F428753
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 380 | 136 | 373 | 405 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0123656|Ga0466963_0123656_304_1644 |
| Length | 446 |
| Sequence | MRRHRTFVRRCALPVHQDKNGVSVMRMRVGRYGLCLVLAACGTAAAPNAQANNADTAEEASATNPQDPPFTITPVASFDNPWAMAFLPGSTNALVTEKPGHIWLVDTRTGTKKPIAGAPRVVANGQGGLLDIALSPTFASDNQVYLTYSELSTNGGSGLALARAKFVPDAVGGYLEGRTVLWHDPAGGQGGQFGAIIAFAPDGKSLFLSSGERQRFTPAQDPSQPIGKILHLTLDGNPAPGNPMAGKLGAPTVTIINPPEDTRAAKHAAGRPFKWPGPNLTPAETWSSGHRNPYGLTFDAQGRLWETEMGPRGGDELNLILPGRNYGWPLVSEGQNYNGVPIPKPSTRPDLERAKLFWVPSVSPTTLLIYSGNMFPQWKGSGLIGSLSGESLIRVTFNGDSAEKADRWNLGKRIRWVGQGPDGVIYLLEDGGSGGLYRLTPPAVRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 2 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 3 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 4 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 5 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 6 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 7 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 62 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 95 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 96 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 97 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 98 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 101 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 104 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 105 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 106 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 107 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 110 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 111 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 112 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 121 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 123 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 124 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 127 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 128 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 129 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 130 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 131 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 132 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 133 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 134 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 135 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 136 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.16 |
| Metatranscriptomes | 0 |
| Isolates | 1.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.05 |
| Rhizosphere | 89.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10000830 | 3300002075 | Bacteria | 8842 |
| 2 | Ga0070658_10000329 | 3300005327 | Bacteria | 40648 |
| 3 | Ga0070658_10013021 | 3300005327 | Bacteria | 6675 |
| 4 | Ga0070658_10015773 | 3300005327 | Bacteria | 6040 |
| 5 | Ga0070658_10053618 | 3300005327 | Bacteria | 3273 |
| 6 | Ga0070658_10070969 | 3300005327 | Bacteria | 2852 |
| 7 | Ga0070658_10100950 | 3300005327 | Bacteria | 2385 |
| 8 | Ga0070683_100007230 | 3300005329 | Bacteria | 9370 |
| 9 | Ga0070683_100009638 | 3300005329 | Bacteria | 8264 |
| 10 | Ga0070683_100047789 | 3300005329 | Bacteria | 3955 |
| 11 | Ga0070690_100043020 | 3300005330 | Bacteria | 2863 |
| 12 | Ga0070690_100141680 | 3300005330 | Bacteria | 1632 |
| 13 | Ga0070670_100002964 | 3300005331 | Bacteria | 14060 |
| 14 | Ga0070670_100032244 | 3300005331 | Bacteria | 4512 |
| 15 | Ga0070670_100059038 | 3300005331 | Bacteria | 3293 |
| 16 | Ga0070670_100170056 | 3300005331 | Bacteria | 1890 |
| 17 | Ga0068869_100045875 | 3300005334 | Bacteria | 3148 |
| 18 | Ga0070666_10000967 | 3300005335 | Bacteria | 17525 |
| 19 | Ga0070666_10018011 | 3300005335 | Bacteria | 4534 |
| 20 | Ga0070666_10057940 | 3300005335 | Bacteria | 2619 |
| 21 | Ga0070666_10118300 | 3300005335 | Bacteria | 1836 |
| 22 | Ga0070680_100067732 | 3300005336 | Bacteria | 2929 |
| 23 | Ga0070682_100054943 | 3300005337 | Bacteria | 2500 |
| 24 | Ga0070660_100000726 | 3300005339 | Bacteria | 21876 |
| 25 | Ga0070660_100001819 | 3300005339 | Bacteria | 14641 |
| 26 | Ga0070660_100001889 | 3300005339 | Bacteria | 14420 |
| 27 | Ga0070660_100009935 | 3300005339 | Bacteria | 6714 |
| 28 | Ga0070660_100061806 | 3300005339 | Bacteria | 2908 |
| 29 | Ga0070660_100083329 | 3300005339 | Bacteria | 2512 |
| 30 | Ga0070661_100001222 | 3300005344 | Bacteria | 18099 |
| 31 | Ga0070661_100049110 | 3300005344 | Bacteria | 3089 |
| 32 | Ga0070671_100000793 | 3300005355 | Bacteria | 22759 |
| 33 | Ga0070671_100001688 | 3300005355 | Bacteria | 16743 |
| 34 | Ga0070671_100003799 | 3300005355 | Bacteria | 11849 |
| 35 | Ga0070671_100007194 | 3300005355 | Bacteria | 8897 |
| 36 | Ga0070671_100022686 | 3300005355 | Bacteria | 5127 |
| 37 | Ga0070671_100082252 | 3300005355 | Bacteria | 2692 |
| 38 | Ga0070671_100106242 | 3300005355 | Bacteria | 2356 |
| 39 | Ga0070674_100134297 | 3300005356 | Bacteria | 1849 |
| 40 | Ga0070673_100024636 | 3300005364 | Bacteria | 4416 |
| 41 | Ga0070673_100073594 | 3300005364 | Bacteria | 2751 |
| 42 | Ga0070659_100000356 | 3300005366 | Bacteria | 34780 |
| 43 | Ga0070659_100003382 | 3300005366 | Bacteria | 11356 |
| 44 | Ga0070659_100089497 | 3300005366 | Bacteria | 2466 |
| 45 | Ga0070667_100010798 | 3300005367 | Bacteria | 7546 |
| 46 | Ga0070709_10028646 | 3300005434 | Bacteria | 3324 |
| 47 | Ga0070714_100051956 | 3300005435 | Bacteria | 3495 |
| 48 | Ga0070714_100097766 | 3300005435 | Bacteria | 2581 |
| 49 | Ga0070714_100101864 | 3300005435 | Bacteria | 2531 |
| 50 | Ga0070663_100008716 | 3300005455 | Bacteria | 6252 |
| 51 | Ga0070663_100083200 | 3300005455 | Bacteria | 2356 |
| 52 | Ga0070663_100127076 | 3300005455 | Bacteria | 1932 |
| 53 | Ga0070678_100086614 | 3300005456 | Bacteria | 2390 |
| 54 | Ga0070662_100000069 | 3300005457 | Bacteria | 56301 |
| 55 | Ga0070662_100107127 | 3300005457 | Bacteria | 2124 |
| 56 | Ga0070681_10011596 | 3300005458 | Bacteria | 8724 |
| 57 | Ga0070681_10064640 | 3300005458 | Bacteria | 3629 |
| 58 | Ga0070679_100036155 | 3300005530 | Bacteria | 4900 |
| 59 | Ga0070679_100075943 | 3300005530 | Bacteria | 3350 |
| 60 | Ga0070679_100176522 | 3300005530 | Bacteria | 2109 |
| 61 | Ga0070684_100006143 | 3300005535 | Bacteria | 9261 |
| 62 | Ga0070684_100034194 | 3300005535 | Bacteria | 4345 |
| 63 | Ga0070684_100060150 | 3300005535 | Bacteria | 3322 |
| 64 | Ga0068853_100001087 | 3300005539 | Bacteria | 19234 |
| 65 | Ga0068853_100012265 | 3300005539 | Bacteria | 6969 |
| 66 | Ga0068853_100053490 | 3300005539 | Bacteria | 3477 |
| 67 | Ga0068853_100062415 | 3300005539 | Bacteria | 3225 |
| 68 | Ga0070672_100053566 | 3300005543 | Bacteria | 3155 |
