F428790

General Info

Members Datasets Scaffolds Average Seq Length
380 245 360 155

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0448662|Ga0501034_0448662_309_854
Length 181
Sequence LAHHRTKLEACNSTIRNQGFSDMRLALYQPDIAQNTGTILRLGACLGVAVDVIGPTGFDMSDRALKRAALDYLEHVDLTRHASFSDFINSRASGEASQQRGRLVLLSAHAETPHYEFAFDPNDTLMLGRESAGVPEAVHSAADARITIPMRPGLRSLNVAVTAALVLGEALRQTGGFPSGS

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
3 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
4 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
5 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
6 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
7 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
8 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
9 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
128 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
150 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
151 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
226 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
230 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
231 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
236 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
237 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
238 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
239 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
240 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
241 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
242 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
243 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
244 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
245 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.74
Metatranscriptomes 0
Isolates 5.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.89
Nodule 4.21
Rhizoplane 8.16
Rhizosphere 81.05
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10231415 3300003320 Bacteria 1661
2 Ga0070658_10002782 3300005327 Bacteria 14541
3 Ga0070690_100980302 3300005330 Unclassified 665
4 Ga0070670_101124377 3300005331 Bacteria 717
5 Ga0068869_100102669 3300005334 Bacteria 2165
6 Ga0070680_100004299 3300005336 Bacteria 10709
7 Ga0070680_100093883 3300005336 Bacteria 2486
8 Ga0070682_100011285 3300005337 Bacteria 5101
9 Ga0070660_100009522 3300005339 Bacteria 6837
10 Ga0070660_100016681 3300005339 Bacteria 5338
11 Ga0070689_100829813 3300005340 Bacteria 814
12 Ga0070691_10001427 3300005341 Bacteria 10202
13 Ga0070691_10013433 3300005341 Bacteria 3750
14 Ga0070692_10087728 3300005345 Bacteria 1686
15 Ga0070668_101430609 3300005347 Bacteria 631
16 Ga0070669_100234069 3300005353 Bacteria 1457
17 Ga0070669_100424376 3300005353 Bacteria 1092
18 Ga0070659_100297697 3300005366 Bacteria 1345
19 Ga0070667_101049198 3300005367 Bacteria 761
20 Ga0070709_10003240 3300005434 Bacteria 8732
21 Ga0070713_100000016 3300005436 Bacteria 121229
22 Ga0070705_100168598 3300005440 Bacteria 1471
23 Ga0070700_100806971 3300005441 Bacteria 756
24 Ga0070694_100086470 3300005444 Bacteria 2191
25 Ga0070708_100788037 3300005445 Unclassified 894
26 Ga0070663_100002647 3300005455 Bacteria 10133
27 Ga0070663_100079156 3300005455 Bacteria 2411
28 Ga0070663_100160064 3300005455 Bacteria 1732
29 Ga0070663_100458197 3300005455 Bacteria 1052
30 Ga0070678_100112862 3300005456 Bacteria 2129
31 Ga0070662_100383988 3300005457 Bacteria 1156
32 Ga0070681_10052459 3300005458 Bacteria 4067
33 Ga0070681_10347963 3300005458 Unclassified 1392
34 Ga0070679_100070068 3300005530 Bacteria 3498
35 Ga0068853_100002720 3300005539 Bacteria 13352
36 Ga0070686_100188302 3300005544 Bacteria 1471
37 Ga0070696_100033380 3300005546 Bacteria 3536
38 Ga0070693_100003701 3300005547 Bacteria 7150
39 Ga0070693_100376725 3300005547 Bacteria 978
40 Ga0070704_100364439 3300005549 Bacteria 1223
41 Ga0068855_100103514 3300005563 Bacteria 3275
42 Ga0068855_100163698 3300005563 Bacteria 2523
43 Ga0068855_100165320 3300005563 Bacteria 2509
44 Ga0070664_100118383 3300005564 Bacteria 2317
45 Ga0068857_100201951 3300005577 Bacteria 1812
46 Ga0068857_100300303 3300005577 Bacteria 1480
47 Ga0068854_100065020 3300005578 Bacteria 2651
48 Ga0068854_100717150 3300005578 Bacteria 865
49 Ga0068856_100007521 3300005614 Bacteria 10634
50 Ga0068856_100073952 3300005614 Bacteria 3374
51 Ga0068856_101074563 3300005614 Bacteria 822
52 Ga0070702_100040273 3300005615 Bacteria 2613
53 Ga0068852_100328531 3300005616 Bacteria 1487
54 Ga0068852_101148729 3300005616 Bacteria 797
55 Ga0068859_100322702 3300005617 Bacteria 1638
56 Ga0068864_100156578 3300005618 Bacteria 2068
57 Ga0068864_100224835 3300005618 Bacteria 1733
58 Ga0068864_100371254 3300005618 Bacteria 1354
59 Ga0068861_100305921 3300005719 Bacteria 1379
60 Ga0068870_10048816 3300005840 Bacteria 2230
61 Ga0068858_100105313 3300005842 Bacteria 2632
62 Ga0068858_100638513 3300005842 Bacteria 1034
63 Ga0068860_100264857 3300005843 Bacteria 1676
64 Ga0068862_100617501 3300005844 Bacteria 1043
65 Ga0081455_10000291 3300005937 Bacteria 66446
66 Ga0075364_10004906 3300006051 Bacteria 7753
67 Ga0070715_10007631 3300006163 Bacteria 3732
68 Ga0070712_100000617 3300006175 Bacteria 20907
69 Ga0068871_100428861 3300006358 Bacteria 1182
70 Ga0068871_100519851 3300006358 Bacteria 1075
71 Ga0068871_100690083 3300006358 Unclassified 935
72 Ga0075428_101774949 3300006844 Bacteria 643
73 Ga0075430_100042915 3300006846 Bacteria 3823
74 Ga0075430_100415647 3300006846 Bacteria 1110
75 Ga0075431_100040549 3300006847 Bacteria 4799
