 3300046558 Bacteria 1883
269 Ga0495667_0008660 3300046559 Bacteria 6906
270 Ga0495656_0026264 3300046615 Bacteria 2317
271 Ga0495668_0043744 3300046616 Bacteria 2490
272 Ga0495635_0079782 3300046663 Bacteria 2240
273 Ga0495588_0036484 3300046674 Bacteria 2494
274 Ga0495588_0092731 3300046674 Bacteria 1583
275 Ga0495588_0125012 3300046674 Bacteria 1356
276 Ga0495588_0157726 3300046674 Bacteria 1200
277 Ga0495588_0687408 3300046674 Bacteria 535
278 Ga0495657_0064601 3300046675 Bacteria 2410
279 Ga0495670_0024302 3300046691 Bacteria 2995
280 Ga0495670_0291741 3300046691 Bacteria 873
281 Ga0495600_0032232 3300046809 Bacteria 3399
282 Ga0495600_0116864 3300046809 Bacteria 1736
283 Ga0495600_0150513 3300046809 Bacteria 1507
284 Ga0495581_0018292 3300047315 Bacteria 4070
285 Ga0495581_0020845 3300047315 Bacteria 3802
286 Ga0495581_0072648 3300047315 Bacteria 1990
287 Ga0495581_0355837 3300047315 Bacteria 855
288 Ga0495680_0162755 3300047322 Bacteria 1619
289 Ga0495680_0528309 3300047322 Bacteria 797
290 Ga0495675_0089243 3300047444 Bacteria 1935
291 Ga0495675_0092455 3300047444 Bacteria 1898
292 Ga0495685_089374 3300047447 Bacteria 1022
293 Ga0495593_0096545 3300047673 Bacteria 1518
294 Ga0495615_0174057 3300048090 Bacteria 653
295 Ga0496100_0027872 3300048903 Bacteria 3477
296 Ga0496100_0452285 3300048903 Bacteria 984
297 Ga0496101_0011576 3300048904 Bacteria 5858
298 Ga0496101_0187143 3300048904 Bacteria 1596
299 Ga0496101_0399890 3300048904 Bacteria 1081
300 Ga0496101_0937007 3300048904 Bacteria 681
301 Ga0496102_0039409 3300048905 Bacteria 4269
302 Ga0496102_0051775 3300048905 Bacteria 3740
303 Ga0496102_0079995 3300048905 Bacteria 3010
304 Ga0496102_1167356 3300048905 Bacteria 689
305 Ga0496102_1436033 3300048905 Bacteria 609
306 Ga0496103_0016580 3300048906 Bacteria 4396
307 Ga0496103_0042802 3300048906 Bacteria 2787
308 Ga0496103_0067390 3300048906 Bacteria 2235
309 Ga0496103_0120876 3300048906 Bacteria 1668
310 Ga0496104_0017289 3300048907 Bacteria 6563
311 Ga0496104_0160196 3300048907 Bacteria 2159
312 Ga0496104_0398536 3300048907 Bacteria 1288
313 Ga0496105_0064231 3300048908 Bacteria 3028
314 Ga0496105_0116048 3300048908 Bacteria 2208
315 Ga0496106_0004849 3300048909 Bacteria 9956
316 Ga0496106_0235770 3300048909 Bacteria 1461
317 Ga0496106_0498251 3300048909 Bacteria 978
318 Ga0496107_0004262 3300048910 Bacteria 9673
319 Ga0496107_0055783 3300048910 Bacteria 2853
320 Ga0496107_0256037 3300048910 Bacteria 1302
321 Ga0496108_0066690 3300048911 Bacteria 3035
322 Ga0496108_0342387 3300048911 Bacteria 1305
323 Ga0496108_0413202 3300048911 Bacteria 1178
324 Ga0496109_0134604 3300048912 Bacteria 2308
325 Ga0496110_0027792 3300048913 Bacteria 4852
326 Ga0496110_0053903 3300048913 Bacteria 3536
327 Ga0496111_0005943 3300048914 Bacteria 7873
328 Ga0496111_0155901 3300048914 Bacteria 1694
329 Ga0496112_0183769 3300048915 Bacteria 2054
330 Ga0496112_0448599 3300048915 Bacteria 1228
331 Ga0496113_0039876 3300048916 Bacteria 3458