| 69 | Ga0070693_100001251 | 3300005547 | Bacteria | 11489 |
| 70 | Ga0070665_100007044 | 3300005548 | Bacteria | 11423 |
| 71 | Ga0070665_100033642 | 3300005548 | Bacteria | 5157 |
| 72 | Ga0068855_100000259 | 3300005563 | Bacteria | 66061 |
| 73 | Ga0068855_100000348 | 3300005563 | Bacteria | 57384 |
| 74 | Ga0068855_100000942 | 3300005563 | Bacteria | 36250 |
| 75 | Ga0068855_100246271 | 3300005563 | Bacteria | 1995 |
| 76 | Ga0068855_100271700 | 3300005563 | Bacteria | 1885 |
| 77 | Ga0070664_100000548 | 3300005564 | Bacteria | 28696 |
| 78 | Ga0070664_100009514 | 3300005564 | Bacteria | 7880 |
| 79 | Ga0070664_100042322 | 3300005564 | Bacteria | 3845 |
| 80 | Ga0070664_100086600 | 3300005564 | Bacteria | 2706 |
| 81 | Ga0068857_100028701 | 3300005577 | Bacteria | 4909 |
| 82 | Ga0068854_100045600 | 3300005578 | Bacteria | 3118 |
| 83 | Ga0068854_100117349 | 3300005578 | Bacteria | 2015 |
| 84 | Ga0068854_100127736 | 3300005578 | Bacteria | 1938 |
| 85 | Ga0068856_100000163 | 3300005614 | Bacteria | 68963 |
| 86 | Ga0068856_100011453 | 3300005614 | Bacteria | 8605 |
| 87 | Ga0068856_100171409 | 3300005614 | Bacteria | 2182 |
| 88 | Ga0068852_100000348 | 3300005616 | Bacteria | 31130 |
| 89 | Ga0068852_100109043 | 3300005616 | Bacteria | 2513 |
| 90 | Ga0068852_100149862 | 3300005616 | Bacteria | 2168 |
| 91 | Ga0068864_100001733 | 3300005618 | Bacteria | 17945 |
| 92 | Ga0068864_100002647 | 3300005618 | Bacteria | 14784 |
| 93 | Ga0068863_100014012 | 3300005841 | Bacteria | 7725 |
| 94 | Ga0068858_100083409 | 3300005842 | Bacteria | 2972 |
| 95 | Ga0068858_100199736 | 3300005842 | Unclassified | 1890 |
| 96 | Ga0068858_100289923 | 3300005842 | Bacteria | 1560 |
| 97 | Ga0097621_100114874 | 3300006237 | Bacteria | 2278 |
| 98 | Ga0068871_100039088 | 3300006358 | Bacteria | 3794 |
| 99 | Ga0068871_100102050 | 3300006358 | Bacteria | 2404 |
| 100 | Ga0075431_100016109 | 3300006847 | Bacteria | 7585 |
| 101 | Ga0105240_10049323 | 3300009093 | Bacteria | 5315 |
| 102 | Ga0105240_10129669 | 3300009093 | Bacteria | 3026 |
| 103 | Ga0105240_10173950 | 3300009093 | Bacteria | 2547 |
| 104 | Ga0105241_10236283 | 3300009174 | Bacteria | 1543 |
| 105 | Ga0105248_10003466 | 3300009177 | Bacteria | 17517 |
| 106 | Ga0105248_10004624 | 3300009177 | Bacteria | 15220 |
| 107 | Ga0105248_10005282 | 3300009177 | Bacteria | 14214 |
| 108 | Ga0105248_10010048 | 3300009177 | Bacteria | 10423 |
| 109 | Ga0105248_10151165 | 3300009177 | Bacteria | 2619 |
| 110 | Ga0105248_10260556 | 3300009177 | Bacteria | 1952 |
| 111 | Ga0105238_10062564 | 3300009551 | Bacteria | 3722 |
| 112 | Ga0157373_10036977 | 3300013100 | Bacteria | 3503 |
| 113 | Ga0157373_10050934 | 3300013100 | Bacteria | 2948 |
| 114 | Ga0157373_10058941 | 3300013100 | Bacteria | 2721 |
| 115 | Ga0157371_10010498 | 3300013102 | Bacteria | 7204 |
| 116 | Ga0157371_10018948 | 3300013102 | Bacteria | 5081 |
| 117 | Ga0157371_10093437 | 3300013102 | Bacteria | 2131 |
| 118 | Ga0157370_10004637 | 3300013104 | Bacteria | 15715 |
| 119 | Ga0157370_10031131 | 3300013104 | Bacteria | 5222 |
| 120 | Ga0157370_10100815 | 3300013104 | Bacteria | 2705 |
| 121 | Ga0157370_10115773 | 3300013104 | Bacteria | 2504 |
| 122 | Ga0157369_10014845 | 3300013105 | Bacteria | 8790 |
| 123 | Ga0157369_10033462 | 3300013105 | Bacteria | 5648 |
| 124 | Ga0157369_10088448 | 3300013105 | Bacteria | 3306 |
| 125 | Ga0157369_10110624 | 3300013105 | Bacteria | 2921 |
| 126 | Ga0157369_10114383 | 3300013105 | Bacteria | 2865 |
| 127 | Ga0157369_10226038 | 3300013105 | Bacteria | 1958 |
| 128 | Ga0157374_10015202 | 3300013296 | Bacteria | 6748 |
| 129 | Ga0163162_10059789 | 3300013306 | Bacteria | 3843 |
| 130 | Ga0157372_10266456 | 3300013307 | Bacteria | 1990 |
| 131 | Ga0157375_10034730 | 3300013308 | Bacteria | 4806 |
| 132 | Ga0163163_10000246 | 3300014325 | Bacteria | 55606 |
| 133 | Ga0213875_10007660 | 3300021388 | Bacteria | 5563 |
| 134 | Ga0207697_10006722 | 3300025315 | Bacteria | 5176 |
| 135 | Ga0207697_10023052 | 3300025315 | Bacteria | 2550 |
| 136 | Ga0207682_10020919 | 3300025893 | Bacteria | 2572 |
| 137 | Ga0207680_10001932 | 3300025903 | Bacteria | 9725 |
| 138 | Ga0207680_10041497 | 3300025903 | Bacteria | 2685 |
| 139 | Ga0207680_10098822 | 3300025903 | Bacteria | 1871 |
| 140 | Ga0207647_10005602 | 3300025904 | Bacteria | 9176 |
| 141 | Ga0207647_10013395 | 3300025904 | Bacteria | 5686 |
| 142 | Ga0207647_10029185 | 3300025904 | Bacteria | 3573 |
| 143 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 144 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 145 | Ga0207705_10000095 | 3300025909 | Bacteria | 106506 |
| 146 | Ga0207705_10000208 | 3300025909 | Bacteria | 59559 |
| 147 | Ga0207705_10001112 | 3300025909 | Bacteria | 21864 |
| 148 | Ga0207705_10006363 | 3300025909 | Bacteria | 8761 |
| 149 | Ga0207705_10014713 | 3300025909 | Bacteria | 5626 |
| 150 | Ga0207705_10015701 | 3300025909 | Bacteria | 5436 |
| 151 | Ga0207705_10026238 | 3300025909 | Bacteria | 4156 |
| 152 | Ga0207705_10052415 | 3300025909 | Bacteria | 2937 |
| 153 | Ga0207705_10082175 | 3300025909 | Bacteria | 2349 |
| 154 | Ga0207705_10101002 | 3300025909 | Bacteria | 2122 |
| 155 | Ga0207707_10281570 | 3300025912 | Bacteria | 1440 |
| 156 | Ga0207695_10004994 | 3300025913 | Bacteria | 17834 |
| 157 | Ga0207695_10034241 | 3300025913 | Bacteria | 5528 |
| 158 | Ga0207695_10047721 | 3300025913 | Bacteria | 4529 |
| 159 | Ga0207695_10166787 | 3300025913 | Bacteria | 2130 |
| 160 | Ga0207695_10336176 | 3300025913 | Bacteria | 1398 |
| 161 | Ga0207660_10000716 | 3300025917 | Bacteria | 22075 |
| 162 | Ga0207660_10052569 | 3300025917 | Bacteria | 2900 |
| 163 | Ga0207657_10001862 | 3300025919 | Bacteria | 22804 |
| 164 | Ga0207657_10002486 | 3300025919 | Bacteria | 19933 |
| 165 | Ga0207657_10002855 | 3300025919 | Bacteria | 18575 |
| 166 | Ga0207657_10010100 | 3300025919 | Bacteria | 9439 |
| 167 | Ga0207657_10010899 | 3300025919 | Bacteria | 9048 |
| 168 | Ga0207657_10017410 | 3300025919 | Bacteria | 6890 |
| 169 | Ga0207657_10058648 | 3300025919 | Bacteria | 3311 |
| 170 | Ga0207657_10060654 | 3300025919 | Bacteria | 3245 |
| 171 | Ga0207657_10143833 | 3300025919 | Bacteria | 1947 |
| 172 | Ga0207649_10000014 | 3300025920 | Bacteria | 255001 |
| 173 | Ga0207649_10007807 | 3300025920 | Bacteria | 5822 |
| 174 | Ga0207649_10091597 | 3300025920 | Bacteria | 1991 |
| 175 | Ga0207652_10021319 | 3300025921 | Bacteria | 5348 |
| 176 | Ga0207652_10091506 | 3300025921 | Bacteria | 2675 |
| 177 | Ga0207650_10028912 | 3300025925 | Bacteria | 3979 |
| 178 | Ga0207650_10132955 | 3300025925 | Bacteria | 1949 |
| 179 | Ga0207664_10030036 | 3300025929 | Bacteria | 4147 |
| 180 | Ga0207664_10032728 | 3300025929 | Bacteria | 3988 |