76 Ga0075433_10025944 3300006852 Bacteria 4957
77 Ga0075433_10124915 3300006852 Bacteria 2285
78 Ga0075434_100000268 3300006871 Bacteria 37082
79 Ga0075434_100144453 3300006871 Bacteria 2399
80 Ga0075434_100601510 3300006871 Unclassified 1119
81 Ga0075429_100016522 3300006880 Bacteria 6394
82 Ga0075436_100000270 3300006914 Bacteria 32650
83 Ga0075436_100158984 3300006914 Bacteria 1592
84 Ga0097620_100322714 3300006931 Bacteria 1638
85 Ga0075435_100051030 3300007076 Bacteria 3331
86 Ga0075435_100237332 3300007076 Bacteria 1550
87 Ga0075435_100317807 3300007076 Bacteria 1333
88 Ga0111539_10012926 3300009094 Bacteria 10447
89 Ga0111539_10217322 3300009094 Bacteria 2226
90 Ga0105245_10514426 3300009098 Bacteria 1215
91 Ga0105247_10908454 3300009101 Bacteria 681
92 Ga0105243_10047568 3300009148 Bacteria 3378
93 Ga0105241_10031831 3300009174 Bacteria 3950
94 Ga0105241_10245506 3300009174 Unclassified 1515
95 Ga0105241_10511104 3300009174 Bacteria 1073
96 Ga0105242_10258217 3300009176 Bacteria 1573
97 Ga0105237_10013621 3300009545 Bacteria 8517
98 Ga0105238_10023535 3300009551 Bacteria 6276
99 Ga0105238_10039520 3300009551 Bacteria 4785
100 Ga0105249_11102848 3300009553 Bacteria 864
101 Ga0099796_10035990 3300010159 Bacteria 1646
102 Ga0105239_10659730 3300010375 Bacteria 1195
103 Ga0105239_10861518 3300010375 Bacteria 1039
104 Ga0105239_12676535 3300010375 Unclassified 582
105 Ga0105246_10016784 3300011119 Bacteria 4643
106 Ga0157373_10040551 3300013100 Bacteria 3331
107 Ga0157373_10699154 3300013100 Bacteria 743
108 Ga0157370_10169150 3300013104 Bacteria 2032
109 Ga0157370_10217255 3300013104 Bacteria 1771
110 Ga0157372_10029169 3300013307 Bacteria 6022
111 Ga0157372_11569286 3300013307 Bacteria 758
112 Ga0157375_10131847 3300013308 Bacteria 2619
113 Ga0157379_10183266 3300014968 Bacteria 1891
114 Ga0157379_10189538 3300014968 Bacteria 1858
115 Ga0157379_10896749 3300014968 Bacteria 841
116 Ga0157379_11474644 3300014968 Unclassified 661
117 Ga0157376_10521851 3300014969 Bacteria 1171
118 Ga0163161_10081488 3300017792 Bacteria 2383
119 Ga0207692_10059080 3300025898 Bacteria 1979
120 Ga0207647_10034380 3300025904 Bacteria 3236
121 Ga0207699_10000295 3300025906 Bacteria 26738
122 Ga0207643_10385251 3300025908 Bacteria 884
123 Ga0207705_10000158 3300025909 Bacteria 73213
124 Ga0207654_10016546 3300025911 Bacteria 3842
125 Ga0207707_10018654 3300025912 Bacteria 6049
126 Ga0207671_10052518 3300025914 Bacteria 3020
127 Ga0207693_10008961 3300025915 Bacteria 8164
128 Ga0207660_10002303 3300025917 Bacteria 12578
129 Ga0207657_10000813 3300025919 Bacteria 32997
130 Ga0207657_10031208 3300025919 Bacteria 4829
131 Ga0207694_10048462 3300025924 Bacteria 3287
132 Ga0207694_10080669 3300025924 Bacteria 2554
133 Ga0207700_10000005 3300025928 Bacteria 394836
134 Ga0207670_10592571 3300025936 Bacteria 909
135 Ga0207704_10845224 3300025938 Bacteria 767
136 Ga0207689_10229822 3300025942 Bacteria 1533
137 Ga0207679_10324857 3300025945 Bacteria 1333
138 Ga0207667_10020575 3300025949 Bacteria 7333
139 Ga0207667_10122040 3300025949 Bacteria 2685
140 Ga0207667_10223881 3300025949 Bacteria 1927
141 Ga0207640_10114808 3300025981 Bacteria 1917
142 Ga0207640_10935172 3300025981 Bacteria 759
143 Ga0207658_10445423 3300025986 Bacteria 1146
144 Ga0207703_10205984 3300026035 Bacteria 1751
145 Ga0207703_10666412 3300026035 Bacteria 988
146 Ga0207639_10002122 3300026041 Bacteria 13359
147 Ga0207639_10040205 3300026041 Bacteria 3489
148 Ga0207678_10000647 3300026067 Bacteria 32061
149 Ga0207678_10056727 3300026067 Bacteria 3372
150 Ga0207678_10100836 3300026067 Bacteria 2466
151 Ga0207678_10462080 3300026067 Bacteria 1104
152 Ga0207708_10877890 3300026075 Bacteria 775
153 Ga0207702_10000102 3300026078 Bacteria 99313
154 Ga0207648_10783605 3300026089 Bacteria 887
155 Ga0207676_10223295 3300026095 Bacteria 1679
156 Ga0207676_11376913 3300026095 Bacteria 701
157 Ga0207674_10163255 3300026116 Bacteria 2182
158 Ga0207683_10114165 3300026121 Bacteria 2420
159 Ga0207698_10247490 3300026142 Bacteria 1629
160 Ga0207428_10039217 3300027907 Bacteria 3845
161 Ga0207428_10066860 3300027907 Bacteria 2831
162 Ga0268265_10321327 3300028380 Bacteria 1402
163 Ga0268264_10492341 3300028381 Bacteria 1194
164 Ga0265328_10030234 3300031239 Bacteria 2019
165 Ga0265331_10000007 3300031250 Bacteria 331074
166 Ga0265327_10123884 3300031251 Bacteria 1222
167 Ga0307408_101097818 3300031548 Bacteria 738
168 Ga0265314_10013579 3300031711 Bacteria 6571
169 Ga0307415_100922096 3300032126 Unclassified 807
170 Ga0373928_0013193 3300035084 Bacteria 1657
171 Ga0373929_0130378 3300035085 Bacteria 659
172 Ga0373949_0047922 3300035090 Bacteria 1069
173 Ga0373951_0025948 3300035091 Bacteria 1363
174 Ga0373932_0039919 3300035112 Bacteria 1348
175 Ga0373932_0150356 3300035112 Bacteria 798
176 Ga0373932_0368535 3300035112 Bacteria 550
177 Ga0373939_0022774 3300035114 Bacteria 1729
178 Ga0373941_0032472 3300035115 Bacteria 1563
179 Ga0373941_0165329 3300035115 Bacteria 821
180 Ga0373956_0459150 3300035119 Bacteria 608
181 Ga0373957_0024295 3300035120 Bacteria 2176
182 Ga0373960_0131207 3300035121 Bacteria 840
183 Ga0373955_0417865 3300035172 Unclassified 816
184 Ga0373962_0082670 3300035242 Bacteria 977
185 Ga0373924_0080251 3300035410 Bacteria 1387
186 Ga0373931_0007893 3300035691 Bacteria 5033
187 Ga0373931_0036076 3300035691 Bacteria 2575
188 Ga0373931_0497734 3300035691 Bacteria 786
189 Ga0373935_0112415 3300035692 Bacteria 1809
190 Ga0373933_0011395 3300035724 Bacteria 4898