332 Ga0496113_0180881 3300048916 Bacteria 1671
333 Ga0496114_0020633 3300048917 Bacteria 5349
334 Ga0496114_0171232 3300048917 Bacteria 1892
335 Ga0496114_0238221 3300048917 Bacteria 1599
336 Ga0496115_0021587 3300048918 Bacteria 4975
337 Ga0496115_0227374 3300048918 Bacteria 1539
338 Ga0496117_0503264 3300048920 Bacteria 587
339 Ga0496124_0027655 3300048927 Bacteria 5085
340 Ga0496125_0087159 3300048928 Bacteria 2359
341 Ga0501323_090252 3300049539 Bacteria 510
342 Ga0501325_058671 3300049541 Bacteria 504
343 Ga0501032_0004616 3300049569 Bacteria 10361
344 Ga0501032_0650572 3300049569 Bacteria 669
345 Ga0501033_1087024 3300049570 Bacteria 532
346 Ga0501034_0000669 3300049571 Bacteria 52088
347 Ga0501037_0000272 3300049573 Bacteria 44618
348 Ga0501038_0000252 3300049574 Bacteria 45401
349 Ga0501038_0647031 3300049574 Bacteria 796
350 Ga0501043_0015940 3300049579 Bacteria 5891
351 Ga0501043_0249306 3300049579 Bacteria 1368
352 Ga0501070_0736008 3300049586 Bacteria 778
353 Ga0501266_023172 3300049763 Bacteria 857
354 Ga0501279_049752 3300049775 Bacteria 662
355 Ga0501044_0007570 3300049823 Bacteria 11936
356 Ga0501044_1125075 3300049823 Bacteria 654
357 nmdc:mga06z11_512236_c1 3300050494 Bacteria 727
358 Ga0590075_099553 3300059424 Bacteria 757
359 Ga0587072_002812 3300059643 Bacteria 2373
360 2939650825 2939647034 Bacteria 4681660
361 2691515698 2690315906 Bacteria 4517044
362 2808828245 2808606357 Bacteria 4466944
363 2808892803 2808606370 Bacteria 4942454
364 2857742867 2857740372 Bacteria 4782044
365 2904779075 2904776348 Bacteria 4658726
366 2910809758 2910809715 Bacteria 4982797
367 2919037197 2919034639 Bacteria 4763403
368 2919061487 2919059106 Bacteria 4991624
369 2919542940 2919538618 Bacteria 4677069
370 2932427459 2932426870 Bacteria 4547726
371 2933419429 2933418574 Bacteria 4476724
372 2939601018 2939598168 Bacteria 4687164
373 2939677036 2939674588 Bacteria 4844420
374 2945922262 2945920336 Bacteria 4501603
375 2945944295 2945941187 Bacteria 4682474
376 2946037478 2946037020 Bacteria 4900426
377 2953999176 2953998280 Bacteria 4812144
378 8004022085 8004021418 Bacteria 4313954
379 8004025808 8004025490 Bacteria 4327753
380 8054109328 8054107350 Bacteria 5022511
381 LJQas_1000684
382 LJQas_1001169
383 Ga0055532_1004259
384 Ga0055527_1000005
385 Ga0055535_1021830
386 Ga0055542_1000006
387 Ga0055542_1005479
388 Ga0055529_1000013
389 Ga0065714_10117718
390 Ga0065714_10159126
391 Ga0065714_10332856
392 Ga0065712_10114067
393 Ga0070676_10001684
394 Ga0070670_100046629
395 Ga0070670_100936879
396 Ga0070677_10009663
397 Ga0070677_10014177
398 Ga0070666_10002892
399 Ga0070666_10168254
400 Ga0070668_100172740
401 Ga0070669_100045035
402 Ga0070675_100003219
403 Ga0070675_101502956
404 Ga0070674_100144469
405 Ga0070673_100018812
406 Ga0070673_102168158
407 Ga0070667_100022662
408 Ga0070678_100602607
409 Ga0070698_101397289
410 Ga0070672_100064550
411 Ga0070672_100770505
412 Ga0068864_101186088
413 Ga0068870_11431297
414 Ga0068863_101089246
415 Ga0075364_10345294
416 Ga0075432_10001429
417 Ga0075432_10259790
418 Ga0075367_10402564
419 Ga0105251_10016957
420 Ga0105244_10015759
421 Ga0105244_10036369
422 Ga0105244_10041218
423 Ga0105244_10137328
424 Ga0105243_10113227
425 Ga0105243_10163685
426 Ga0105243_10821877
427 Ga0105242_10065471
428 Ga0105248_10011701
429 Ga0105238_10329792
430 Ga0105246_10007180
431 Ga0105246_10007805
432 Ga0105246_10103699
433 Ga0105246_11262022
434 Ga0157373_10029196
435 Ga0157371_10038200
436 Ga0157371_10065379
437 Ga0157370_10007935
438 Ga0157369_10033455
439 Ga0157369_10058864
440 Ga0157374_11069876
441 Ga0163162_10007835
442 Ga0163162_10123336
443 Ga0163162_10191279
444 Ga0157375_10052499
445 Ga0157375_10515993
446 Ga0157375_10720340
447 Ga0157375_10820604
448 Ga0209672_100003
449 Ga0209147_101008
450 Ga0209258_106034
451 Ga0209148_1000004
452 Ga0209148_1005178
453 Ga0209455_1000046
454 Ga0209051_1001084
455 Ga0207697_10000359
456 Ga0207697_10010187
457 Ga0207655_1026521
458 Ga0207655_1039899
459 Ga0207655_1119058
460 Ga0207655_1132878
461 Ga0207682_10000797
462 Ga0207688_10168630
463 Ga0207680_10492128
464 Ga0207680_11187829
465 Ga0207645_10004818
466 Ga0207645_10288078
467 Ga0207643_10081200
468 Ga0207681_10087184
469 Ga0207650_10003553
470 Ga0207650_11558760
471 Ga0207644_10382808
472 Ga0207686_10102206
473 Ga0207709_10004550
474 Ga0207709_10809114
475 Ga0207669_10066505
476 Ga0207691_10050929
477 Ga0207711_10103140
478 Ga0207651_10201744
479 Ga0207668_10042482
480 Ga0207658_10140662
481 Ga0207641_10398765
482 Ga0207683_10003098
483 Ga0207683_10184233
484 Ga0207683_10400109
485 Ga0207428_10437278
486 Ga0307408_100018702
487 Ga0307408_100054144
488 Ga0307408_100060959
489 Ga0307408_100115912
490 Ga0307408_100129573
491 Ga0307408_100248111
492 Ga0307408_100253953
493 Ga0307408_100308755
494 Ga0307408_100399975
495 Ga0307408_100539544
496 Ga0307408_100960432
497 Ga0307408_101061460
498 Ga0307405_10065445
499 Ga0307405_10088375
500 Ga0307405_10113356
501 Ga0307405_10124920
502 Ga0307405_10271654
503 Ga0307405_10275566
504 Ga0307405_10374374
505 Ga0307405_10738001
506 Ga0307413_10042740
507 Ga0307413_10055326
508 Ga0307413_10148919
509 Ga0307413_10262067
510 Ga0307413_10278701
511 Ga0307413_10476342
512 Ga0307413_10478749
513 Ga0307413_10612037
514 Ga0307413_11045444
515 Ga0307410_10034332
516 Ga0307410_10037022
517 Ga0307410_10079367
518 Ga0307410_10134888
519 Ga0307410_10140147
520 Ga0307410_10438102
521 Ga0307410_10463635
522 Ga0307410_10584806
523 Ga0307410_10652792
524 Ga0307410_10665854
525 Ga0307410_11420861
526 Ga0307410_11638950
527 Ga0307406_10067295
528 Ga0307406_10679533
529 Ga0307406_10930122
530 Ga0307406_10961819
531 Ga0307406_11232885
532 Ga0307407_10075315
533 Ga0307407_10102667
534 Ga0307407_10244158
535 Ga0307407_10303320
536 Ga0307407_10436285
537 Ga0307407_10493365
538 Ga0307412_10000949
539 Ga0307412_10048943
540 Ga0307412_10123471
541 Ga0307412_10133437
542 Ga0307412_10152777
543 Ga0307412_10178610
544 Ga0307412_10220538
545 Ga0307412_10228789
546 Ga0307412_10261865
547 Ga0307412_10432614
548 Ga0307412_10454975
549 Ga0307412_10455642
550 Ga0307412_10545494
551 Ga0307409_100050029
552 Ga0307409_100057818
553 Ga0307409_100063873
554 Ga0307409_100078236
555 Ga0307409_100093832
556 Ga0307409_100167005
557 Ga0307409_100328340
558 Ga0307409_100474824
559 Ga0307409_101428013
560 Ga0307409_102307571
561 Ga0307409_102343908
562 Ga0307416_100161099
563 Ga0307416_100173557
564 Ga0307416_100174591
565 Ga0307416_100176770
566 Ga0307416_100235702
567 Ga0307416_100387302
568 Ga0307416_100388662
569 Ga0307416_100495093
570 Ga0307416_100532037
571 Ga0307416_100837171
572 Ga0307416_101049113
573 Ga0307416_103181324
574 Ga0307414_10164213
575 Ga0307414_10451713
576 Ga0307414_10820065
577 Ga0307414_11026136
578 Ga0307414_11915961
579 Ga0307411_10803838
580 Ga0307411_10889584
581 Ga0307411_11498487
582 Ga0307411_11565080
583 Ga0307415_100304631
584 Ga0307415_100463918
585 Ga0307415_101098355
586 Ga0373943_0593675
587 Ga0395899_0561605
588 Ga0395900_0075197
589 Ga0395901_0070353
590 Ga0439436_0015457
591 Ga0439436_0033614
592 Ga0439439_0019425
593 Ga0439447_154560
594 Ga0439466_0009426
595 Ga0439466_0124261
596 Ga0439465_0072569
597 Ga0439433_0001140
598 Ga0439433_0001557
599 Ga0439433_0016222
600 Ga0439433_0081437
601 Ga0439442_000002
602 Ga0439442_000264
603 Ga0439442_004037
604 Ga0439442_004633
605 Ga0439442_068795
606 Ga0439442_139928
607 Ga0439432_077437
608 Ga0439449_0003948
609 Ga0439449_0033640
610 Ga0439449_0207524
611 Ga0439449_0209211
612 Ga0439457_005783
613 Ga0439457_017346
614 Ga0439462_0203248
615 Ga0450911_020648
616 Ga0450919_012613
617 Ga0450920_000222
618 Ga0450920_002346
619 Ga0450920_055014
620 Ga0450920_076026
621 Ga0450923_068818
622 Ga0450907_000013
623 Ga0439446_0336318
624 Ga0439434_0084771
625 Ga0450918_004848
626 Ga0495629_0053284
627 Ga0495653_0109092
628 Ga0495580_0074542
629 Ga0495582_0005520
630 Ga0495582_0173621
631 Ga0495639_0172724
632 Ga0495662_0009758
633 Ga0495662_0271756
634 Ga0495664_0900146
635 Ga0495594_0125398
636 Ga0495583_0439640
637 Ga0495630_0887445
638 Ga0495630_1398979
639 Ga0495643_0223352
640 Ga0495642_0071981
641 Ga0495665_0006715
642 Ga0495665_0032014
643 Ga0495586_0001286
644 Ga0495586_0009118
645 Ga0495586_0178591
646 Ga0495587_0015817
647 Ga0495645_0001034
648 Ga0495633_0054407
649 Ga0495667_0008660
650 Ga0495656_0026264
651 Ga0495668_0043744
652 Ga0495635_0079782
653 Ga0495588_0036484
654 Ga0495588_0092731
655 Ga0495588_0125012
656 Ga0495588_0157726
657 Ga0495588_0687408
658 Ga0495657_0064601
659 Ga0495670_0024302
660 Ga0495670_0291741
661 Ga0495600_0032232
662 Ga0495600_0116864
663 Ga0495600_0150513
664 Ga0495581_0018292
665 Ga0495581_0020845
666 Ga0495581_0072648
667 Ga0495581_0355837
668 Ga0495680_0162755
669 Ga0495680_0528309
670 Ga0495675_0089243
671 Ga0495675_0092455
672 Ga0495685_089374
673 Ga0495593_0096545
674 Ga0495615_0174057
675 Ga0496100_0027872
676 Ga0496100_0452285
677 Ga0496101_0011576
678 Ga0496101_0187143
679 Ga0496101_0399890
680 Ga0496101_0937007
681 Ga0496102_0039409
682 Ga0496102_0051775
683 Ga0496102_0079995
684 Ga0496102_1167356
685 Ga0496102_1436033
686 Ga0496103_0016580
687 Ga0496103_0042802
688 Ga0496103_0067390
689 Ga0496103_0120876
690 Ga0496104_0017289
691 Ga0496104_0160196
692 Ga0496104_0398536
693 Ga0496105_0064231
694 Ga0496105_0116048
695 Ga0496106_0004849
696 Ga0496106_0235770
697 Ga0496106_0498251
698 Ga0496107_0004262
699 Ga0496107_0055783
700 Ga0496107_0256037
701 Ga0496108_0066690
702 Ga0496108_0342387
703 Ga0496108_0413202
704 Ga0496109_0134604
705 Ga0496110_0027792
706 Ga0496110_0053903
707 Ga0496111_0005943
708 Ga0496111_0155901
709 Ga0496112_0183769
710 Ga0496112_0448599
711 Ga0496113_0039876
712 Ga0496113_0180881
713 Ga0496114_0020633
714 Ga0496114_0171232
715 Ga0496114_0238221
716 Ga0496115_0021587
717 Ga0496115_0227374
718 Ga0496117_0503264
719 Ga0496124_0027655
720 Ga0496125_0087159
721 Ga0501323_090252
722 Ga0501325_058671
723 Ga0501032_0004616
724 Ga0501032_0650572
725 Ga0501033_1087024
726 Ga0501034_0000669
727 Ga0501037_0000272
728 Ga0501038_0000252
729 Ga0501038_0647031
730 Ga0501043_0015940
731 Ga0501043_0249306
732 Ga0501070_0736008
733 Ga0501266_023172
734 Ga0501279_049752
735 Ga0501044_0007570
736 Ga0501044_1125075
737 nmdc:mga06z11_512236_c1
738 Ga0590075_099553
739 Ga0587072_002812
740 2939650825
741 2691515698
742 2808828245
743 2808892803
744 2857742867
745 2904779075
746 2910809758
747 2919037197
748 2919061487
749 2919542940
750 2932427459
751 2933419429
752 2939601018
753 2939677036
754 2945922262
755 2945944295
756 2946037478
757 2953999176
758 8004022085
759 8004025808
760 8054109328

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

60

109

0.97

PF12840

HTH_20

Helix-turn-helix domain

58

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.9248 41 120
1wq2-assembly1.cif.gz_B neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.9096 46 106
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9066 34 120
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.8998 34 120
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8996 50 107
ID Description Score Start End Superfamily
3f6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9248 41 120 1.10.10.10
af_O53773_1_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9234 41 120 1.10.10.10
af_Q54FU1_288_364_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9099 46 106 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9087 35 119 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9084 46 105 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1Q4A6C4-F1-model_v4 Transcriptional regulator 0.9742 38 118 GO:0003700
GO:0046685
AF-A0A514Z6I9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.95 35 112 GO:0003677
GO:0003700
AF-J9SI29-F1-model_v4 Putative transcriptional regulators 0.9342 36 118 GO:0003700
GO:0046685
AF-A0A2N9JDG0-F1-model_v4 HTH arsR-type domain-containing protein 0.9341 38 118 GO:0003700
AF-A0A315SBY3-F1-model_v4 deleted 0.925 32 118

Map