| 181 | Ga0207644_10000151 | 3300025931 | Bacteria | 49728 |
| 182 | Ga0207644_10001389 | 3300025931 | Bacteria | 15624 |
| 183 | Ga0207644_10061942 | 3300025931 | Bacteria | 2711 |
| 184 | Ga0207690_10000229 | 3300025932 | Bacteria | 41732 |
| 185 | Ga0207690_10020496 | 3300025932 | Bacteria | 4086 |
| 186 | Ga0207690_10043173 | 3300025932 | Bacteria | 2966 |
| 187 | Ga0207690_10052532 | 3300025932 | Bacteria | 2730 |
| 188 | Ga0207706_10000719 | 3300025933 | Bacteria | 34558 |
| 189 | Ga0207706_10004393 | 3300025933 | Bacteria | 13254 |
| 190 | Ga0207706_10008821 | 3300025933 | Bacteria | 9280 |
| 191 | Ga0207706_10039828 | 3300025933 | Bacteria | 4166 |
| 192 | Ga0207706_10114487 | 3300025933 | Bacteria | 2372 |
| 193 | Ga0207706_10122028 | 3300025933 | Bacteria | 2292 |
| 194 | Ga0207706_10188297 | 3300025933 | Bacteria | 1812 |
| 195 | Ga0207691_10032536 | 3300025940 | Bacteria | 4862 |
| 196 | Ga0207691_10038413 | 3300025940 | Bacteria | 4430 |
| 197 | Ga0207711_10001841 | 3300025941 | Bacteria | 19341 |
| 198 | Ga0207711_10002207 | 3300025941 | Bacteria | 17481 |
| 199 | Ga0207711_10014963 | 3300025941 | Bacteria | 6445 |
| 200 | Ga0207711_10015751 | 3300025941 | Bacteria | 6271 |
| 201 | Ga0207679_10000116 | 3300025945 | Bacteria | 64406 |
| 202 | Ga0207679_10009367 | 3300025945 | Bacteria | 6272 |
| 203 | Ga0207679_10020127 | 3300025945 | Bacteria | 4498 |
| 204 | Ga0207679_10098362 | 3300025945 | Bacteria | 2281 |
| 205 | Ga0207667_10001695 | 3300025949 | Bacteria | 27714 |
| 206 | Ga0207667_10004895 | 3300025949 | Bacteria | 16353 |
| 207 | Ga0207667_10007293 | 3300025949 | Bacteria | 13323 |
| 208 | Ga0207667_10039559 | 3300025949 | Bacteria | 5025 |
| 209 | Ga0207667_10042269 | 3300025949 | Bacteria | 4846 |
| 210 | Ga0207667_10118207 | 3300025949 | Bacteria | 2732 |
| 211 | Ga0207640_10005167 | 3300025981 | Bacteria | 7098 |
| 212 | Ga0207640_10005368 | 3300025981 | Bacteria | 6989 |
| 213 | Ga0207640_10032465 | 3300025981 | Bacteria | 3238 |
| 214 | Ga0207658_10011656 | 3300025986 | Bacteria | 5987 |
| 215 | Ga0207703_10051718 | 3300026035 | Bacteria | 3331 |
| 216 | Ga0207703_10213904 | 3300026035 | Bacteria | 1720 |
| 217 | Ga0207639_10000406 | 3300026041 | Bacteria | 29790 |
| 218 | Ga0207639_10059714 | 3300026041 | Bacteria | 2939 |
| 219 | Ga0207639_10066367 | 3300026041 | Bacteria | 2804 |
| 220 | Ga0207678_10002336 | 3300026067 | Bacteria | 17192 |
| 221 | Ga0207678_10005316 | 3300026067 | Bacteria | 11525 |
| 222 | Ga0207678_10240968 | 3300026067 | Bacteria | 1549 |
| 223 | Ga0207702_10000272 | 3300026078 | Bacteria | 59391 |
| 224 | Ga0207702_10006879 | 3300026078 | Bacteria | 9748 |
| 225 | Ga0207702_10048935 | 3300026078 | Bacteria | 3566 |
| 226 | Ga0207702_10147814 | 3300026078 | Bacteria | 2134 |
| 227 | Ga0207641_10004390 | 3300026088 | Bacteria | 12225 |
| 228 | Ga0207641_10066211 | 3300026088 | Bacteria | 3092 |
| 229 | Ga0207676_10005530 | 3300026095 | Bacteria | 8944 |
| 230 | Ga0207676_10009721 | 3300026095 | Bacteria | 6838 |
| 231 | Ga0207674_10003100 | 3300026116 | Bacteria | 20520 |
| 232 | Ga0207683_10073349 | 3300026121 | Bacteria | 3028 |
| 233 | Ga0207683_10127534 | 3300026121 | Bacteria | 2287 |
| 234 | Ga0207698_10000266 | 3300026142 | Bacteria | 31722 |
| 235 | Ga0207698_10005537 | 3300026142 | Bacteria | 7816 |
| 236 | Ga0207698_10021118 | 3300026142 | Bacteria | 4496 |
| 237 | Ga0207698_10043669 | 3300026142 | Bacteria | 3360 |
| 238 | Ga0268266_10012591 | 3300028379 | Bacteria | 7309 |
| 239 | Ga0268266_10066480 | 3300028379 | Bacteria | 3118 |
| 240 | Ga0268266_10279503 | 3300028379 | Unclassified | 1552 |
| 241 | Ga0307408_100048454 | 3300031548 | Bacteria | 3048 |
| 242 | Ga0307410_10033952 | 3300031852 | Bacteria | 3299 |
| 243 | Ga0307412_10000435 | 3300031911 | Bacteria | 25212 |
| 244 | Ga0395899_0001364 | 3300037312 | Bacteria | 20941 |
| 245 | Ga0395899_0008516 | 3300037312 | Bacteria | 7898 |
| 246 | Ga0395899_0017035 | 3300037312 | Bacteria | 5536 |
| 247 | Ga0395899_0036508 | 3300037312 | Bacteria | 3686 |
| 248 | Ga0395899_0065128 | 3300037312 | Bacteria | 2678 |
| 249 | Ga0395899_0117191 | 3300037312 | Bacteria | 1910 |
| 250 | Ga0395899_0150935 | 3300037312 | Bacteria | 1647 |
| 251 | Ga0395900_0002598 | 3300037418 | Bacteria | 19737 |
| 252 | Ga0395900_0026581 | 3300037418 | Bacteria | 5925 |
| 253 | Ga0395900_0030978 | 3300037418 | Bacteria | 5494 |
| 254 | Ga0395900_0033748 | 3300037418 | Bacteria | 5266 |
| 255 | Ga0395900_0036406 | 3300037418 | Bacteria | 5074 |
| 256 | Ga0395900_0049234 | 3300037418 | Bacteria | 4341 |
| 257 | Ga0395900_0054129 | 3300037418 | Bacteria | 4131 |
| 258 | Ga0395900_0066233 | 3300037418 | Bacteria | 3712 |
| 259 | Ga0395900_0072904 | 3300037418 | Bacteria | 3529 |
| 260 | Ga0395900_0120137 | 3300037418 | Bacteria | 2696 |
| 261 | Ga0395900_0188138 | 3300037418 | Bacteria | 2095 |
| 262 | Ga0395900_0221394 | 3300037418 | Bacteria | 1907 |
| 263 | Ga0395900_0318692 | 3300037418 | Bacteria | 1535 |
| 264 | Ga0395898_0006953 | 3300037466 | Bacteria | 12024 |
| 265 | Ga0395898_0025349 | 3300037466 | Bacteria | 5976 |
| 266 | Ga0395898_0026748 | 3300037466 | Bacteria | 5798 |
| 267 | Ga0395898_0027414 | 3300037466 | Bacteria | 5720 |
| 268 | Ga0395898_0177857 | 3300037466 | Bacteria | 2033 |
| 269 | Ga0395898_0198069 | 3300037466 | Bacteria | 1918 |
| 270 | Ga0395898_0201598 | 3300037466 | Bacteria | 1899 |
| 271 | Ga0395898_0295094 | 3300037466 | Bacteria | 1546 |
| 272 | Ga0395898_0318547 | 3300037466 | Bacteria | 1483 |
| 273 | Ga0395898_0366921 | 3300037466 | Bacteria | 1373 |
| 274 | Ga0395898_0383914 | 3300037466 | Bacteria | 1339 |
| 275 | Ga0395905_0000358 | 3300037471 | Bacteria | 64883 |
| 276 | Ga0395905_0001857 | 3300037471 | Bacteria | 24328 |
| 277 | Ga0395905_0001888 | 3300037471 | Bacteria | 24158 |
| 278 | Ga0395905_0002566 | 3300037471 | Bacteria | 20009 |
| 279 | Ga0395905_0007846 | 3300037471 | Bacteria | 10574 |
| 280 | Ga0395905_0021568 | 3300037471 | Bacteria | 6090 |
| 281 | Ga0395905_0028093 | 3300037471 | Bacteria | 5304 |
| 282 | Ga0395905_0031418 | 3300037471 | Bacteria | 4999 |
| 283 | Ga0395905_0047246 | 3300037471 | Bacteria | 4035 |
| 284 | Ga0395905_0080724 | 3300037471 | Bacteria | 3048 |
| 285 | Ga0395905_0092739 | 3300037471 | Bacteria | 2832 |
| 286 | Ga0395905_0095838 | 3300037471 | Bacteria | 2785 |
| 287 | Ga0395905_0143275 | 3300037471 | Bacteria | 2248 |
| 288 | Ga0395905_0149632 | 3300037471 | Bacteria | 2196 |
| 289 | Ga0395905_0184019 | 3300037471 | Bacteria | 1961 |
| 290 | Ga0436364_1351302 | 3300037853 | Bacteria | 15199 |
| 291 | Ga0395901_0007334 | 3300038443 | Bacteria | 11129 |
| 292 | Ga0395901_0012581 | 3300038443 | Bacteria | 8586 |
| 293 | Ga0395901_0045287 | 3300038443 | Bacteria | 4565 |