191 Ga0373933_0083236 3300035724 Bacteria 1965
192 Ga0373937_0285663 3300036401 Bacteria 1558
193 Ga0373925_0523509 3300037068 Bacteria 974
194 Ga0395899_0205918 3300037312 Bacteria 1369
195 Ga0395899_0601668 3300037312 Unclassified 700
196 Ga0395898_0525499 3300037466 Bacteria 1125
197 Ga0436364_0183465 3300037853 Bacteria 1055
198 Ga0395901_0621620 3300038443 Unclassified 1087
199 Ga0400490_17418 3300038726 Bacteria 1905
200 Ga0400485_03793 3300038735 Unclassified 1167
201 Ga0400485_12104 3300038735 Bacteria 2407
202 Ga0400486_23404 3300038742 Unclassified 3088
203 Ga0436365_0608492 3300039437 Bacteria 1403
204 Ga0439448_0168040 3300042005 Bacteria 765
205 Ga0495603_0577191 3300046455 Bacteria 644
206 Ga0495638_0155924 3300046460 Bacteria 1321
207 Ga0495638_0203355 3300046460 Bacteria 1117
208 Ga0495664_0452335 3300046477 Unclassified 769
209 Ga0495585_0088201 3300046492 Bacteria 1673
210 Ga0495620_0124963 3300046515 Bacteria 1012
211 Ga0495648_0192592 3300046524 Bacteria 1027
212 Ga0495633_0360056 3300046558 Bacteria 659
213 Ga0495667_0482407 3300046559 Unclassified 777
214 Ga0495588_0215559 3300046674 Bacteria 1013
215 Ga0495623_0083288 3300046679 Bacteria 1976
216 Ga0495672_0062037 3300047320 Bacteria 2152
217 Ga0495672_0080468 3300047320 Bacteria 1817
218 Ga0495672_0181398 3300047320 Bacteria 1066
219 Ga0495680_0508564 3300047322 Unclassified 817
220 Ga0496100_0230599 3300048903 Bacteria 1362
221 Ga0496101_0050800 3300048904 Bacteria 2986
222 Ga0496101_0075560 3300048904 Bacteria 2480
223 Ga0496102_0024970 3300048905 Bacteria 5316
224 Ga0496102_0099845 3300048905 Bacteria 2695
225 Ga0496102_0194314 3300048905 Bacteria 1912
226 Ga0496102_0466056 3300048905 Bacteria 1184
227 Ga0496103_0006658 3300048906 Bacteria 6896
228 Ga0496103_0454912 3300048906 Bacteria 821
229 Ga0496104_0003196 3300048907 Bacteria 14081
230 Ga0496104_0077271 3300048907 Bacteria 3172
231 Ga0496105_0153120 3300048908 Bacteria 1895
232 Ga0496105_0165888 3300048908 Bacteria 1812
233 Ga0496105_0198189 3300048908 Bacteria 1639
234 Ga0496106_0005631 3300048909 Bacteria 9269
235 Ga0496106_0029256 3300048909 Bacteria 4105
236 Ga0496106_0128750 3300048909 Bacteria 1984
237 Ga0496106_0149558 3300048909 Bacteria 1841
238 Ga0496107_0013254 3300048910 Bacteria 5761
239 Ga0496108_0695780 3300048911 Bacteria 882
240 Ga0496109_0061066 3300048912 Bacteria 3445
241 Ga0496110_0256030 3300048913 Bacteria 1593
242 Ga0496111_0389011 3300048914 Bacteria 1031
243 Ga0496112_0088145 3300048915 Bacteria 3071
244 Ga0496113_0023402 3300048916 Bacteria 4380
245 Ga0496113_0108009 3300048916 Bacteria 2163
246 Ga0496114_0051168 3300048917 Bacteria 3439
247 Ga0496114_0547552 3300048917 Bacteria 1022
248 Ga0496114_0661597 3300048917 Bacteria 918
249 Ga0496115_0004881 3300048918 Bacteria 9736
250 Ga0496115_0017012 3300048918 Bacteria 5547
251 Ga0496116_0049903 3300048919 Bacteria 2793
252 Ga0496121_0005812 3300048924 Bacteria 15639
253 Ga0496121_0525414 3300048924 Bacteria 746
254 Ga0501031_0011496 3300049568 Bacteria 5770
255 Ga0501032_0003478 3300049569 Bacteria 12055
256 Ga0501032_0189744 3300049569 Bacteria 1343
257 Ga0501032_0564143 3300049569 Viruses 725
258 Ga0501033_0115769 3300049570 Bacteria 1948
259 Ga0501033_1021553 3300049570 Bacteria 552
260 Ga0501034_0000031 3300049571 Bacteria 244022
261 Ga0501034_0065711 3300049571 Bacteria 3640
262 Ga0501034_0448662 3300049571 Bacteria 1208
263 Ga0501034_0917226 3300049571 Bacteria 763
264 Ga0501036_0342071 3300049572 Unclassified 1249
265 Ga0501036_0503526 3300049572 Bacteria 1008
266 Ga0501037_0019123 3300049573 Bacteria 5050
267 Ga0501037_0095429 3300049573 Bacteria 2150
268 Ga0501038_0087372 3300049574 Bacteria 2618
269 Ga0501038_0101961 3300049574 Bacteria 2389
270 Ga0501038_0533177 3300049574 Bacteria 895
271 Ga0501039_0008937 3300049575 Bacteria 7634
272 Ga0501039_0172741 3300049575 Bacteria 1699
273 Ga0501040_0144712 3300049576 Bacteria 1675
274 Ga0501040_0260709 3300049576 Bacteria 1237
275 Ga0501041_0092595 3300049577 Bacteria 1866
276 Ga0501043_0020025 3300049579 Bacteria 5250
277 Ga0501043_0578917 3300049579 Unclassified 831
278 Ga0501046_0005738 3300049580 Bacteria 11079
279 Ga0501046_0011152 3300049580 Bacteria 7698
280 Ga0501046_0055637 3300049580 Bacteria 3108
281 Ga0501047_0002152 3300049581 Bacteria 18843
282 Ga0501047_0070961 3300049581 Bacteria 3353
283 Ga0501047_0103763 3300049581 Bacteria 2724
284 Ga0501047_0104918 3300049581 Bacteria 2707
285 Ga0501047_0161983 3300049581 Bacteria 2109
286 Ga0501048_0005689 3300049582 Bacteria 9478
287 Ga0501067_0001011 3300049583 Bacteria 15105
288 Ga0501067_0007817 3300049583 Bacteria 5947
289 Ga0501067_0211124 3300049583 Bacteria 1081
290 Ga0501068_0712793 3300049584 Bacteria 656
291 Ga0501070_0000345 3300049586 Bacteria 42150
292 Ga0501070_0017149 3300049586 Bacteria 6078
293 Ga0501070_0079269 3300049586 Bacteria 2718
294 Ga0501070_0155049 3300049586 Bacteria 1889
295 Ga0501070_0711352 3300049586 Bacteria 794
296 Ga0501070_0750887 3300049586 Bacteria 769
297 Ga0501071_0045748 3300049587 Bacteria 3142
298 Ga0501071_1341524 3300049587 Unclassified 552
299 Ga0501072_0096766 3300049588 Bacteria 2346
300 Ga0501073_0022223 3300049589 Bacteria 4571
301 Ga0501073_0253691 3300049589 Bacteria 1214
302 Ga0501074_0778718 3300049590 Bacteria 674
303 Ga0501075_0413985 3300049591 Bacteria 1028
304 Ga0501076_0025076 3300049592 Bacteria 4612
305 Ga0501077_0047649 3300049593 Bacteria 2723
306 Ga0501079_0002885 3300049741 Bacteria 12552
307 Ga0501079_0462076 3300049741 Bacteria 997