| 294 | Ga0395901_0116627 | 3300038443 | Bacteria | 2805 |
| 295 | Ga0395901_0127955 | 3300038443 | Bacteria | 2669 |
| 296 | Ga0395901_0143923 | 3300038443 | Bacteria | 2506 |
| 297 | Ga0395901_0179179 | 3300038443 | Bacteria | 2222 |
| 298 | Ga0436365_0450343 | 3300039437 | Bacteria | 12525 |
| 299 | Ga0436365_0451685 | 3300039437 | Bacteria | 11482 |
| 300 | Ga0466969_0002723 | 3300044656 | Bacteria | 9449 |
| 301 | Ga0466972_0066684 | 3300044658 | Bacteria | 1720 |
| 302 | Ga0466966_0000039 | 3300044684 | Bacteria | 97202 |
| 303 | Ga0466966_0008831 | 3300044684 | Bacteria | 6673 |
| 304 | Ga0466966_0014455 | 3300044684 | Bacteria | 5225 |
| 305 | Ga0466961_0001899 | 3300044693 | Bacteria | 13012 |
| 306 | Ga0466961_0006223 | 3300044693 | Bacteria | 7582 |
| 307 | Ga0466961_0012489 | 3300044693 | Bacteria | 5436 |
| 308 | Ga0466961_0015406 | 3300044693 | Bacteria | 4908 |
| 309 | Ga0466961_0038089 | 3300044693 | Bacteria | 3085 |
| 310 | Ga0466961_0054617 | 3300044693 | Bacteria | 2547 |
| 311 | Ga0466961_0066433 | 3300044693 | Bacteria | 2291 |
| 312 | Ga0466961_0206489 | 3300044693 | Bacteria | 1214 |
| 313 | Ga0466963_0004040 | 3300044694 | Bacteria | 8489 |
| 314 | Ga0466963_0016298 | 3300044694 | Bacteria | 4620 |
| 315 | Ga0466963_0017070 | 3300044694 | Bacteria | 4521 |
| 316 | Ga0466963_0123656 | 3300044694 | Bacteria | 1782 |
| 317 | Ga0466971_0010728 | 3300044719 | Bacteria | 4008 |
| 318 | Ga0466971_0012794 | 3300044719 | Bacteria | 3678 |
| 319 | Ga0466971_0017664 | 3300044719 | Bacteria | 3157 |
| 320 | Ga0466971_0077878 | 3300044719 | Bacteria | 1510 |
| 321 | Ga0466968_0005016 | 3300044735 | Bacteria | 4960 |
| 322 | Ga0466970_0002859 | 3300044765 | Bacteria | 8347 |
| 323 | Ga0466970_0034083 | 3300044765 | Unclassified | 2694 |
| 324 | Ga0466957_0000515 | 3300044842 | Bacteria | 19383 |
| 325 | Ga0466957_0004705 | 3300044842 | Bacteria | 7637 |
| 326 | Ga0466957_0007292 | 3300044842 | Bacteria | 6248 |
| 327 | Ga0466957_0008079 | 3300044842 | Bacteria | 5970 |
| 328 | Ga0466957_0069733 | 3300044842 | Bacteria | 2172 |
| 329 | Ga0466959_0009026 | 3300045049 | Bacteria | 7072 |
| 330 | Ga0466959_0009377 | 3300045049 | Bacteria | 6958 |
| 331 | Ga0466959_0038972 | 3300045049 | Bacteria | 3511 |
| 332 | Ga0466959_0153138 | 3300045049 | Bacteria | 1624 |
| 333 | Ga0466959_0180876 | 3300045049 | Bacteria | 1474 |
| 334 | Ga0466958_0003175 | 3300045836 | Bacteria | 8467 |
| 335 | Ga0466958_0028793 | 3300045836 | Bacteria | 3295 |
| 336 | Ga0466958_0154819 | 3300045836 | Bacteria | 1446 |
| 337 | Ga0466967_0026805 | 3300045976 | Bacteria | 4781 |
| 338 | Ga0466967_0038584 | 3300045976 | Bacteria | 4098 |
| 339 | Ga0495617_000051 | 3300046452 | Bacteria | 106590 |
| 340 | Ga0495620_0000223 | 3300046515 | Bacteria | 42640 |
| 341 | Ga0495670_0000015 | 3300046691 | Bacteria | 131137 |
| 342 | Ga0495636_0020360 | 3300047318 | Bacteria | 2674 |
| 343 | Ga0496100_0076945 | 3300048903 | Bacteria | 2242 |
| 344 | Ga0496101_0014063 | 3300048904 | Bacteria | 5376 |
| 345 | Ga0496101_0048692 | 3300048904 | Bacteria | 3046 |
| 346 | Ga0496106_0000591 | 3300048909 | Bacteria | 25938 |
| 347 | Ga0496106_0027899 | 3300048909 | Bacteria | 4203 |
| 348 | Ga0496106_0074569 | 3300048909 | Bacteria | 2598 |
| 349 | Ga0496107_0002482 | 3300048910 | Bacteria | 11974 |
| 350 | Ga0496107_0011163 | 3300048910 | Bacteria | 6253 |
| 351 | Ga0496107_0037449 | 3300048910 | Bacteria | 3481 |
| 352 | Ga0496108_0019997 | 3300048911 | Bacteria | 5501 |
| 353 | Ga0496109_0011318 | 3300048912 | Bacteria | 7663 |
| 354 | Ga0496109_0015589 | 3300048912 | Bacteria | 6628 |
| 355 | Ga0496109_0152948 | 3300048912 | Bacteria | 2161 |
| 356 | Ga0496111_0118403 | 3300048914 | Bacteria | 1955 |
| 357 | Ga0496112_0007854 | 3300048915 | Bacteria | 9499 |
| 358 | Ga0496112_0038537 | 3300048915 | Bacteria | 4667 |
| 359 | Ga0496112_0246777 | 3300048915 | Bacteria | 1737 |
| 360 | Ga0496113_0005302 | 3300048916 | Bacteria | 8027 |
| 361 | Ga0496113_0063780 | 3300048916 | Bacteria | 2785 |
| 362 | Ga0496114_0000006 | 3300048917 | Bacteria | 472921 |
| 363 | Ga0496115_0031390 | 3300048918 | Bacteria | 4187 |
| 364 | Ga0496120_0013400 | 3300048923 | Bacteria | 5522 |
| 365 | Ga0496122_0055845 | 3300048925 | Bacteria | 2950 |
| 366 | Ga0496122_0098516 | 3300048925 | Bacteria | 1963 |
| 367 | Ga0496123_0107807 | 3300048926 | Bacteria | 1601 |
| 368 | Ga0496123_0115340 | 3300048926 | Bacteria | 1524 |
| 369 | Ga0496124_0000912 | 3300048927 | Bacteria | 47709 |
| 370 | Ga0496124_0003256 | 3300048927 | Bacteria | 20059 |
| 371 | Ga0496124_0017394 | 3300048927 | Bacteria | 6775 |
| 372 | Ga0496126_0052820 | 3300048929 | Bacteria | 3691 |
| 373 | Ga0466962_0018570 | 3300061719 | Bacteria | 3344 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005563 | Ga0068855_100000259 | Ga0068855_1000002599 | 349 |
| 2 | 3300025949 | Ga0207667_10042269 | Ga0207667_100422692 | 349 |
| 3 | 3300009177 | Ga0105248_10260556 | Ga0105248_102605562 | 356 |
| 4 | 3300037471 | Ga0395905_0095838 | Ga0395905_0095838_37_1125 | 356 |
| 5 | 3300037466 | Ga0395898_0201598 | Ga0395898_0201598_551_1633 | 359 |
| 6 | 3300005614 | Ga0068856_100171409 | Ga0068856_1001714092 | 360 |
| 7 | 3300013104 | Ga0157370_10004637 | Ga0157370_1000463712 | 360 |
| 8 | 3300025913 | Ga0207695_10336176 | Ga0207695_103361761 | 360 |
| 9 | 3300026078 | Ga0207702_10006879 | Ga0207702_100068792 | 360 |
| 10 | 3300037312 | Ga0395899_0017035 | Ga0395899_0017035_3666_4757 | 360 |
| 11 | 3300037312 | Ga0395899_0036508 | Ga0395899_0036508_125_1207 | 360 |
| 12 | 3300037418 | Ga0395900_0033748 | Ga0395900_0033748_3960_5051 | 360 |
| 13 | 3300037418 | Ga0395900_0120137 | Ga0395900_0120137_362_1444 | 360 |
| 14 | 3300037466 | Ga0395898_0295094 | Ga0395898_0295094_216_1307 | 360 |
| 15 | 3300037466 | Ga0395898_0383914 | Ga0395898_0383914_143_1225 | 360 |
| 16 | 3300038443 | Ga0395901_0127955 | Ga0395901_0127955_111_1193 | 360 |
| 17 | 3300044684 | Ga0466966_0008831 | Ga0466966_0008831_533_1615 | 360 |
| 18 | 3300045049 | Ga0466959_0009026 | Ga0466959_0009026_984_2066 | 360 |
| 19 | 3300009177 | Ga0105248_10151165 | Ga0105248_101511651 | 361 |
| 20 | 3300013105 | Ga0157369_10110624 | Ga0157369_101106242 | 361 |
| 21 | 3300037471 | Ga0395905_0001857 | Ga0395905_0001857_22539_23627 | 361 |
| 22 | 3300038443 | Ga0395901_0116627 | Ga0395901_0116627_1139_2227 | 361 |
| 23 | 3300048917 | Ga0496114_0000006 | Ga0496114_0000006_120167_121252 | 361 |
| 24 | 3300009177 | Ga0105248_10005282 | Ga0105248_100052824 | 363 |
| 25 | 3300031548 | Ga0307408_100048454 | Ga0307408_1000484542 | 363 |
| 26 | 3300037466 | Ga0395898_0177857 | Ga0395898_0177857_593_1684 | 363 |
| 27 | 3300044658 | Ga0466972_0066684 | Ga0466972_0066684_588_1682 | 363 |
| 28 | 3300044693 | Ga0466961_0012489 | Ga0466961_0012489_2559_3653 | 363 |
| 29 | 3300044693 | Ga0466961_0206489 | Ga0466961_0206489_51_1142 | 363 |
| 30 | 3300044694 | Ga0466963_0017070 | Ga0466963_0017070_1887_2981 | 363 |
| 31 | 3300044719 | Ga0466971_0010728 | Ga0466971_0010728_1081_2175 | 363 |
| 32 | 3300044842 | Ga0466957_0008079 | Ga0466957_0008079_3226_4320 | 363 |
| 33 | 3300045049 | Ga0466959_0180876 | Ga0466959_0180876_327_1418 | 363 |
| 34 | 3300045836 | Ga0466958_0154819 | Ga0466958_0154819_29_1120 | 363 |
| 35 | 3300048904 | Ga0496101_0048692 | Ga0496101_0048692_1065_2156 | 363 |
| 36 | 3300048909 | Ga0496106_0074569 | Ga0496106_0074569_1056_2147 | 363 |
| 37 | 3300048910 | Ga0496107_0011163 | Ga0496107_0011163_2830_3921 | 363 |
| 38 | 3300048914 | Ga0496111_0118403 | Ga0496111_0118403_750_1841 | 363 |
| 39 | 3300048918 | Ga0496115_0031390 | Ga0496115_0031390_2081_3172 | 363 |
| 40 | 3300031852 | Ga0307410_10033952 | Ga0307410_100339523 | 364 |
| 41 | 3300037312 | Ga0395899_0065128 | Ga0395899_0065128_662_1780 | 372 |
| 42 | 3300044656 | Ga0466969_0002723 | Ga0466969_0002723_5455_6582 | 372 |
| 43 | 3300044684 | Ga0466966_0014455 | Ga0466966_0014455_3166_4293 | 372 |
| 44 | 3300044693 | Ga0466961_0001899 | Ga0466961_0001899_4998_6125 | 372 |
| 45 | 3300044693 | Ga0466961_0054617 | Ga0466961_0054617_40_1167 | 372 |
| 46 | 3300044694 | Ga0466963_0016298 | Ga0466963_0016298_2551_3678 | 372 |
| 47 | 3300044719 | Ga0466971_0012794 | Ga0466971_0012794_114_1241 | 372 |
| 48 | 3300044842 | Ga0466957_0000515 | Ga0466957_0000515_11905_13032 | 372 |
| 49 | 3300045049 | Ga0466959_0009377 | Ga0466959_0009377_336_1463 | 372 |
| 50 | 3300045836 | Ga0466958_0003175 | Ga0466958_0003175_933_2060 | 372 |
| 51 | 3300061719 | Ga0466962_0018570 | Ga0466962_0018570_178_1305 | 372 |
| 52 | 3300013105 | Ga0157369_10033462 | Ga0157369_100334624 | 375 |
| 53 | 3300037466 | Ga0395898_0027414 | Ga0395898_0027414_952_2079 | 375 |
| 54 | 3300037471 | Ga0395905_0001888 | Ga0395905_0001888_5103_6230 | 375 |
| 55 | 3300038443 | Ga0395901_0007334 | Ga0395901_0007334_8307_9434 | 375 |
| 56 | 3300037418 | Ga0395900_0049234 | Ga0395900_0049234_804_2051 | 377 |
| 57 | 3300013105 | Ga0157369_10226038 | Ga0157369_102260382 | 378 |
| 58 | 3300037312 | Ga0395899_0001364 | Ga0395899_0001364_15648_16784 | 378 |
| 59 | 3300037418 | Ga0395900_0002598 | Ga0395900_0002598_15648_16784 | 378 |
| 60 | 3300037466 | Ga0395898_0006953 | Ga0395898_0006953_9195_10331 | 378 |
| 61 | 3300005578 | Ga0068854_100045600 | Ga0068854_1000456003 | 380 |
| 62 | 3300025981 | Ga0207640_10005368 | Ga0207640_100053683 | 380 |
| 63 | 3300037312 | Ga0395899_0117191 | Ga0395899_0117191_74_1216 | 380 |
| 64 | 3300044684 | Ga0466966_0000039 | Ga0466966_0000039_23680_24921 | 381 |
| 65 | 3300025931 | Ga0207644_10001389 | Ga0207644_100013897 | 385 |
| 66 | 3300037471 | Ga0395905_0184019 | Ga0395905_0184019_183_1430 | 385 |
| 67 | 3300038443 | Ga0395901_0143923 | Ga0395901_0143923_942_2189 | 385 |
| 68 | 3300025933 | Ga0207706_10114487 | Ga0207706_101144872 | 392 |
| 69 | 3300037418 | Ga0395900_0054129 | Ga0395900_0054129_615_1862 | 392 |
| 70 | 3300005339 | Ga0070660_100061806 | Ga0070660_1000618061 | 393 |
| 71 | iso_pu_bacteria | 2599185354 | 2600202326 | 393 |
| 72 | 3300005327 | Ga0070658_10015773 | Ga0070658_100157735 | 394 |
| 73 | 3300005327 | Ga0070658_10053618 | Ga0070658_100536182 | 394 |
| 74 | 3300005331 | Ga0070670_100170056 | Ga0070670_1001700562 | 394 |
| 75 | 3300005366 | Ga0070659_100003382 | Ga0070659_1000033828 | 394 |
| 76 | 3300005366 | Ga0070659_100089497 | Ga0070659_1000894972 | 394 |
| 77 | 3300005457 | Ga0070662_100107127 | Ga0070662_1001071272 | 394 |
| 78 | 3300005539 | Ga0068853_100053490 | Ga0068853_1000534902 | 394 |
| 79 | 3300005564 | Ga0070664_100009514 | Ga0070664_1000095142 | 394 |
| 80 | 3300005616 | Ga0068852_100149862 | Ga0068852_1001498622 | 394 |
| 81 | 3300013100 | Ga0157373_10050934 | Ga0157373_100509342 | 394 |
| 82 | 3300025909 | Ga0207705_10006363 | Ga0207705_100063635 | 394 |
| 83 | 3300025919 | Ga0207657_10017410 | Ga0207657_100174105 | 394 |
| 84 | 3300025932 | Ga0207690_10020496 | Ga0207690_100204965 | 394 |
| 85 | 3300025933 | Ga0207706_10008821 | Ga0207706_100088219 | 394 |
| 86 | 3300025945 | Ga0207679_10098362 | Ga0207679_100983622 | 394 |
| 87 | 3300026041 | Ga0207639_10059714 | Ga0207639_100597142 | 394 |
| 88 | 3300026078 | Ga0207702_10147814 | Ga0207702_101478142 | 394 |
| 89 | 3300046691 | Ga0495670_0000015 | Ga0495670_0000015_60649_61923 | 394 |
| 90 | 3300037471 | Ga0395905_0149632 | Ga0395905_0149632_89_1276 | 395 |
| 91 | 3300038443 | Ga0395901_0179179 | Ga0395901_0179179_463_1653 | 395 |
| 92 | 3300031911 | Ga0307412_10000435 | Ga0307412_100004353 | 396 |
| 93 | 3300048923 | Ga0496120_0013400 | Ga0496120_0013400_1056_2327 | 396 |
| 94 | 3300048925 | Ga0496122_0098516 | Ga0496122_0098516_577_1857 | 396 |
| 95 | 3300048926 | Ga0496123_0115340 | Ga0496123_0115340_78_1358 | 396 |
| 96 | 3300048927 | Ga0496124_0000912 | Ga0496124_0000912_1318_2589 | 396 |
| 97 | 3300048927 | Ga0496124_0003256 | Ga0496124_0003256_835_2115 | 396 |
| 98 | 3300048929 | Ga0496126_0052820 | Ga0496126_0052820_149_1420 | 396 |
| 99 | 3300005434 | Ga0070709_10028646 | Ga0070709_100286463 | 397 |
| 100 | 3300005435 | Ga0070714_100051956 | Ga0070714_1000519562 | 397 |
| 101 | 3300013102 | Ga0157371_10018948 | Ga0157371_100189483 | 397 |
| 102 | 3300013104 | Ga0157370_10100815 | Ga0157370_101008152 | 397 |
| 103 | 3300039437 | Ga0436365_0450343 | Ga0436365_0450343_1187_2449 | 397 |
| 104 | 3300044842 | Ga0466957_0069733 | Ga0466957_0069733_772_1965 | 397 |
| 105 | iso_pu_bacteria | 2751185897 | 2753766062 | 397 |
| 106 | 3300005335 | Ga0070666_10057940 | Ga0070666_100579402 | 398 |
| 107 | 3300005355 | Ga0070671_100000793 | Ga0070671_1000007932 | 398 |
| 108 | 3300005356 | Ga0070674_100134297 | Ga0070674_1001342972 | 398 |
| 109 | 3300005364 | Ga0070673_100073594 | Ga0070673_1000735943 | 398 |
| 110 | 3300005548 | Ga0070665_100033642 | Ga0070665_1000336423 | 398 |
| 111 | 3300005842 | Ga0068858_100289923 | Ga0068858_1002899232 | 398 |
| 112 | 3300009093 | Ga0105240_10129669 | Ga0105240_101296693 | 398 |
| 113 | 3300009177 | Ga0105248_10010048 | Ga0105248_100100482 | 398 |
| 114 | 3300013296 | Ga0157374_10015202 | Ga0157374_100152024 | 398 |
| 115 | 3300013306 | Ga0163162_10059789 | Ga0163162_100597895 | 398 |
| 116 | 3300013308 | Ga0157375_10034730 | Ga0157375_100347302 | 398 |
| 117 | 3300025315 | Ga0207697_10023052 | Ga0207697_100230523 | 398 |
| 118 | 3300025903 | Ga0207680_10098822 | Ga0207680_100988221 | 398 |
| 119 | 3300025913 | Ga0207695_10166787 | Ga0207695_101667871 | 398 |
| 120 | 3300025933 | Ga0207706_10122028 | Ga0207706_101220282 | 398 |
| 121 | 3300025940 | Ga0207691_10032536 | Ga0207691_100325363 | 398 |