308 Ga0501079_1055569 3300049741 Unclassified 640
309 Ga0501080_0000629 3300049742 Bacteria 27961
310 Ga0501080_0001220 3300049742 Bacteria 21353
311 Ga0501080_0004144 3300049742 Bacteria 12855
312 Ga0501080_0574025 3300049742 Bacteria 1003
313 Ga0501081_0181008 3300049743 Bacteria 1524
314 Ga0501081_0228480 3300049743 Bacteria 1355
315 Ga0501083_0043049 3300049744 Bacteria 3060
316 Ga0501035_0000054 3300049822 Bacteria 142023
317 Ga0501035_0003869 3300049822 Bacteria 14283
318 Ga0501035_0168720 3300049822 Bacteria 1892
319 Ga0501044_0000013 3300049823 Bacteria 248795
320 Ga0501044_0002940 3300049823 Bacteria 19377
321 Ga0501044_0013916 3300049823 Bacteria 8694
322 Ga0501044_0038410 3300049823 Bacteria 4999
323 Ga0501044_0167281 3300049823 Bacteria 2172
324 Ga0501044_0206724 3300049823 Bacteria 1919
325 Ga0501044_0701780 3300049823 Viruses 897
326 Ga0501045_0056000 3300049824 Bacteria 2884
327 Ga0501045_0165882 3300049824 Bacteria 1645
328 nmdc:mga00v17_33338_c1 3300050491 Bacteria 3051
329 nmdc:mga0qj67_392181_c1 3300050509 Bacteria 1121
330 nmdc:mga06r32_2657_c1 3300050510 Bacteria 15975
331 nmdc:mga06r32_360503_c1 3300050510 Bacteria 1438
332 nmdc:mga06r32_537619_c1 3300050510 Bacteria 1143
333 nmdc:mga08y16_11215_c1 3300050511 Bacteria 9415
334 nmdc:mga08y16_75011_c1 3300050511 Bacteria 3526
335 nmdc:mga08y16_751378_c1 3300050511 Bacteria 971
336 nmdc:mga0n895_2979_c1 3300050512 Bacteria 13434
337 nmdc:mga0n895_304706_c1 3300050512 Bacteria 1615
338 nmdc:mga0rr50_113977_c1 3300050513 Bacteria 2143
339 nmdc:mga0rr50_281497_c1 3300050513 Bacteria 1388
340 nmdc:mga08x19_160_c1 3300050514 Bacteria 55694
341 nmdc:mga08x19_523953_c1 3300050514 Unclassified 838
342 nmdc:mga0a205_2843_c1 3300050515 Bacteria 15314
343 nmdc:mga0a205_607670_c1 3300050515 Bacteria 946
344 Ga0500643_000017 3300053087 Bacteria 305781
345 Ga0500646_0118325 3300053090 Unclassified 849
346 Ga0500592_005594 3300053116 Bacteria 2002
347 Ga0500595_023575 3300053119 Bacteria 2161
348 Ga0500568_0031810 3300053139 Bacteria 2174
349 Ga0500616_0009556 3300053153 Bacteria 5892
350 Ga0500611_053402 3300053727 Bacteria 933
351 Ga0500625_044720 3300053729 Bacteria 2070
352 Ga0500645_039041 3300053730 Bacteria 1408
353 Ga0501084_0001539 3300054114 Bacteria 18342
354 Ga0501084_0182835 3300054114 Bacteria 1770
355 Ga0501084_1013262 3300054114 Bacteria 698
356 Ga0501082_0175519 3300060353 Bacteria 1863
357 Ga0501082_0185568 3300060353 Bacteria 1810
358 Ga0501082_0749398 3300060353 Unclassified 855
359 Ga0501082_0940064 3300060353 Bacteria 756
360 Ga0530510_0032160 3300061734 Bacteria 3773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0711352 Ga0501070_0711352_30_407 121
2 3300049570 Ga0501033_1021553 Ga0501033_1021553_56_439 123
3 3300049741 Ga0501079_1055569 Ga0501079_1055569_238_627 125
4 3300038726 Ga0400490_17418 Ga0400490_17418_1339_1779 129
5 3300038735 Ga0400485_12104 Ga0400485_12104_221_622 129
6 3300046477 Ga0495664_0452335 Ga0495664_0452335_346_750 129
7 3300031548 Ga0307408_101097818 Ga0307408_1010978181 131
8 3300053727 Ga0500611_053402 Ga0500611_053402_466_882 131
9 3300060353 Ga0501082_0749398 Ga0501082_0749398_26_448 132
10 3300035172 Ga0373955_0417865 Ga0373955_0417865_277_744 138
11 3300035410 Ga0373924_0080251 Ga0373924_0080251_21_488 138
12 iso_pu_bacteria 2524023250 2524611195 141
13 3300035112 Ga0373932_0039919 Ga0373932_0039919_566_1015 142
14 iso_pu_bacteria 2935675223 2935683354 144
15 iso_pu_bacteria 2935769743 2935771052 144
16 iso_pu_bacteria 2935777560 2935781220 144
17 iso_pu_bacteria 2935785616 2935786247 144
18 iso_pu_bacteria 2935793552 2935793956 144
19 iso_pu_bacteria 2941531003 2941531676 144
20 iso_pu_bacteria 8016522445 8016528027 144
21 iso_pu_bacteria 8016530956 8016533151 144
22 iso_pu_bacteria 8016548790 8016555736 144
23 iso_pu_bacteria 8016557553 8016564089 144
24 iso_pu_bacteria 8016566248 8016571471 144
25 iso_pu_bacteria 8016575299 8016575726 144
26 iso_pu_bacteria 8016595262 8016601795 144
27 iso_pu_bacteria 8016603502 8016608454 144
28 iso_pu_bacteria 8016613128 8016616412 144
29 iso_pu_bacteria 8019530166 8019532948 144
30 3300005367 Ga0070667_101049198 Ga0070667_1010491981 145
31 3300005844 Ga0068862_100617501 Ga0068862_1006175012 145
32 3300010159 Ga0099796_10035990 Ga0099796_100359902 145
33 3300025898 Ga0207692_10059080 Ga0207692_100590803 145
34 3300028380 Ga0268265_10321327 Ga0268265_103213272 145
35 3300035120 Ga0373957_0024295 Ga0373957_0024295_997_1464 145
36 3300035724 Ga0373933_0083236 Ga0373933_0083236_921_1388 145
37 3300036401 Ga0373937_0285663 Ga0373937_0285663_159_626 145
38 3300037853 Ga0436364_0183465 Ga0436364_0183465_145_642 145
39 3300046559 Ga0495667_0482407 Ga0495667_0482407_171_638 145
40 3300047320 Ga0495672_0080468 Ga0495672_0080468_112_570 145
41 3300047322 Ga0495680_0508564 Ga0495680_0508564_266_733 145
42 3300049586 Ga0501070_0750887 Ga0501070_0750887_53_511 145
43 iso_pu_bacteria 2523231067 2523470751 145
44 iso_pu_bacteria 2738543031 2739349072 145
45 3300005434 Ga0070709_10003240 Ga0070709_100032402 146
46 3300005436 Ga0070713_100000016 Ga0070713_10000001638 146
47 3300005445 Ga0070708_100788037 Ga0070708_1007880373 146
48 3300005539 Ga0068853_100002720 Ga0068853_10000272011 146
49 3300005547 Ga0070693_100376725 Ga0070693_1003767252 146
50 3300005614 Ga0068856_100007521 Ga0068856_10000752114 146
51 3300005618 Ga0068864_100371254 Ga0068864_1003712543 146
52 3300006175 Ga0070712_100000617 Ga0070712_10000061720 146
53 3300006358 Ga0068871_100428861 Ga0068871_1004288612 146
54 3300006358 Ga0068871_100519851 Ga0068871_1005198512 146
55 3300006358 Ga0068871_100690083 Ga0068871_1006900831 146
56 3300006871 Ga0075434_100144453 Ga0075434_1001444534 146
57 3300006871 Ga0075434_100601510 Ga0075434_1006015102 146
58 3300006914 Ga0075436_100000270 Ga0075436_10000027018 146
59 3300006914 Ga0075436_100158984 Ga0075436_1001589841 146
60 3300007076 Ga0075435_100051030 Ga0075435_1000510303 146
61 3300007076 Ga0075435_100317807 Ga0075435_1003178072 146
62 3300009174 Ga0105241_10511104 Ga0105241_105111042 146
63 3300014968 Ga0157379_10189538 Ga0157379_101895383 146
64 3300025906 Ga0207699_10000295 Ga0207699_100002952 146
65 3300025915 Ga0207693_10008961 Ga0207693_100089616 146
66 3300025928 Ga0207700_10000005 Ga0207700_10000005242 146
67 3300026041 Ga0207639_10002122 Ga0207639_100021225 146
68 3300026078 Ga0207702_10000102 Ga0207702_1000010285 146
69 3300035112 Ga0373932_0150356 Ga0373932_0150356_160_612 146
70 3300035691 Ga0373931_0036076 Ga0373931_0036076_163_615 146
71 3300035692 Ga0373935_0112415 Ga0373935_0112415_366_818 146
72 3300035724 Ga0373933_0011395 Ga0373933_0011395_1599_2051 146
73 3300037068 Ga0373925_0523509 Ga0373925_0523509_424_876 146
74 3300046679 Ga0495623_0083288 Ga0495623_0083288_113_565 146
75 3300048905 Ga0496102_0466056 Ga0496102_0466056_710_1162 146
76 3300048909 Ga0496106_0128750 Ga0496106_0128750_135_587 146
77 3300050512 nmdc:mga0n895_304706_c1 nmdc:mga0n895_304706_c1_980_1432 146
78 3300050513 nmdc:mga0rr50_113977_c1 nmdc:mga0rr50_113977_c1_1660_2112 146
79 3300050513 nmdc:mga0rr50_281497_c1 nmdc:mga0rr50_281497_c1_241_693 146
80 3300050514 nmdc:mga08x19_160_c1 nmdc:mga08x19_160_c1_45724_46176 146
81 3300050514 nmdc:mga08x19_523953_c1 nmdc:mga08x19_523953_c1_44_496 146
82 3300005347 Ga0070668_101430609 Ga0070668_1014306091 147
83 3300035691 Ga0373931_0497734 Ga0373931_0497734_227_676 147
84 3300039437 Ga0436365_0608492 Ga0436365_0608492_383_847 147
85 3300005327 Ga0070658_10002782 Ga0070658_100027823 148
86 3300005331 Ga0070670_101124377 Ga0070670_1011243771 148
87 3300005336 Ga0070680_100093883 Ga0070680_1000938833 148
88 3300005339 Ga0070660_100009522 Ga0070660_1000095222 148
89 3300005340 Ga0070689_100829813 Ga0070689_1008298131 148
90 3300005341 Ga0070691_10001427 Ga0070691_100014278 148
91 3300005353 Ga0070669_100234069 Ga0070669_1002340692 148
92 3300005353 Ga0070669_100424376 Ga0070669_1004243761 148
93 3300005455 Ga0070663_100079156 Ga0070663_1000791562 148
94 3300005455 Ga0070663_100160064 Ga0070663_1001600643 148
95 3300005455 Ga0070663_100458197 Ga0070663_1004581972 148
96 3300005457 Ga0070662_100383988 Ga0070662_1003839881 148
97 3300005458 Ga0070681_10347963 Ga0070681_103479632 148
98 3300005530 Ga0070679_100070068 Ga0070679_1000700684 148
99 3300005549 Ga0070704_100364439 Ga0070704_1003644392 148
100 3300005563 Ga0068855_100103514 Ga0068855_1001035142 148
101 3300005563 Ga0068855_100163698 Ga0068855_1001636982 148
102 3300005577 Ga0068857_100300303 Ga0068857_1003003031 148
103 3300005578 Ga0068854_100717150 Ga0068854_1007171502 148
104 3300005614 Ga0068856_101074563 Ga0068856_1010745632 148
105 3300005618 Ga0068864_100224835 Ga0068864_1002248354 148
106 3300005719 Ga0068861_100305921 Ga0068861_1003059211 148
107 3300005842 Ga0068858_100638513 Ga0068858_1006385132 148
108 3300005937 Ga0081455_10000291 Ga0081455_1000029122 148
109 3300006051 Ga0075364_10004906 Ga0075364_100049065 148
110 3300006163 Ga0070715_10007631 Ga0070715_100076313 148
111 3300006844 Ga0075428_101774949 Ga0075428_1017749491 148
112 3300006846 Ga0075430_100042915 Ga0075430_1000429154 148
113 3300006846 Ga0075430_100415647 Ga0075430_1004156471 148
114 3300006847 Ga0075431_100040549 Ga0075431_1000405494 148
115 3300006852 Ga0075433_10025944 Ga0075433_100259442 148
116 3300006852 Ga0075433_10124915 Ga0075433_101249152 148
117 3300006871 Ga0075434_100000268 Ga0075434_1000002688 148
118 3300006880 Ga0075429_100016522 Ga0075429_1000165226 148
119 3300007076 Ga0075435_100237332 Ga0075435_1002373321 148
120 3300009094 Ga0111539_10012926 Ga0111539_100129266 148
121 3300009094 Ga0111539_10217322 Ga0111539_102173222 148
122 3300009101 Ga0105247_10908454 Ga0105247_109084541 148
123 3300009174 Ga0105241_10245506 Ga0105241_102455062 148
124 3300009176 Ga0105242_10258217 Ga0105242_102582173 148
125 3300009551 Ga0105238_10023535 Ga0105238_100235357 148
126 3300010375 Ga0105239_12676535 Ga0105239_126765351 148
127 3300013100 Ga0157373_10040551 Ga0157373_100405513 148
128 3300013104 Ga0157370_10217255 Ga0157370_102172551 148
129 3300013307 Ga0157372_10029169 Ga0157372_100291697 148
130 3300017792 Ga0163161_10081488 Ga0163161_100814883 148
131 3300025909 Ga0207705_10000158 Ga0207705_100001585 148
132 3300025912 Ga0207707_10018654 Ga0207707_100186544 148
133 3300025917 Ga0207660_10002303 Ga0207660_1000230310 148
134 3300025919 Ga0207657_10000813 Ga0207657_1000081328 148
135 3300025924 Ga0207694_10048462 Ga0207694_100484624 148
136 3300025936 Ga0207670_10592571 Ga0207670_105925712 148
137 3300025938 Ga0207704_10845224 Ga0207704_108452242 148
138 3300025949 Ga0207667_10020575 Ga0207667_100205758 148
139 3300025949 Ga0207667_10223881 Ga0207667_102238812 148
140 3300025981 Ga0207640_10935172 Ga0207640_109351722 148
141 3300025986 Ga0207658_10445423 Ga0207658_104454232 148
142 3300026035 Ga0207703_10666412 Ga0207703_106664121 148
143 3300026067 Ga0207678_10056727 Ga0207678_100567271 148
144 3300026067 Ga0207678_10100836 Ga0207678_101008361 148
145 3300026067 Ga0207678_10462080 Ga0207678_104620802 148
146 3300026095 Ga0207676_11376913 Ga0207676_113769131 148
147 3300027907 Ga0207428_10039217 Ga0207428_100392174 148
148 3300027907 Ga0207428_10066860 Ga0207428_100668603 148
149 3300031239 Ga0265328_10030234 Ga0265328_100302342 148
150 3300031250 Ga0265331_10000007 Ga0265331_1000000736 148
151 3300031251 Ga0265327_10123884 Ga0265327_101238842 148
152 3300031711 Ga0265314_10013579 Ga0265314_100135798 148
153 3300035084 Ga0373928_0013193 Ga0373928_0013193_829_1308 148
154 3300035085 Ga0373929_0130378 Ga0373929_0130378_42_521 148
155 3300035090 Ga0373949_0047922 Ga0373949_0047922_313_792 148
156 3300035091 Ga0373951_0025948 Ga0373951_0025948_545_1024 148
157 3300035112 Ga0373932_0368535 Ga0373932_0368535_73_531 148
158 3300035114 Ga0373939_0022774 Ga0373939_0022774_57_536 148
159 3300035115 Ga0373941_0032472 Ga0373941_0032472_216_695 148
160 3300035115 Ga0373941_0165329 Ga0373941_0165329_10_468 148
161 3300035119 Ga0373956_0459150 Ga0373956_0459150_71_532 148
162 3300035121 Ga0373960_0131207 Ga0373960_0131207_198_677 148
163 3300035242 Ga0373962_0082670 Ga0373962_0082670_113_592 148
164 3300035691 Ga0373931_0007893 Ga0373931_0007893_2648_3127 148
165 3300038735 Ga0400485_03793 Ga0400485_03793_122_619 148
166 3300038742 Ga0400486_23404 Ga0400486_23404_1291_1791 148
167 3300042005 Ga0439448_0168040 Ga0439448_0168040_144_602 148
168 3300046455 Ga0495603_0577191 Ga0495603_0577191_152_604 148
169 3300046460 Ga0495638_0155924 Ga0495638_0155924_65_532 148
170 3300046492 Ga0495585_0088201 Ga0495585_0088201_873_1325 148
171 3300046515 Ga0495620_0124963 Ga0495620_0124963_269_727 148
172 3300046524 Ga0495648_0192592 Ga0495648_0192592_208_660 148
173 3300046558 Ga0495633_0360056 Ga0495633_0360056_41_493 148
174 3300046674 Ga0495588_0215559 Ga0495588_0215559_320_772 148
175 3300047320 Ga0495672_0062037 Ga0495672_0062037_459_932 148
176 3300047320 Ga0495672_0181398 Ga0495672_0181398_18_470 148
177 3300048903 Ga0496100_0230599 Ga0496100_0230599_271_882 148
178 3300048904 Ga0496101_0050800 Ga0496101_0050800_1031_1510 148
179 3300048905 Ga0496102_0194314 Ga0496102_0194314_252_731 148
180 3300048907 Ga0496104_0003196 Ga0496104_0003196_2863_3342 148
181 3300048908 Ga0496105_0165888 Ga0496105_0165888_273_752 148
182 3300048908 Ga0496105_0198189 Ga0496105_0198189_364_816 148
183 3300048909 Ga0496106_0029256 Ga0496106_0029256_1806_2264 148
184 3300048909 Ga0496106_0149558 Ga0496106_0149558_299_778 148
185 3300048911 Ga0496108_0695780 Ga0496108_0695780_49_528 148
186 3300048912 Ga0496109_0061066 Ga0496109_0061066_2143_2622 148
187 3300048913 Ga0496110_0256030 Ga0496110_0256030_773_1225 148
188 3300048914 Ga0496111_0389011 Ga0496111_0389011_470_949 148
189 3300048915 Ga0496112_0088145 Ga0496112_0088145_1871_2350 148
190 3300048916 Ga0496113_0023402 Ga0496113_0023402_2737_3216 148
191 3300048916 Ga0496113_0108009 Ga0496113_0108009_1283_1735 148
192 3300048917 Ga0496114_0547552 Ga0496114_0547552_53_532 148
193 3300048917 Ga0496114_0661597 Ga0496114_0661597_241_693 148
194 3300048918 Ga0496115_0017012 Ga0496115_0017012_2893_3372 148
195 3300048919 Ga0496116_0049903 Ga0496116_0049903_1684_2136 148
196 3300048924 Ga0496121_0005812 Ga0496121_0005812_15049_15501 148
197 3300049568 Ga0501031_0011496 Ga0501031_0011496_221_679 148
198 3300049569 Ga0501032_0189744 Ga0501032_0189744_470_928 148
199 3300049570 Ga0501033_0115769 Ga0501033_0115769_1446_1904 148
200 3300049572 Ga0501036_0503526 Ga0501036_0503526_22_474 148
201 3300049573 Ga0501037_0095429 Ga0501037_0095429_1119_1628 148
202 3300049574 Ga0501038_0087372 Ga0501038_0087372_1934_2392 148
203 3300049574 Ga0501038_0533177 Ga0501038_0533177_255_713 148
204 3300049575 Ga0501039_0172741 Ga0501039_0172741_722_1231 148
205 3300049576 Ga0501040_0144712 Ga0501040_0144712_84_593 148
206 3300049577 Ga0501041_0092595 Ga0501041_0092595_23_493 148
207 3300049579 Ga0501043_0578917 Ga0501043_0578917_246_704 148
208 3300049580 Ga0501046_0055637 Ga0501046_0055637_423_890 148
209 3300049581 Ga0501047_0104918 Ga0501047_0104918_260_718 148
210 3300049584 Ga0501068_0712793 Ga0501068_0712793_166_633 148
211 3300049586 Ga0501070_0000345 Ga0501070_0000345_17684_18142 148
212 3300049587 Ga0501071_0045748 Ga0501071_0045748_1374_1883 148
213 3300049587 Ga0501071_1341524 Ga0501071_1341524_84_542 148
214 3300049588 Ga0501072_0096766 Ga0501072_0096766_230_739 148
215 3300049591 Ga0501075_0413985 Ga0501075_0413985_486_965 148
216 3300049592 Ga0501076_0025076 Ga0501076_0025076_2484_2993 148
217 3300049593 Ga0501077_0047649 Ga0501077_0047649_789_1298 148
218 3300049741 Ga0501079_0002885 Ga0501079_0002885_5000_5509 148
219 3300049741 Ga0501079_0462076 Ga0501079_0462076_165_617 148
220 3300049742 Ga0501080_0000629 Ga0501080_0000629_10206_10664 148
221 3300049742 Ga0501080_0004144 Ga0501080_0004144_5208_5717 148
222 3300049743 Ga0501081_0181008 Ga0501081_0181008_828_1337 148
223 3300049743 Ga0501081_0228480 Ga0501081_0228480_680_1147 148
224 3300049744 Ga0501083_0043049 Ga0501083_0043049_1033_1542 148
225 3300049822 Ga0501035_0003869 Ga0501035_0003869_1172_1630 148
226 3300049823 Ga0501044_0002940 Ga0501044_0002940_17748_18206 148
227 3300049823 Ga0501044_0013916 Ga0501044_0013916_5272_5730 148
228 3300049823 Ga0501044_0038410 Ga0501044_0038410_4019_4477 148
229 3300049823 Ga0501044_0206724 Ga0501044_0206724_1436_1894 148
230 3300049823 Ga0501044_0701780 Ga0501044_0701780_337_789 148
231 3300049824 Ga0501045_0056000 Ga0501045_0056000_1118_1627 148
232 3300049824 Ga0501045_0165882 Ga0501045_0165882_1099_1569 148
233 3300050491 nmdc:mga00v17_33338_c1 nmdc:mga00v17_33338_c1_1848_2303 148
234 3300050509 nmdc:mga0qj67_392181_c1 nmdc:mga0qj67_392181_c1_208_657 148
235 3300050510 nmdc:mga06r32_2657_c1 nmdc:mga06r32_2657_c1_9987_10436 148
236 3300050510 nmdc:mga06r32_360503_c1 nmdc:mga06r32_360503_c1_572_1036 148
237 3300050510 nmdc:mga06r32_537619_c1 nmdc:mga06r32_537619_c1_58_525 148
238 3300050511 nmdc:mga08y16_11215_c1 nmdc:mga08y16_11215_c1_2775_3254 148
239 3300050511 nmdc:mga08y16_75011_c1 nmdc:mga08y16_75011_c1_1740_2204 148
240 3300050511 nmdc:mga08y16_751378_c1 nmdc:mga08y16_751378_c1_163_627 148
241 3300050512 nmdc:mga0n895_2979_c1 nmdc:mga0n895_2979_c1_4574_5053 148
242 3300050515 nmdc:mga0a205_2843_c1 nmdc:mga0a205_2843_c1_14748_15227 148
243 3300050515 nmdc:mga0a205_607670_c1 nmdc:mga0a205_607670_c1_426_911 148
244 3300053087 Ga0500643_000017 Ga0500643_000017_294813_295280 148
245 3300053090 Ga0500646_0118325 Ga0500646_0118325_351_818 148
246 3300053116 Ga0500592_005594 Ga0500592_005594_1288_1755 148
247 3300053139 Ga0500568_0031810 Ga0500568_0031810_941_1408 148
248 3300053729 Ga0500625_044720 Ga0500625_044720_1231_1689 148
249 3300053730 Ga0500645_039041 Ga0500645_039041_754_1221 148
250 3300054114 Ga0501084_0001539 Ga0501084_0001539_9273_9782 148
251 3300054114 Ga0501084_1013262 Ga0501084_1013262_89_547 148
252 3300060353 Ga0501082_0940064 Ga0501082_0940064_45_512 148
253 3300061734 Ga0530510_0032160 Ga0530510_0032160_171_680 148
254 iso_pu_bacteria 8045864390 8045864485 148
255 3300005616 Ga0068852_101148729 Ga0068852_1011487292 149
256 3300009553 Ga0105249_11102848 Ga0105249_111028482 149
257 3300014968 Ga0157379_10183266 Ga0157379_101832663 149
258 3300049583 Ga0501067_0007817 Ga0501067_0007817_1528_1998 149
259 3300032126 Ga0307415_100922096 Ga0307415_1009220961 150
260 3300046460 Ga0495638_0203355 Ga0495638_0203355_628_1092 150
261 3300049569 Ga0501032_0003478 Ga0501032_0003478_4199_4690 150
262 3300049571 Ga0501034_0000031 Ga0501034_0000031_31782_32273 150
263 3300049572 Ga0501036_0342071 Ga0501036_0342071_522_1013 150
264 3300049573 Ga0501037_0019123 Ga0501037_0019123_4427_4918 150
265 3300049574 Ga0501038_0101961 Ga0501038_0101961_459_950 150
266 3300049575 Ga0501039_0008937 Ga0501039_0008937_2045_2548 150
267 3300049576 Ga0501040_0260709 Ga0501040_0260709_547_1038 150
268 3300049579 Ga0501043_0020025 Ga0501043_0020025_3891_4382 150
269 3300049580 Ga0501046_0011152 Ga0501046_0011152_815_1306 150
270 3300049581 Ga0501047_0002152 Ga0501047_0002152_4252_4743 150
271 3300049581 Ga0501047_0103763 Ga0501047_0103763_899_1375 150
272 3300049583 Ga0501067_0001011 Ga0501067_0001011_1095_1586 150
273 3300049586 Ga0501070_0017149 Ga0501070_0017149_3224_3715 150
274 3300049589 Ga0501073_0022223 Ga0501073_0022223_1234_1725 150
275 3300049590 Ga0501074_0778718 Ga0501074_0778718_79_570 150
276 3300049742 Ga0501080_0001220 Ga0501080_0001220_4306_4797 150
277 3300049822 Ga0501035_0000054 Ga0501035_0000054_137213_137704 150
278 3300049823 Ga0501044_0000013 Ga0501044_0000013_35936_36427 150
279 3300054114 Ga0501084_0182835 Ga0501084_0182835_562_1053 150
280 3300003320 rootH2_10231415 rootH2_102314152 151
281 3300005330 Ga0070690_100980302 Ga0070690_1009803022 151
282 3300005334 Ga0068869_100102669 Ga0068869_1001026693 151
283 3300005336 Ga0070680_100004299 Ga0070680_1000042993 151
284 3300005337 Ga0070682_100011285 Ga0070682_1000112853 151
285 3300005339 Ga0070660_100016681 Ga0070660_1000166813 151
286 3300005341 Ga0070691_10013433 Ga0070691_100134333 151
287 3300005345 Ga0070692_10087728 Ga0070692_100877283 151
288 3300005366 Ga0070659_100297697 Ga0070659_1002976972 151
289 3300005440 Ga0070705_100168598 Ga0070705_1001685983 151
290 3300005441 Ga0070700_100806971 Ga0070700_1008069712 151
291 3300005444 Ga0070694_100086470 Ga0070694_1000864703 151
292 3300005455 Ga0070663_100002647 Ga0070663_1000026476 151
293 3300005456 Ga0070678_100112862 Ga0070678_1001128621 151
294 3300005458 Ga0070681_10052459 Ga0070681_100524594 151
295 3300005544 Ga0070686_100188302 Ga0070686_1001883021 151
296 3300005546 Ga0070696_100033380 Ga0070696_1000333803 151
297 3300005547 Ga0070693_100003701 Ga0070693_1000037012 151
298 3300005563 Ga0068855_100165320 Ga0068855_1001653203 151
299 3300005564 Ga0070664_100118383 Ga0070664_1001183833 151
300 3300005577 Ga0068857_100201951 Ga0068857_1002019512 151
301 3300005578 Ga0068854_100065020 Ga0068854_1000650202 151
302 3300005614 Ga0068856_100073952 Ga0068856_1000739524 151
303 3300005615 Ga0070702_100040273 Ga0070702_1000402731 151
304 3300005616 Ga0068852_100328531 Ga0068852_1003285313 151
305 3300005617 Ga0068859_100322702 Ga0068859_1003227022 151
306 3300005618 Ga0068864_100156578 Ga0068864_1001565783 151
307 3300005840 Ga0068870_10048816 Ga0068870_100488163 151
308 3300005842 Ga0068858_100105313 Ga0068858_1001053131 151
309 3300005843 Ga0068860_100264857 Ga0068860_1002648573 151
310 3300006931 Ga0097620_100322714 Ga0097620_1003227142 151
311 3300009098 Ga0105245_10514426 Ga0105245_105144261 151
312 3300009148 Ga0105243_10047568 Ga0105243_100475683 151
313 3300009174 Ga0105241_10031831 Ga0105241_100318314 151
314 3300009545 Ga0105237_10013621 Ga0105237_100136217 151
315 3300009551 Ga0105238_10039520 Ga0105238_100395203 151
316 3300010375 Ga0105239_10659730 Ga0105239_106597302 151
317 3300010375 Ga0105239_10861518 Ga0105239_108615181 151
318 3300011119 Ga0105246_10016784 Ga0105246_100167843 151
319 3300013100 Ga0157373_10699154 Ga0157373_106991542 151
320 3300013104 Ga0157370_10169150 Ga0157370_101691503 151
321 3300013307 Ga0157372_11569286 Ga0157372_115692861 151
322 3300013308 Ga0157375_10131847 Ga0157375_101318473 151
323 3300014968 Ga0157379_10896749 Ga0157379_108967492 151
324 3300014968 Ga0157379_11474644 Ga0157379_114746441 151
325 3300014969 Ga0157376_10521851 Ga0157376_105218512 151
326 3300025904 Ga0207647_10034380 Ga0207647_100343802 151
327 3300025908 Ga0207643_10385251 Ga0207643_103852511 151
328 3300025911 Ga0207654_10016546 Ga0207654_100165462 151
329 3300025914 Ga0207671_10052518 Ga0207671_100525181 151
330 3300025919 Ga0207657_10031208 Ga0207657_100312083 151
331 3300025924 Ga0207694_10080669 Ga0207694_100806692 151
332 3300025942 Ga0207689_10229822 Ga0207689_102298222 151
333 3300025945 Ga0207679_10324857 Ga0207679_103248572 151
334 3300025949 Ga0207667_10122040 Ga0207667_101220403 151
335 3300025981 Ga0207640_10114808 Ga0207640_101148082 151
336 3300026035 Ga0207703_10205984 Ga0207703_102059843 151
337 3300026041 Ga0207639_10040205 Ga0207639_100402054 151
338 3300026067 Ga0207678_10000647 Ga0207678_1000064716 151
339 3300026075 Ga0207708_10877890 Ga0207708_108778901 151
340 3300026089 Ga0207648_10783605 Ga0207648_107836052 151
341 3300026095 Ga0207676_10223295 Ga0207676_102232953 151
342 3300026116 Ga0207674_10163255 Ga0207674_101632553 151
343 3300026121 Ga0207683_10114165 Ga0207683_101141652 151
344 3300026142 Ga0207698_10247490 Ga0207698_102474903 151
345 3300028381 Ga0268264_10492341 Ga0268264_104923412 151
346 3300037312 Ga0395899_0205918 Ga0395899_0205918_320_805 151
347 3300037312 Ga0395899_0601668 Ga0395899_0601668_174_653 151
348 3300037466 Ga0395898_0525499 Ga0395898_0525499_162_641 151
349 3300038443 Ga0395901_0621620 Ga0395901_0621620_431_916 151
350 3300048904 Ga0496101_0075560 Ga0496101_0075560_731_1198 151
351 3300048905 Ga0496102_0024970 Ga0496102_0024970_1600_2067 151
352 3300048905 Ga0496102_0099845 Ga0496102_0099845_1813_2280 151
353 3300048906 Ga0496103_0006658 Ga0496103_0006658_791_1258 151
354 3300048906 Ga0496103_0454912 Ga0496103_0454912_229_696 151
355 3300048907 Ga0496104_0077271 Ga0496104_0077271_362_829 151
356 3300048908 Ga0496105_0153120 Ga0496105_0153120_380_847 151
357 3300048909 Ga0496106_0005631 Ga0496106_0005631_3503_3970 151
358 3300048910 Ga0496107_0013254 Ga0496107_0013254_1472_1939 151
359 3300048917 Ga0496114_0051168 Ga0496114_0051168_2811_3278 151
360 3300048918 Ga0496115_0004881 Ga0496115_0004881_3601_4068 151
361 3300048924 Ga0496121_0525414 Ga0496121_0525414_262_732 151
362 3300049569 Ga0501032_0564143 Ga0501032_0564143_210_695 151
363 3300049571 Ga0501034_0065711 Ga0501034_0065711_1233_1712 151
364 3300049571 Ga0501034_0448662 Ga0501034_0448662_309_854 151
365 3300049571 Ga0501034_0917226 Ga0501034_0917226_156_635 151
366 3300049580 Ga0501046_0005738 Ga0501046_0005738_4259_4738 151
367 3300049581 Ga0501047_0070961 Ga0501047_0070961_1284_1763 151
368 3300049581 Ga0501047_0161983 Ga0501047_0161983_1047_1532 151
369 3300049582 Ga0501048_0005689 Ga0501048_0005689_4474_4944 151
370 3300049583 Ga0501067_0211124 Ga0501067_0211124_149_628 151
371 3300049586 Ga0501070_0079269 Ga0501070_0079269_1541_2026 151
372 3300049586 Ga0501070_0155049 Ga0501070_0155049_1078_1557 151
373 3300049589 Ga0501073_0253691 Ga0501073_0253691_334_813 151
374 3300049742 Ga0501080_0574025 Ga0501080_0574025_339_818 151
375 3300049822 Ga0501035_0168720 Ga0501035_0168720_1284_1769 151
376 3300049823 Ga0501044_0167281 Ga0501044_0167281_1032_1511 151
377 3300053119 Ga0500595_023575 Ga0500595_023575_907_1377 151
378 3300053153 Ga0500616_0009556 Ga0500616_0009556_2185_2679 151
379 3300060353 Ga0501082_0175519 Ga0501082_0175519_327_803 151
380 3300060353 Ga0501082_0185568 Ga0501082_0185568_593_1072 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

22

168

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.9371 2 149
5co4-assembly1.cif.gz_B structural insights into the 2-oh methylation of c/u34 on trna 0.9363 2 149
4kdz-assembly1.cif.gz_A crystal structure of trna/rrna methyltransferase yibk from escherichia coli (target nysgrc-012599) 0.9273 2 149
1j85-assembly1.cif.gz_A structure of yibk from haemophilus influenzae (hi0766), a truncated sequence homolog of trna (guanosine-2'-o-) methyltransferase (spou) 0.9233 1 149
4kgn-assembly1.cif.gz_A crystal structure of a trna (cytidine(34)-2'-o)-methyltransferase bound to s-adenosyl homocysteine 0.9212 2 149
ID Description Score Start End Superfamily
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9559 2 149 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9371 2 149 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9314 2 149 3.40.1280.10
af_O50394_1_154_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9152 2 149 3.40.1280.10
5l0zB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9022 2 148 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A2S6STY3-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9716 1 150 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A1Z8NX47-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9707 1 150 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-D7A3L6-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9677 2 150 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A0K6H0Q5-F1-model_v4 deleted 0.9676 2 149
AF-A0A2S6U8P9-F1-model_v4 tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmL) 0.9659 2 149 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102

Feature Viewer

pLDDT pTM Quality
94.92 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map