| 122 | 3300026121 | Ga0207683_10073349 | Ga0207683_100733493 | 398 |
| 123 | 3300028379 | Ga0268266_10066480 | Ga0268266_100664802 | 398 |
| 124 | 3300048911 | Ga0496108_0019997 | Ga0496108_0019997_2717_3913 | 398 |
| 125 | 3300048916 | Ga0496113_0005302 | Ga0496113_0005302_1160_2356 | 398 |
| 126 | 3300048927 | Ga0496124_0017394 | Ga0496124_0017394_851_2131 | 398 |
| 127 | 3300025933 | Ga0207706_10039828 | Ga0207706_100398282 | 399 |
| 128 | iso_pu_bacteria | 2599185359 | 2600226893 | 399 |
| 129 | iso_pu_bacteria | 2818991466 | 2819715657 | 399 |
| 130 | iso_pu_bacteria | 2879163058 | 2879163767 | 399 |
| 131 | iso_pu_bacteria | 2928526807 | 2928529677 | 399 |
| 132 | iso_pu_bacteria | 2928968154 | 2928970836 | 399 |
| 133 | 3300005334 | Ga0068869_100045875 | Ga0068869_1000458751 | 401 |
| 134 | 3300005355 | Ga0070671_100007194 | Ga0070671_1000071949 | 401 |
| 135 | 3300005530 | Ga0070679_100075943 | Ga0070679_1000759433 | 401 |
| 136 | 3300005535 | Ga0070684_100060150 | Ga0070684_1000601504 | 401 |
| 137 | 3300005543 | Ga0070672_100053566 | Ga0070672_1000535663 | 401 |
| 138 | 3300005564 | Ga0070664_100086600 | Ga0070664_1000866001 | 401 |
| 139 | 3300005578 | Ga0068854_100117349 | Ga0068854_1001173492 | 401 |
| 140 | 3300025315 | Ga0207697_10006722 | Ga0207697_100067226 | 401 |
| 141 | 3300025919 | Ga0207657_10060654 | Ga0207657_100606542 | 401 |
| 142 | 3300025920 | Ga0207649_10007807 | Ga0207649_100078072 | 401 |
| 143 | 3300025933 | Ga0207706_10188297 | Ga0207706_101882971 | 401 |
| 144 | 3300025940 | Ga0207691_10038413 | Ga0207691_100384133 | 401 |
| 145 | 3300025945 | Ga0207679_10009367 | Ga0207679_100093675 | 401 |
| 146 | 3300025945 | Ga0207679_10020127 | Ga0207679_100201275 | 401 |
| 147 | 3300026035 | Ga0207703_10213904 | Ga0207703_102139041 | 401 |
| 148 | 3300026121 | Ga0207683_10127534 | Ga0207683_101275342 | 401 |
| 149 | 3300047318 | Ga0495636_0020360 | Ga0495636_0020360_128_1456 | 401 |
| 150 | 3300048912 | Ga0496109_0152948 | Ga0496109_0152948_536_1831 | 401 |
| 151 | 3300048915 | Ga0496112_0246777 | Ga0496112_0246777_30_1283 | 401 |
| 152 | 3300005330 | Ga0070690_100141680 | Ga0070690_1001416802 | 402 |
| 153 | 3300005335 | Ga0070666_10018011 | Ga0070666_100180114 | 402 |
| 154 | 3300006847 | Ga0075431_100016109 | Ga0075431_1000161098 | 402 |
| 155 | 3300046452 | Ga0495617_000051 | Ga0495617_000051_23499_24719 | 402 |
| 156 | 3300046515 | Ga0495620_0000223 | Ga0495620_0000223_17973_19193 | 402 |
| 157 | 3300048909 | Ga0496106_0000591 | Ga0496106_0000591_8259_9479 | 402 |
| 158 | 3300037471 | Ga0395905_0028093 | Ga0395905_0028093_796_2010 | 403 |
| 159 | 3300048915 | Ga0496112_0038537 | Ga0496112_0038537_265_1482 | 403 |
| 160 | 3300048925 | Ga0496122_0055845 | Ga0496122_0055845_834_2114 | 403 |
| 161 | 3300048926 | Ga0496123_0107807 | Ga0496123_0107807_172_1452 | 403 |
| 162 | 3300005327 | Ga0070658_10013021 | Ga0070658_100130212 | 404 |
| 163 | 3300005339 | Ga0070660_100000726 | Ga0070660_1000007269 | 404 |
| 164 | 3300005539 | Ga0068853_100062415 | Ga0068853_1000624153 | 404 |
| 165 | 3300025909 | Ga0207705_10000002 | Ga0207705_1000000237 | 404 |
| 166 | 3300025919 | Ga0207657_10010899 | Ga0207657_100108996 | 404 |
| 167 | 3300026142 | Ga0207698_10005537 | Ga0207698_100055377 | 404 |
| 168 | 3300044694 | Ga0466963_0004040 | Ga0466963_0004040_5586_6851 | 404 |
| 169 | 3300044842 | Ga0466957_0004705 | Ga0466957_0004705_2031_3296 | 404 |
| 170 | 3300045976 | Ga0466967_0026805 | Ga0466967_0026805_868_2133 | 404 |
| 171 | 3300037853 | Ga0436364_1351302 | Ga0436364_1351302_9736_10953 | 405 |
| 172 | 3300039437 | Ga0436365_0451685 | Ga0436365_0451685_5382_6599 | 405 |
| 173 | 3300005330 | Ga0070690_100043020 | Ga0070690_1000430202 | 406 |
| 174 | 3300005331 | Ga0070670_100059038 | Ga0070670_1000590383 | 407 |
| 175 | 3300005335 | Ga0070666_10118300 | Ga0070666_101183002 | 407 |
| 176 | 3300005355 | Ga0070671_100003799 | Ga0070671_1000037995 | 407 |
| 177 | 3300005618 | Ga0068864_100002647 | Ga0068864_10000264712 | 407 |
| 178 | 3300025903 | Ga0207680_10041497 | Ga0207680_100414973 | 407 |
| 179 | 3300025925 | Ga0207650_10028912 | Ga0207650_100289124 | 407 |
| 180 | 3300025931 | Ga0207644_10000151 | Ga0207644_1000015136 | 407 |
| 181 | 3300025941 | Ga0207711_10002207 | Ga0207711_1000220716 | 407 |
| 182 | 3300026088 | Ga0207641_10066211 | Ga0207641_100662112 | 407 |
| 183 | 3300026095 | Ga0207676_10009721 | Ga0207676_100097217 | 407 |
| 184 | 3300037312 | Ga0395899_0150935 | Ga0395899_0150935_352_1590 | 407 |
| 185 | 3300037418 | Ga0395900_0036406 | Ga0395900_0036406_2756_3997 | 407 |
| 186 | 3300037466 | Ga0395898_0198069 | Ga0395898_0198069_584_1825 | 407 |
| 187 | 3300037471 | Ga0395905_0007846 | Ga0395905_0007846_2503_3741 | 407 |
| 188 | 3300037471 | Ga0395905_0031418 | Ga0395905_0031418_1373_2614 | 407 |
| 189 | 3300038443 | Ga0395901_0045287 | Ga0395901_0045287_2056_3294 | 407 |
| 190 | 3300048912 | Ga0496109_0011318 | Ga0496109_0011318_4587_5816 | 407 |
| 191 | 3300048915 | Ga0496112_0007854 | Ga0496112_0007854_2904_4133 | 407 |
| 192 | 3300005339 | Ga0070660_100009935 | Ga0070660_1000099353 | 408 |
| 193 | 3300005344 | Ga0070661_100049110 | Ga0070661_1000491102 | 408 |
| 194 | 3300005355 | Ga0070671_100022686 | Ga0070671_1000226864 | 408 |
| 195 | 3300005455 | Ga0070663_100083200 | Ga0070663_1000832002 | 408 |
| 196 | 3300005841 | Ga0068863_100014012 | Ga0068863_1000140122 | 408 |
| 197 | 3300005842 | Ga0068858_100199736 | Ga0068858_1001997362 | 408 |
| 198 | 3300006358 | Ga0068871_100039088 | Ga0068871_1000390884 | 408 |
| 199 | 3300009093 | Ga0105240_10173950 | Ga0105240_101739502 | 408 |
| 200 | 3300013307 | Ga0157372_10266456 | Ga0157372_102664562 | 408 |
| 201 | 3300025909 | Ga0207705_10000003 | Ga0207705_10000003576 | 408 |
| 202 | 3300025909 | Ga0207705_10001112 | Ga0207705_100011122 | 408 |
| 203 | 3300025913 | Ga0207695_10034241 | Ga0207695_100342412 | 408 |
| 204 | 3300025919 | Ga0207657_10010100 | Ga0207657_100101003 | 408 |
| 205 | 3300025933 | Ga0207706_10004393 | Ga0207706_1000439312 | 408 |
| 206 | 3300025941 | Ga0207711_10014963 | Ga0207711_100149632 | 408 |
| 207 | 3300025949 | Ga0207667_10039559 | Ga0207667_100395592 | 408 |
| 208 | 3300026067 | Ga0207678_10002336 | Ga0207678_1000233612 | 408 |
| 209 | 3300026088 | Ga0207641_10004390 | Ga0207641_100043904 | 408 |
| 210 | 3300026142 | Ga0207698_10021118 | Ga0207698_100211182 | 408 |
| 211 | 3300037418 | Ga0395900_0318692 | Ga0395900_0318692_283_1512 | 408 |
| 212 | 3300037466 | Ga0395898_0318547 | Ga0395898_0318547_24_1253 | 408 |
| 213 | 3300037471 | Ga0395905_0000358 | Ga0395905_0000358_59071_60303 | 408 |
| 214 | 3300044693 | Ga0466961_0038089 | Ga0466961_0038089_1185_2420 | 408 |
| 215 | 3300005435 | Ga0070714_100101864 | Ga0070714_1001018642 | 409 |
| 216 | 3300005458 | Ga0070681_10064640 | Ga0070681_100646402 | 409 |
| 217 | 3300025929 | Ga0207664_10032728 | Ga0207664_100327282 | 409 |
| 218 | 3300037418 | Ga0395900_0030978 | Ga0395900_0030978_4185_5417 | 409 |
| 219 | 3300037466 | Ga0395898_0025349 | Ga0395898_0025349_4685_5917 | 409 |
| 220 | 3300037471 | Ga0395905_0021568 | Ga0395905_0021568_1433_2665 | 409 |
| 221 | 3300037471 | Ga0395905_0080724 | Ga0395905_0080724_495_1727 | 409 |
| 222 | 3300005327 | Ga0070658_10070969 | Ga0070658_100709692 | 410 |
| 223 | 3300005327 | Ga0070658_10100950 | Ga0070658_101009502 | 410 |
| 224 | 3300005331 | Ga0070670_100002964 | Ga0070670_1000029642 | 410 |
| 225 | 3300005455 | Ga0070663_100127076 | Ga0070663_1001270761 | 410 |
| 226 | 3300005456 | Ga0070678_100086614 | Ga0070678_1000866142 | 410 |
| 227 | 3300005458 | Ga0070681_10011596 | Ga0070681_100115965 | 410 |
| 228 | 3300005530 | Ga0070679_100036155 | Ga0070679_1000361555 | 410 |
| 229 | 3300005614 | Ga0068856_100011453 | Ga0068856_1000114535 | 410 |
| 230 | 3300009093 | Ga0105240_10049323 | Ga0105240_100493232 | 410 |
| 231 | 3300013100 | Ga0157373_10058941 | Ga0157373_100589412 | 410 |
| 232 | 3300013104 | Ga0157370_10031131 | Ga0157370_100311313 | 410 |
| 233 | 3300013104 | Ga0157370_10115773 | Ga0157370_101157732 | 410 |
| 234 | 3300013105 | Ga0157369_10014845 | Ga0157369_100148457 | 410 |
| 235 | 3300013105 | Ga0157369_10114383 | Ga0157369_101143832 | 410 |
| 236 | 3300021388 | Ga0213875_10007660 | Ga0213875_100076606 | 410 |
| 237 | 3300025909 | Ga0207705_10014713 | Ga0207705_100147133 | 410 |
| 238 | 3300025909 | Ga0207705_10015701 | Ga0207705_100157014 | 410 |
| 239 | 3300025909 | Ga0207705_10082175 | Ga0207705_100821752 | 410 |
| 240 | 3300025909 | Ga0207705_10101002 | Ga0207705_101010022 | 410 |
| 241 | 3300025912 | Ga0207707_10281570 | Ga0207707_102815701 | 410 |
| 242 | 3300025913 | Ga0207695_10004994 | Ga0207695_100049946 | 410 |
| 243 | 3300025919 | Ga0207657_10001862 | Ga0207657_100018625 | 410 |
| 244 | 3300025921 | Ga0207652_10021319 | Ga0207652_100213195 | 410 |
| 245 | 3300025921 | Ga0207652_10091506 | Ga0207652_100915062 | 410 |
| 246 | 3300025981 | Ga0207640_10005167 | Ga0207640_100051672 | 410 |
| 247 | 3300026067 | Ga0207678_10005316 | Ga0207678_100053166 | 410 |
| 248 | 3300026095 | Ga0207676_10005530 | Ga0207676_100055308 | 410 |
| 249 | 3300028379 | Ga0268266_10279503 | Ga0268266_102795031 | 410 |
| 250 | 3300037418 | Ga0395900_0188138 | Ga0395900_0188138_601_1836 | 410 |
| 251 | 3300037418 | Ga0395900_0221394 | Ga0395900_0221394_444_1679 | 410 |
| 252 | 3300037466 | Ga0395898_0026748 | Ga0395898_0026748_1273_2517 | 410 |
| 253 | 3300037471 | Ga0395905_0092739 | Ga0395905_0092739_1068_2303 | 410 |
| 254 | 3300005329 | Ga0070683_100047789 | Ga0070683_1000477893 | 411 |
| 255 | 3300005539 | Ga0068853_100012265 | Ga0068853_1000122653 | 411 |
| 256 | 3300005563 | Ga0068855_100271700 | Ga0068855_1002717002 | 411 |
| 257 | 3300005577 | Ga0068857_100028701 | Ga0068857_1000287013 | 411 |
| 258 | 3300025904 | Ga0207647_10005602 | Ga0207647_100056026 | 411 |
| 259 | 3300025909 | Ga0207705_10052415 | Ga0207705_100524152 | 411 |
| 260 | 3300025913 | Ga0207695_10047721 | Ga0207695_100477215 | 411 |
| 261 | 3300025919 | Ga0207657_10058648 | Ga0207657_100586484 | 411 |
| 262 | 3300025949 | Ga0207667_10007293 | Ga0207667_1000729315 | 411 |
| 263 | 3300025949 | Ga0207667_10118207 | Ga0207667_101182072 | 411 |
| 264 | 3300026041 | Ga0207639_10066367 | Ga0207639_100663672 | 411 |
| 265 | 3300026067 | Ga0207678_10240968 | Ga0207678_102409682 | 411 |
| 266 | 3300026078 | Ga0207702_10048935 | Ga0207702_100489354 | 411 |
| 267 | 3300026116 | Ga0207674_10003100 | Ga0207674_1000310022 | 411 |
| 268 | 3300037471 | Ga0395905_0002566 | Ga0395905_0002566_3859_5100 | 411 |
| 269 | 3300037471 | Ga0395905_0047246 | Ga0395905_0047246_621_1856 | 411 |
| 270 | 3300044719 | Ga0466971_0077878 | Ga0466971_0077878_15_1262 | 411 |
| 271 | 3300045976 | Ga0466967_0038584 | Ga0466967_0038584_1592_2830 | 411 |
| 272 | 3300038443 | Ga0395901_0012581 | Ga0395901_0012581_6133_7374 | 413 |
| 273 | 3300044693 | Ga0466961_0066433 | Ga0466961_0066433_816_2066 | 413 |
| 274 | 3300045049 | Ga0466959_0153138 | Ga0466959_0153138_134_1384 | 413 |
| 275 | 3300005355 | Ga0070671_100106242 | Ga0070671_1001062422 | 414 |
| 276 | 3300005564 | Ga0070664_100042322 | Ga0070664_1000423223 | 414 |
| 277 | 3300005616 | Ga0068852_100109043 | Ga0068852_1001090432 | 414 |
| 278 | 3300013105 | Ga0157369_10088448 | Ga0157369_100884482 | 414 |
| 279 | 3300025904 | Ga0207647_10029185 | Ga0207647_100291853 | 414 |
| 280 | 3300025909 | Ga0207705_10026238 | Ga0207705_100262383 | 414 |
| 281 | 3300026142 | Ga0207698_10043669 | Ga0207698_100436694 | 414 |
| 282 | 3300005339 | Ga0070660_100001819 | Ga0070660_10000181913 | 415 |
| 283 | 3300005339 | Ga0070660_100083329 | Ga0070660_1000833292 | 415 |
| 284 | 3300005355 | Ga0070671_100001688 | Ga0070671_1000016887 | 415 |
| 285 | 3300005364 | Ga0070673_100024636 | Ga0070673_1000246364 | 415 |
| 286 | 3300005563 | Ga0068855_100000348 | Ga0068855_10000034827 | 415 |
| 287 | 3300005618 | Ga0068864_100001733 | Ga0068864_10000173311 | 415 |
| 288 | 3300009177 | Ga0105248_10003466 | Ga0105248_1000346611 | 415 |
| 289 | 3300025909 | Ga0207705_10000208 | Ga0207705_1000020843 | 415 |
| 290 | 3300025919 | Ga0207657_10002855 | Ga0207657_100028557 | 415 |
| 291 | 3300025919 | Ga0207657_10143833 | Ga0207657_101438332 | 415 |
| 292 | 3300025932 | Ga0207690_10052532 | Ga0207690_100525322 | 415 |
| 293 | 3300025941 | Ga0207711_10001841 | Ga0207711_100018419 | 415 |
| 294 | 3300025949 | Ga0207667_10004895 | Ga0207667_100048958 | 415 |
| 295 | 3300037312 | Ga0395899_0008516 | Ga0395899_0008516_1275_2522 | 415 |
| 296 | 3300037466 | Ga0395898_0366921 | Ga0395898_0366921_100_1347 | 415 |
| 297 | 3300044693 | Ga0466961_0015406 | Ga0466961_0015406_2894_4156 | 415 |
| 298 | 3300048903 | Ga0496100_0076945 | Ga0496100_0076945_604_1860 | 415 |
| 299 | 3300048904 | Ga0496101_0014063 | Ga0496101_0014063_1209_2465 | 415 |
| 300 | 3300048909 | Ga0496106_0027899 | Ga0496106_0027899_2894_4150 | 415 |
| 301 | 3300048910 | Ga0496107_0002482 | Ga0496107_0002482_7227_8483 | 415 |
| 302 | 3300048912 | Ga0496109_0015589 | Ga0496109_0015589_2881_4137 | 415 |
| 303 | 3300048916 | Ga0496113_0063780 | Ga0496113_0063780_1269_2525 | 415 |
| 304 | 3300025893 | Ga0207682_10020919 | Ga0207682_100209191 | 416 |
| 305 | 3300005329 | Ga0070683_100009638 | Ga0070683_1000096382 | 417 |
| 306 | 3300005535 | Ga0070684_100006143 | Ga0070684_1000061438 | 417 |
| 307 | 3300013102 | Ga0157371_10093437 | Ga0157371_100934372 | 417 |
| 308 | 3300025920 | Ga0207649_10091597 | Ga0207649_100915972 | 417 |
| 309 | 3300037418 | Ga0395900_0072904 | Ga0395900_0072904_455_1708 | 417 |
| 310 | 3300044694 | Ga0466963_0123656 | Ga0466963_0123656_304_1644 | 417 |
| 311 | 3300044719 | Ga0466971_0017664 | Ga0466971_0017664_1337_2677 | 417 |
| 312 | 3300044735 | Ga0466968_0005016 | Ga0466968_0005016_2024_3349 | 417 |
| 313 | 3300044765 | Ga0466970_0002859 | Ga0466970_0002859_4090_5415 | 417 |
| 314 | 3300044842 | Ga0466957_0007292 | Ga0466957_0007292_1984_3324 | 417 |
| 315 | 3300045049 | Ga0466959_0038972 | Ga0466959_0038972_2033_3358 | 417 |
| 316 | 3300045836 | Ga0466958_0028793 | Ga0466958_0028793_935_2260 | 417 |
| 317 | 3300005563 | Ga0068855_100246271 | Ga0068855_1002462712 | 418 |
| 318 | 3300025932 | Ga0207690_10043173 | Ga0207690_100431733 | 418 |
| 319 | 3300005530 | Ga0070679_100176522 | Ga0070679_1001765221 | 419 |
| 320 | 3300025917 | Ga0207660_10000716 | Ga0207660_1000071621 | 419 |
| 321 | 3300002075 | JGI24738J21930_10000830 | JGI24738J21930_100008305 | 420 |
| 322 | 3300005327 | Ga0070658_10000329 | Ga0070658_1000032927 | 420 |
| 323 | 3300005329 | Ga0070683_100007230 | Ga0070683_1000072305 | 420 |
| 324 | 3300005331 | Ga0070670_100032244 | Ga0070670_1000322445 | 420 |
| 325 | 3300005335 | Ga0070666_10000967 | Ga0070666_1000096712 | 420 |
| 326 | 3300005336 | Ga0070680_100067732 | Ga0070680_1000677322 | 420 |
| 327 | 3300005337 | Ga0070682_100054943 | Ga0070682_1000549432 | 420 |
| 328 | 3300005339 | Ga0070660_100001889 | Ga0070660_1000018897 | 420 |
| 329 | 3300005344 | Ga0070661_100001222 | Ga0070661_10000122210 | 420 |
| 330 | 3300005355 | Ga0070671_100082252 | Ga0070671_1000822521 | 420 |
| 331 | 3300005366 | Ga0070659_100000356 | Ga0070659_10000035627 | 420 |
| 332 | 3300005367 | Ga0070667_100010798 | Ga0070667_1000107982 | 420 |
| 333 | 3300005435 | Ga0070714_100097766 | Ga0070714_1000977662 | 420 |
| 334 | 3300005455 | Ga0070663_100008716 | Ga0070663_1000087166 | 420 |
| 335 | 3300005457 | Ga0070662_100000069 | Ga0070662_10000006911 | 420 |
| 336 | 3300005535 | Ga0070684_100034194 | Ga0070684_1000341942 | 420 |
| 337 | 3300005539 | Ga0068853_100001087 | Ga0068853_1000010875 | 420 |
| 338 | 3300005547 | Ga0070693_100001251 | Ga0070693_1000012512 | 420 |
| 339 | 3300005548 | Ga0070665_100007044 | Ga0070665_10000704411 | 420 |
| 340 | 3300005563 | Ga0068855_100000942 | Ga0068855_10000094217 | 420 |
| 341 | 3300005564 | Ga0070664_100000548 | Ga0070664_10000054827 | 420 |
| 342 | 3300005578 | Ga0068854_100127736 | Ga0068854_1001277362 | 420 |
| 343 | 3300005614 | Ga0068856_100000163 | Ga0068856_1000001633 | 420 |
| 344 | 3300005616 | Ga0068852_100000348 | Ga0068852_10000034811 | 420 |
| 345 | 3300005842 | Ga0068858_100083409 | Ga0068858_1000834094 | 420 |
| 346 | 3300006237 | Ga0097621_100114874 | Ga0097621_1001148742 | 420 |
| 347 | 3300006358 | Ga0068871_100102050 | Ga0068871_1001020502 | 420 |
| 348 | 3300009174 | Ga0105241_10236283 | Ga0105241_102362832 | 420 |
| 349 | 3300009177 | Ga0105248_10004624 | Ga0105248_1000462416 | 420 |
| 350 | 3300009551 | Ga0105238_10062564 | Ga0105238_100625642 | 420 |
| 351 | 3300013100 | Ga0157373_10036977 | Ga0157373_100369772 | 420 |
| 352 | 3300013102 | Ga0157371_10010498 | Ga0157371_100104985 | 420 |
| 353 | 3300014325 | Ga0163163_10000246 | Ga0163163_1000024651 | 420 |
| 354 | 3300025903 | Ga0207680_10001932 | Ga0207680_100019326 | 420 |
| 355 | 3300025904 | Ga0207647_10013395 | Ga0207647_100133952 | 420 |
| 356 | 3300025909 | Ga0207705_10000095 | Ga0207705_1000009574 | 420 |
| 357 | 3300025917 | Ga0207660_10052569 | Ga0207660_100525693 | 420 |
| 358 | 3300025919 | Ga0207657_10002486 | Ga0207657_100024869 | 420 |
| 359 | 3300025920 | Ga0207649_10000014 | Ga0207649_10000014167 | 420 |
| 360 | 3300025925 | Ga0207650_10132955 | Ga0207650_101329552 | 420 |
| 361 | 3300025929 | Ga0207664_10030036 | Ga0207664_100300362 | 420 |
| 362 | 3300025931 | Ga0207644_10061942 | Ga0207644_100619421 | 420 |
| 363 | 3300025932 | Ga0207690_10000229 | Ga0207690_1000022920 | 420 |
| 364 | 3300025933 | Ga0207706_10000719 | Ga0207706_1000071927 | 420 |
| 365 | 3300025941 | Ga0207711_10015751 | Ga0207711_100157512 | 420 |
| 366 | 3300025945 | Ga0207679_10000116 | Ga0207679_1000011618 | 420 |
| 367 | 3300025949 | Ga0207667_10001695 | Ga0207667_100016957 | 420 |
| 368 | 3300025981 | Ga0207640_10032465 | Ga0207640_100324654 | 420 |
| 369 | 3300025986 | Ga0207658_10011656 | Ga0207658_100116565 | 420 |
| 370 | 3300026035 | Ga0207703_10051718 | Ga0207703_100517184 | 420 |
| 371 | 3300026041 | Ga0207639_10000406 | Ga0207639_1000040610 | 420 |
| 372 | 3300026078 | Ga0207702_10000272 | Ga0207702_1000027212 | 420 |
| 373 | 3300026142 | Ga0207698_10000266 | Ga0207698_1000026627 | 420 |
| 374 | 3300028379 | Ga0268266_10012591 | Ga0268266_100125916 | 420 |
| 375 | 3300037418 | Ga0395900_0026581 | Ga0395900_0026581_3334_4602 | 420 |
| 376 | 3300037418 | Ga0395900_0066233 | Ga0395900_0066233_2417_3679 | 420 |
| 377 | 3300037471 | Ga0395905_0143275 | Ga0395905_0143275_894_2156 | 420 |
| 378 | 3300044693 | Ga0466961_0006223 | Ga0466961_0006223_5369_6655 | 420 |
| 379 | 3300044765 | Ga0466970_0034083 | Ga0466970_0034083_344_1630 | 420 |
| 380 | 3300048910 | Ga0496107_0037449 | Ga0496107_0037449_158_1420 | 420 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g8s-assembly2.cif.gz_B | crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form | 0.9248 | 44 | 416 |
| 2g8s-assembly2.cif.gz_B | crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form | 0.9197 | 44 | 416 |
| 7cgz-assembly1.cif.gz_B | glucose dehydrogenase | 0.9086 | 45 | 412 |
| 7cdy-assembly2.cif.gz_B | crystal structure of glucose dehydrogenase | 0.9015 | 45 | 417 |
| 7cdy-assembly1.cif.gz_A | crystal structure of glucose dehydrogenase | 0.9004 | 45 | 417 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75804_19_370_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9049 | 36 | 416 | 2.120.10.30 |
| af_P75804_19_370_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9025 | 36 | 416 | 2.120.10.30 |
| 3a9gA00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8667 | 44 | 417 | 2.120.10.30 |
| 3a9gA00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8544 | 44 | 417 | 2.120.10.30 |
| 2ismB00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8333 | 44 | 414 | 2.120.10.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A653XSF3-F1-model_v4 | Dehydrogenase | 0.9802 | 34 | 418 |
|
| AF-A0A031I3X8-F1-model_v4 | Putative glucose/sorbosone dehydrogenase | 0.9797 | 47 | 420 |
|
| AF-A0A2E0N664-F1-model_v4 | Glucose/Sorbosone dehydrogenase domain-containing protein | 0.9781 | 292 | 416 |
|
| AF-A0A031I3X8-F1-model_v4 | Putative glucose/sorbosone dehydrogenase | 0.9745 | 47 | 420 |
|
| AF-A0A829RIC8-F1-model_v4 | deleted | 0.9729 | 272 | 418 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar