F428753

General Info

Members Datasets Scaffolds Average Seq Length
380 136 373 405

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0123656|Ga0466963_0123656_304_1644
Length 446
Sequence MRRHRTFVRRCALPVHQDKNGVSVMRMRVGRYGLCLVLAACGTAAAPNAQANNADTAEEASATNPQDPPFTITPVASFDNPWAMAFLPGSTNALVTEKPGHIWLVDTRTGTKKPIAGAPRVVANGQGGLLDIALSPTFASDNQVYLTYSELSTNGGSGLALARAKFVPDAVGGYLEGRTVLWHDPAGGQGGQFGAIIAFAPDGKSLFLSSGERQRFTPAQDPSQPIGKILHLTLDGNPAPGNPMAGKLGAPTVTIINPPEDTRAAKHAAGRPFKWPGPNLTPAETWSSGHRNPYGLTFDAQGRLWETEMGPRGGDELNLILPGRNYGWPLVSEGQNYNGVPIPKPSTRPDLERAKLFWVPSVSPTTLLIYSGNMFPQWKGSGLIGSLSGESLIRVTFNGDSAEKADRWNLGKRIRWVGQGPDGVIYLLEDGGSGGLYRLTPPAVRR

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
4 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
5 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
6 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
7 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 0
Isolates 1.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.05
Rhizosphere 89.74
Stem 0
Stem Tuber 0
Unclassified 4.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10000830 3300002075 Bacteria 8842
2 Ga0070658_10000329 3300005327 Bacteria 40648
3 Ga0070658_10013021 3300005327 Bacteria 6675
4 Ga0070658_10015773 3300005327 Bacteria 6040
5 Ga0070658_10053618 3300005327 Bacteria 3273
6 Ga0070658_10070969 3300005327 Bacteria 2852
7 Ga0070658_10100950 3300005327 Bacteria 2385
8 Ga0070683_100007230 3300005329 Bacteria 9370
9 Ga0070683_100009638 3300005329 Bacteria 8264
10 Ga0070683_100047789 3300005329 Bacteria 3955
11 Ga0070690_100043020 3300005330 Bacteria 2863
12 Ga0070690_100141680 3300005330 Bacteria 1632
13 Ga0070670_100002964 3300005331 Bacteria 14060
14 Ga0070670_100032244 3300005331 Bacteria 4512
15 Ga0070670_100059038 3300005331 Bacteria 3293
16 Ga0070670_100170056 3300005331 Bacteria 1890
17 Ga0068869_100045875 3300005334 Bacteria 3148
18 Ga0070666_10000967 3300005335 Bacteria 17525
19 Ga0070666_10018011 3300005335 Bacteria 4534
20 Ga0070666_10057940 3300005335 Bacteria 2619
21 Ga0070666_10118300 3300005335 Bacteria 1836
22 Ga0070680_100067732 3300005336 Bacteria 2929
23 Ga0070682_100054943 3300005337 Bacteria 2500
24 Ga0070660_100000726 3300005339 Bacteria 21876
25 Ga0070660_100001819 3300005339 Bacteria 14641
26 Ga0070660_100001889 3300005339 Bacteria 14420
27 Ga0070660_100009935 3300005339 Bacteria 6714
28 Ga0070660_100061806 3300005339 Bacteria 2908
29 Ga0070660_100083329 3300005339 Bacteria 2512
30 Ga0070661_100001222 3300005344 Bacteria 18099
31 Ga0070661_100049110 3300005344 Bacteria 3089
32 Ga0070671_100000793 3300005355 Bacteria 22759
33 Ga0070671_100001688 3300005355 Bacteria 16743
34 Ga0070671_100003799 3300005355 Bacteria 11849
35 Ga0070671_100007194 3300005355 Bacteria 8897
36 Ga0070671_100022686 3300005355 Bacteria 5127
37 Ga0070671_100082252 3300005355 Bacteria 2692
38 Ga0070671_100106242 3300005355 Bacteria 2356
39 Ga0070674_100134297 3300005356 Bacteria 1849
40 Ga0070673_100024636 3300005364 Bacteria 4416
41 Ga0070673_100073594 3300005364 Bacteria 2751
42 Ga0070659_100000356 3300005366 Bacteria 34780
43 Ga0070659_100003382 3300005366 Bacteria 11356
44 Ga0070659_100089497 3300005366 Bacteria 2466
45 Ga0070667_100010798 3300005367 Bacteria 7546
46 Ga0070709_10028646 3300005434 Bacteria 3324
47 Ga0070714_100051956 3300005435 Bacteria 3495
48 Ga0070714_100097766 3300005435 Bacteria 2581
49 Ga0070714_100101864 3300005435 Bacteria 2531
50 Ga0070663_100008716 3300005455 Bacteria 6252
51 Ga0070663_100083200 3300005455 Bacteria 2356
52 Ga0070663_100127076 3300005455 Bacteria 1932
53 Ga0070678_100086614 3300005456 Bacteria 2390
54 Ga0070662_100000069 3300005457 Bacteria 56301
55 Ga0070662_100107127 3300005457 Bacteria 2124
56 Ga0070681_10011596 3300005458 Bacteria 8724
57 Ga0070681_10064640 3300005458 Bacteria 3629
58 Ga0070679_100036155 3300005530 Bacteria 4900
59 Ga0070679_100075943 3300005530 Bacteria 3350
60 Ga0070679_100176522 3300005530 Bacteria 2109
61 Ga0070684_100006143 3300005535 Bacteria 9261
62 Ga0070684_100034194 3300005535 Bacteria 4345
63 Ga0070684_100060150 3300005535 Bacteria 3322
64 Ga0068853_100001087 3300005539 Bacteria 19234
65 Ga0068853_100012265 3300005539 Bacteria 6969
66 Ga0068853_100053490 3300005539 Bacteria 3477
67 Ga0068853_100062415 3300005539 Bacteria 3225
68 Ga0070672_100053566 3300005543 Bacteria 3155
69 Ga0070693_100001251 3300005547 Bacteria 11489
70 Ga0070665_100007044 3300005548 Bacteria 11423
71 Ga0070665_100033642 3300005548 Bacteria 5157
72 Ga0068855_100000259 3300005563 Bacteria 66061
73 Ga0068855_100000348 3300005563 Bacteria 57384
74 Ga0068855_100000942 3300005563 Bacteria 36250
75 Ga0068855_100246271 3300005563 Bacteria 1995
76 Ga0068855_100271700 3300005563 Bacteria 1885
77 Ga0070664_100000548 3300005564 Bacteria 28696
78 Ga0070664_100009514 3300005564 Bacteria 7880
79 Ga0070664_100042322 3300005564 Bacteria 3845
80 Ga0070664_100086600 3300005564 Bacteria 2706
81 Ga0068857_100028701 3300005577 Bacteria 4909
82 Ga0068854_100045600 3300005578 Bacteria 3118
83 Ga0068854_100117349 3300005578 Bacteria 2015
84 Ga0068854_100127736 3300005578 Bacteria 1938
85 Ga0068856_100000163 3300005614 Bacteria 68963
86 Ga0068856_100011453 3300005614 Bacteria 8605
87 Ga0068856_100171409 3300005614 Bacteria 2182
88 Ga0068852_100000348 3300005616 Bacteria 31130
89 Ga0068852_100109043 3300005616 Bacteria 2513
90 Ga0068852_100149862 3300005616 Bacteria 2168
91 Ga0068864_100001733 3300005618 Bacteria 17945
92 Ga0068864_100002647 3300005618 Bacteria 14784
93 Ga0068863_100014012 3300005841 Bacteria 7725
94 Ga0068858_100083409 3300005842 Bacteria 2972
95 Ga0068858_100199736 3300005842 Unclassified 1890
96 Ga0068858_100289923 3300005842 Bacteria 1560
97 Ga0097621_100114874 3300006237 Bacteria 2278
98 Ga0068871_100039088 3300006358 Bacteria 3794
99 Ga0068871_100102050 3300006358 Bacteria 2404
100 Ga0075431_100016109 3300006847 Bacteria 7585
101 Ga0105240_10049323 3300009093 Bacteria 5315
102 Ga0105240_10129669 3300009093 Bacteria 3026
103 Ga0105240_10173950 3300009093 Bacteria 2547
104 Ga0105241_10236283 3300009174 Bacteria 1543
105 Ga0105248_10003466 3300009177 Bacteria 17517
106 Ga0105248_10004624 3300009177 Bacteria 15220
107 Ga0105248_10005282 3300009177 Bacteria 14214
108 Ga0105248_10010048 3300009177 Bacteria 10423
109 Ga0105248_10151165 3300009177 Bacteria 2619
110 Ga0105248_10260556 3300009177 Bacteria 1952
111 Ga0105238_10062564 3300009551 Bacteria 3722
112 Ga0157373_10036977 3300013100 Bacteria 3503
113 Ga0157373_10050934 3300013100 Bacteria 2948
114 Ga0157373_10058941 3300013100 Bacteria 2721
115 Ga0157371_10010498 3300013102 Bacteria 7204
116 Ga0157371_10018948 3300013102 Bacteria 5081
117 Ga0157371_10093437 3300013102 Bacteria 2131
118 Ga0157370_10004637 3300013104 Bacteria 15715
119 Ga0157370_10031131 3300013104 Bacteria 5222
120 Ga0157370_10100815 3300013104 Bacteria 2705
121 Ga0157370_10115773 3300013104 Bacteria 2504
122 Ga0157369_10014845 3300013105 Bacteria 8790
123 Ga0157369_10033462 3300013105 Bacteria 5648
124 Ga0157369_10088448 3300013105 Bacteria 3306
125 Ga0157369_10110624 3300013105 Bacteria 2921
126 Ga0157369_10114383 3300013105 Bacteria 2865
127 Ga0157369_10226038 3300013105 Bacteria 1958
128 Ga0157374_10015202 3300013296 Bacteria 6748
129 Ga0163162_10059789 3300013306 Bacteria 3843
130 Ga0157372_10266456 3300013307 Bacteria 1990
131 Ga0157375_10034730 3300013308 Bacteria 4806
132 Ga0163163_10000246 3300014325 Bacteria 55606
133 Ga0213875_10007660 3300021388 Bacteria 5563
134 Ga0207697_10006722 3300025315 Bacteria 5176
135 Ga0207697_10023052 3300025315 Bacteria 2550
136 Ga0207682_10020919 3300025893 Bacteria 2572
137 Ga0207680_10001932 3300025903 Bacteria 9725
138 Ga0207680_10041497 3300025903 Bacteria 2685
139 Ga0207680_10098822 3300025903 Bacteria 1871
140 Ga0207647_10005602 3300025904 Bacteria 9176
141 Ga0207647_10013395 3300025904 Bacteria 5686
142 Ga0207647_10029185 3300025904 Bacteria 3573
143 Ga0207705_10000002 3300025909 Bacteria 2046852
144 Ga0207705_10000003 3300025909 Bacteria 709270
145 Ga0207705_10000095 3300025909 Bacteria 106506
146 Ga0207705_10000208 3300025909 Bacteria 59559
147 Ga0207705_10001112 3300025909 Bacteria 21864
148 Ga0207705_10006363 3300025909 Bacteria 8761
149 Ga0207705_10014713 3300025909 Bacteria 5626
150 Ga0207705_10015701 3300025909 Bacteria 5436
151 Ga0207705_10026238 3300025909 Bacteria 4156
152 Ga0207705_10052415 3300025909 Bacteria 2937
153 Ga0207705_10082175 3300025909 Bacteria 2349
154 Ga0207705_10101002 3300025909 Bacteria 2122
155 Ga0207707_10281570 3300025912 Bacteria 1440
156 Ga0207695_10004994 3300025913 Bacteria 17834
157 Ga0207695_10034241 3300025913 Bacteria 5528
158 Ga0207695_10047721 3300025913 Bacteria 4529
159 Ga0207695_10166787 3300025913 Bacteria 2130
160 Ga0207695_10336176 3300025913 Bacteria 1398
161 Ga0207660_10000716 3300025917 Bacteria 22075
162 Ga0207660_10052569 3300025917 Bacteria 2900
163 Ga0207657_10001862 3300025919 Bacteria 22804
164 Ga0207657_10002486 3300025919 Bacteria 19933
165 Ga0207657_10002855 3300025919 Bacteria 18575
166 Ga0207657_10010100 3300025919 Bacteria 9439
167 Ga0207657_10010899 3300025919 Bacteria 9048
168 Ga0207657_10017410 3300025919 Bacteria 6890
169 Ga0207657_10058648 3300025919 Bacteria 3311
170 Ga0207657_10060654 3300025919 Bacteria 3245
171 Ga0207657_10143833 3300025919 Bacteria 1947
172 Ga0207649_10000014 3300025920 Bacteria 255001
173 Ga0207649_10007807 3300025920 Bacteria 5822
174 Ga0207649_10091597 3300025920 Bacteria 1991
175 Ga0207652_10021319 3300025921 Bacteria 5348
176 Ga0207652_10091506 3300025921 Bacteria 2675
177 Ga0207650_10028912 3300025925 Bacteria 3979
178 Ga0207650_10132955 3300025925 Bacteria 1949
179 Ga0207664_10030036 3300025929 Bacteria 4147
180 Ga0207664_10032728 3300025929 Bacteria 3988
181 Ga0207644_10000151 3300025931 Bacteria 49728
182 Ga0207644_10001389 3300025931 Bacteria 15624
183 Ga0207644_10061942 3300025931 Bacteria 2711
184 Ga0207690_10000229 3300025932 Bacteria 41732
185 Ga0207690_10020496 3300025932 Bacteria 4086
186 Ga0207690_10043173 3300025932 Bacteria 2966
187 Ga0207690_10052532 3300025932 Bacteria 2730
188 Ga0207706_10000719 3300025933 Bacteria 34558
189 Ga0207706_10004393 3300025933 Bacteria 13254
190 Ga0207706_10008821 3300025933 Bacteria 9280
191 Ga0207706_10039828 3300025933 Bacteria 4166
192 Ga0207706_10114487 3300025933 Bacteria 2372
193 Ga0207706_10122028 3300025933 Bacteria 2292
194 Ga0207706_10188297 3300025933 Bacteria 1812
195 Ga0207691_10032536 3300025940 Bacteria 4862
196 Ga0207691_10038413 3300025940 Bacteria 4430
197 Ga0207711_10001841 3300025941 Bacteria 19341
198 Ga0207711_10002207 3300025941 Bacteria 17481
199 Ga0207711_10014963 3300025941 Bacteria 6445
200 Ga0207711_10015751 3300025941 Bacteria 6271
201 Ga0207679_10000116 3300025945 Bacteria 64406
202 Ga0207679_10009367 3300025945 Bacteria 6272
203 Ga0207679_10020127 3300025945 Bacteria 4498
204 Ga0207679_10098362 3300025945 Bacteria 2281
205 Ga0207667_10001695 3300025949 Bacteria 27714
206 Ga0207667_10004895 3300025949 Bacteria 16353
207 Ga0207667_10007293 3300025949 Bacteria 13323
208 Ga0207667_10039559 3300025949 Bacteria 5025
209 Ga0207667_10042269 3300025949 Bacteria 4846
210 Ga0207667_10118207 3300025949 Bacteria 2732
211 Ga0207640_10005167 3300025981 Bacteria 7098
212 Ga0207640_10005368 3300025981 Bacteria 6989
213 Ga0207640_10032465 3300025981 Bacteria 3238
214 Ga0207658_10011656 3300025986 Bacteria 5987
215 Ga0207703_10051718 3300026035 Bacteria 3331
216 Ga0207703_10213904 3300026035 Bacteria 1720
217 Ga0207639_10000406 3300026041 Bacteria 29790
218 Ga0207639_10059714 3300026041 Bacteria 2939
219 Ga0207639_10066367 3300026041 Bacteria 2804
220 Ga0207678_10002336 3300026067 Bacteria 17192
221 Ga0207678_10005316 3300026067 Bacteria 11525
222 Ga0207678_10240968 3300026067 Bacteria 1549
223 Ga0207702_10000272 3300026078 Bacteria 59391
224 Ga0207702_10006879 3300026078 Bacteria 9748
225 Ga0207702_10048935 3300026078 Bacteria 3566
226 Ga0207702_10147814 3300026078 Bacteria 2134
227 Ga0207641_10004390 3300026088 Bacteria 12225
228 Ga0207641_10066211 3300026088 Bacteria 3092
229 Ga0207676_10005530 3300026095 Bacteria 8944
230 Ga0207676_10009721 3300026095 Bacteria 6838
231 Ga0207674_10003100 3300026116 Bacteria 20520
232 Ga0207683_10073349 3300026121 Bacteria 3028
233 Ga0207683_10127534 3300026121 Bacteria 2287
234 Ga0207698_10000266 3300026142 Bacteria 31722
235 Ga0207698_10005537 3300026142 Bacteria 7816
236 Ga0207698_10021118 3300026142 Bacteria 4496
237 Ga0207698_10043669 3300026142 Bacteria 3360
238 Ga0268266_10012591 3300028379 Bacteria 7309
239 Ga0268266_10066480 3300028379 Bacteria 3118
240 Ga0268266_10279503 3300028379 Unclassified 1552
241 Ga0307408_100048454 3300031548 Bacteria 3048
242 Ga0307410_10033952 3300031852 Bacteria 3299
243 Ga0307412_10000435 3300031911 Bacteria 25212
244 Ga0395899_0001364 3300037312 Bacteria 20941
245 Ga0395899_0008516 3300037312 Bacteria 7898
246 Ga0395899_0017035 3300037312 Bacteria 5536
247 Ga0395899_0036508 3300037312 Bacteria 3686
248 Ga0395899_0065128 3300037312 Bacteria 2678
249 Ga0395899_0117191 3300037312 Bacteria 1910
250 Ga0395899_0150935 3300037312 Bacteria 1647
251 Ga0395900_0002598 3300037418 Bacteria 19737
252 Ga0395900_0026581 3300037418 Bacteria 5925
253 Ga0395900_0030978 3300037418 Bacteria 5494
254 Ga0395900_0033748 3300037418 Bacteria 5266
255 Ga0395900_0036406 3300037418 Bacteria 5074
256 Ga0395900_0049234 3300037418 Bacteria 4341
257 Ga0395900_0054129 3300037418 Bacteria 4131
258 Ga0395900_0066233 3300037418 Bacteria 3712
259 Ga0395900_0072904 3300037418 Bacteria 3529
260 Ga0395900_0120137 3300037418 Bacteria 2696
261 Ga0395900_0188138 3300037418 Bacteria 2095
262 Ga0395900_0221394 3300037418 Bacteria 1907
263 Ga0395900_0318692 3300037418 Bacteria 1535
264 Ga0395898_0006953 3300037466 Bacteria 12024
265 Ga0395898_0025349 3300037466 Bacteria 5976
266 Ga0395898_0026748 3300037466 Bacteria 5798
267 Ga0395898_0027414 3300037466 Bacteria 5720
268 Ga0395898_0177857 3300037466 Bacteria 2033
269 Ga0395898_0198069 3300037466 Bacteria 1918
270 Ga0395898_0201598 3300037466 Bacteria 1899
271 Ga0395898_0295094 3300037466 Bacteria 1546
272 Ga0395898_0318547 3300037466 Bacteria 1483
273 Ga0395898_0366921 3300037466 Bacteria 1373
274 Ga0395898_0383914 3300037466 Bacteria 1339
275 Ga0395905_0000358 3300037471 Bacteria 64883
276 Ga0395905_0001857 3300037471 Bacteria 24328
277 Ga0395905_0001888 3300037471 Bacteria 24158
278 Ga0395905_0002566 3300037471 Bacteria 20009
279 Ga0395905_0007846 3300037471 Bacteria 10574
280 Ga0395905_0021568 3300037471 Bacteria 6090
281 Ga0395905_0028093 3300037471 Bacteria 5304
282 Ga0395905_0031418 3300037471 Bacteria 4999
283 Ga0395905_0047246 3300037471 Bacteria 4035
284 Ga0395905_0080724 3300037471 Bacteria 3048
285 Ga0395905_0092739 3300037471 Bacteria 2832
286 Ga0395905_0095838 3300037471 Bacteria 2785
287 Ga0395905_0143275 3300037471 Bacteria 2248
288 Ga0395905_0149632 3300037471 Bacteria 2196
289 Ga0395905_0184019 3300037471 Bacteria 1961
290 Ga0436364_1351302 3300037853 Bacteria 15199
291 Ga0395901_0007334 3300038443 Bacteria 11129
292 Ga0395901_0012581 3300038443 Bacteria 8586
293 Ga0395901_0045287 3300038443 Bacteria 4565
294 Ga0395901_0116627 3300038443 Bacteria 2805
295 Ga0395901_0127955 3300038443 Bacteria 2669
296 Ga0395901_0143923 3300038443 Bacteria 2506
297 Ga0395901_0179179 3300038443 Bacteria 2222
298 Ga0436365_0450343 3300039437 Bacteria 12525
299 Ga0436365_0451685 3300039437 Bacteria 11482
300 Ga0466969_0002723 3300044656 Bacteria 9449
301 Ga0466972_0066684 3300044658 Bacteria 1720
302 Ga0466966_0000039 3300044684 Bacteria 97202
303 Ga0466966_0008831 3300044684 Bacteria 6673
304 Ga0466966_0014455 3300044684 Bacteria 5225
305 Ga0466961_0001899 3300044693 Bacteria 13012
306 Ga0466961_0006223 3300044693 Bacteria 7582
307 Ga0466961_0012489 3300044693 Bacteria 5436
308 Ga0466961_0015406 3300044693 Bacteria 4908
309 Ga0466961_0038089 3300044693 Bacteria 3085
310 Ga0466961_0054617 3300044693 Bacteria 2547
311 Ga0466961_0066433 3300044693 Bacteria 2291
312 Ga0466961_0206489 3300044693 Bacteria 1214
313 Ga0466963_0004040 3300044694 Bacteria 8489
314 Ga0466963_0016298 3300044694 Bacteria 4620
315 Ga0466963_0017070 3300044694 Bacteria 4521
316 Ga0466963_0123656 3300044694 Bacteria 1782
317 Ga0466971_0010728 3300044719 Bacteria 4008
318 Ga0466971_0012794 3300044719 Bacteria 3678
319 Ga0466971_0017664 3300044719 Bacteria 3157
320 Ga0466971_0077878 3300044719 Bacteria 1510
321 Ga0466968_0005016 3300044735 Bacteria 4960
322 Ga0466970_0002859 3300044765 Bacteria 8347
323 Ga0466970_0034083 3300044765 Unclassified 2694
324 Ga0466957_0000515 3300044842 Bacteria 19383
325 Ga0466957_0004705 3300044842 Bacteria 7637
326 Ga0466957_0007292 3300044842 Bacteria 6248
327 Ga0466957_0008079 3300044842 Bacteria 5970
328 Ga0466957_0069733 3300044842 Bacteria 2172
329 Ga0466959_0009026 3300045049 Bacteria 7072
330 Ga0466959_0009377 3300045049 Bacteria 6958
331 Ga0466959_0038972 3300045049 Bacteria 3511
332 Ga0466959_0153138 3300045049 Bacteria 1624
333 Ga0466959_0180876 3300045049 Bacteria 1474
334 Ga0466958_0003175 3300045836 Bacteria 8467
335 Ga0466958_0028793 3300045836 Bacteria 3295
336 Ga0466958_0154819 3300045836 Bacteria 1446
337 Ga0466967_0026805 3300045976 Bacteria 4781
338 Ga0466967_0038584 3300045976 Bacteria 4098
339 Ga0495617_000051 3300046452 Bacteria 106590
340 Ga0495620_0000223 3300046515 Bacteria 42640
341 Ga0495670_0000015 3300046691 Bacteria 131137
342 Ga0495636_0020360 3300047318 Bacteria 2674
343 Ga0496100_0076945 3300048903 Bacteria 2242
344 Ga0496101_0014063 3300048904 Bacteria 5376
345 Ga0496101_0048692 3300048904 Bacteria 3046
346 Ga0496106_0000591 3300048909 Bacteria 25938
347 Ga0496106_0027899 3300048909 Bacteria 4203
348 Ga0496106_0074569 3300048909 Bacteria 2598
349 Ga0496107_0002482 3300048910 Bacteria 11974
350 Ga0496107_0011163 3300048910 Bacteria 6253
351 Ga0496107_0037449 3300048910 Bacteria 3481
352 Ga0496108_0019997 3300048911 Bacteria 5501
353 Ga0496109_0011318 3300048912 Bacteria 7663
354 Ga0496109_0015589 3300048912 Bacteria 6628
355 Ga0496109_0152948 3300048912 Bacteria 2161
356 Ga0496111_0118403 3300048914 Bacteria 1955
357 Ga0496112_0007854 3300048915 Bacteria 9499
358 Ga0496112_0038537 3300048915 Bacteria 4667
359 Ga0496112_0246777 3300048915 Bacteria 1737
360 Ga0496113_0005302 3300048916 Bacteria 8027
361 Ga0496113_0063780 3300048916 Bacteria 2785
362 Ga0496114_0000006 3300048917 Bacteria 472921
363 Ga0496115_0031390 3300048918 Bacteria 4187
364 Ga0496120_0013400 3300048923 Bacteria 5522
365 Ga0496122_0055845 3300048925 Bacteria 2950
366 Ga0496122_0098516 3300048925 Bacteria 1963
367 Ga0496123_0107807 3300048926 Bacteria 1601
368 Ga0496123_0115340 3300048926 Bacteria 1524
369 Ga0496124_0000912 3300048927 Bacteria 47709
370 Ga0496124_0003256 3300048927 Bacteria 20059
371 Ga0496124_0017394 3300048927 Bacteria 6775
372 Ga0496126_0052820 3300048929 Bacteria 3691
373 Ga0466962_0018570 3300061719 Bacteria 3344

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100000259 Ga0068855_1000002599 349
2 3300025949 Ga0207667_10042269 Ga0207667_100422692 349
3 3300009177 Ga0105248_10260556 Ga0105248_102605562 356
4 3300037471 Ga0395905_0095838 Ga0395905_0095838_37_1125 356
5 3300037466 Ga0395898_0201598 Ga0395898_0201598_551_1633 359
6 3300005614 Ga0068856_100171409 Ga0068856_1001714092 360
7 3300013104 Ga0157370_10004637 Ga0157370_1000463712 360
8 3300025913 Ga0207695_10336176 Ga0207695_103361761 360
9 3300026078 Ga0207702_10006879 Ga0207702_100068792 360
10 3300037312 Ga0395899_0017035 Ga0395899_0017035_3666_4757 360
11 3300037312 Ga0395899_0036508 Ga0395899_0036508_125_1207 360
12 3300037418 Ga0395900_0033748 Ga0395900_0033748_3960_5051 360
13 3300037418 Ga0395900_0120137 Ga0395900_0120137_362_1444 360
14 3300037466 Ga0395898_0295094 Ga0395898_0295094_216_1307 360
15 3300037466 Ga0395898_0383914 Ga0395898_0383914_143_1225 360
16 3300038443 Ga0395901_0127955 Ga0395901_0127955_111_1193 360
17 3300044684 Ga0466966_0008831 Ga0466966_0008831_533_1615 360
18 3300045049 Ga0466959_0009026 Ga0466959_0009026_984_2066 360
19 3300009177 Ga0105248_10151165 Ga0105248_101511651 361
20 3300013105 Ga0157369_10110624 Ga0157369_101106242 361
21 3300037471 Ga0395905_0001857 Ga0395905_0001857_22539_23627 361
22 3300038443 Ga0395901_0116627 Ga0395901_0116627_1139_2227 361
23 3300048917 Ga0496114_0000006 Ga0496114_0000006_120167_121252 361
24 3300009177 Ga0105248_10005282 Ga0105248_100052824 363
25 3300031548 Ga0307408_100048454 Ga0307408_1000484542 363
26 3300037466 Ga0395898_0177857 Ga0395898_0177857_593_1684 363
27 3300044658 Ga0466972_0066684 Ga0466972_0066684_588_1682 363
28 3300044693 Ga0466961_0012489 Ga0466961_0012489_2559_3653 363
29 3300044693 Ga0466961_0206489 Ga0466961_0206489_51_1142 363
30 3300044694 Ga0466963_0017070 Ga0466963_0017070_1887_2981 363
31 3300044719 Ga0466971_0010728 Ga0466971_0010728_1081_2175 363
32 3300044842 Ga0466957_0008079 Ga0466957_0008079_3226_4320 363
33 3300045049 Ga0466959_0180876 Ga0466959_0180876_327_1418 363
34 3300045836 Ga0466958_0154819 Ga0466958_0154819_29_1120 363
35 3300048904 Ga0496101_0048692 Ga0496101_0048692_1065_2156 363
36 3300048909 Ga0496106_0074569 Ga0496106_0074569_1056_2147 363
37 3300048910 Ga0496107_0011163 Ga0496107_0011163_2830_3921 363
38 3300048914 Ga0496111_0118403 Ga0496111_0118403_750_1841 363
39 3300048918 Ga0496115_0031390 Ga0496115_0031390_2081_3172 363
40 3300031852 Ga0307410_10033952 Ga0307410_100339523 364
41 3300037312 Ga0395899_0065128 Ga0395899_0065128_662_1780 372
42 3300044656 Ga0466969_0002723 Ga0466969_0002723_5455_6582 372
43 3300044684 Ga0466966_0014455 Ga0466966_0014455_3166_4293 372
44 3300044693 Ga0466961_0001899 Ga0466961_0001899_4998_6125 372
45 3300044693 Ga0466961_0054617 Ga0466961_0054617_40_1167 372
46 3300044694 Ga0466963_0016298 Ga0466963_0016298_2551_3678 372
47 3300044719 Ga0466971_0012794 Ga0466971_0012794_114_1241 372
48 3300044842 Ga0466957_0000515 Ga0466957_0000515_11905_13032 372
49 3300045049 Ga0466959_0009377 Ga0466959_0009377_336_1463 372
50 3300045836 Ga0466958_0003175 Ga0466958_0003175_933_2060 372
51 3300061719 Ga0466962_0018570 Ga0466962_0018570_178_1305 372
52 3300013105 Ga0157369_10033462 Ga0157369_100334624 375
53 3300037466 Ga0395898_0027414 Ga0395898_0027414_952_2079 375
54 3300037471 Ga0395905_0001888 Ga0395905_0001888_5103_6230 375
55 3300038443 Ga0395901_0007334 Ga0395901_0007334_8307_9434 375
56 3300037418 Ga0395900_0049234 Ga0395900_0049234_804_2051 377
57 3300013105 Ga0157369_10226038 Ga0157369_102260382 378
58 3300037312 Ga0395899_0001364 Ga0395899_0001364_15648_16784 378
59 3300037418 Ga0395900_0002598 Ga0395900_0002598_15648_16784 378
60 3300037466 Ga0395898_0006953 Ga0395898_0006953_9195_10331 378
61 3300005578 Ga0068854_100045600 Ga0068854_1000456003 380
62 3300025981 Ga0207640_10005368 Ga0207640_100053683 380
63 3300037312 Ga0395899_0117191 Ga0395899_0117191_74_1216 380
64 3300044684 Ga0466966_0000039 Ga0466966_0000039_23680_24921 381
65 3300025931 Ga0207644_10001389 Ga0207644_100013897 385
66 3300037471 Ga0395905_0184019 Ga0395905_0184019_183_1430 385
67 3300038443 Ga0395901_0143923 Ga0395901_0143923_942_2189 385
68 3300025933 Ga0207706_10114487 Ga0207706_101144872 392
69 3300037418 Ga0395900_0054129 Ga0395900_0054129_615_1862 392
70 3300005339 Ga0070660_100061806 Ga0070660_1000618061 393
71 iso_pu_bacteria 2599185354 2600202326 393
72 3300005327 Ga0070658_10015773 Ga0070658_100157735 394
73 3300005327 Ga0070658_10053618 Ga0070658_100536182 394
74 3300005331 Ga0070670_100170056 Ga0070670_1001700562 394
75 3300005366 Ga0070659_100003382 Ga0070659_1000033828 394
76 3300005366 Ga0070659_100089497 Ga0070659_1000894972 394
77 3300005457 Ga0070662_100107127 Ga0070662_1001071272 394
78 3300005539 Ga0068853_100053490 Ga0068853_1000534902 394
79 3300005564 Ga0070664_100009514 Ga0070664_1000095142 394
80 3300005616 Ga0068852_100149862 Ga0068852_1001498622 394
81 3300013100 Ga0157373_10050934 Ga0157373_100509342 394
82 3300025909 Ga0207705_10006363 Ga0207705_100063635 394
83 3300025919 Ga0207657_10017410 Ga0207657_100174105 394
84 3300025932 Ga0207690_10020496 Ga0207690_100204965 394
85 3300025933 Ga0207706_10008821 Ga0207706_100088219 394
86 3300025945 Ga0207679_10098362 Ga0207679_100983622 394
87 3300026041 Ga0207639_10059714 Ga0207639_100597142 394
88 3300026078 Ga0207702_10147814 Ga0207702_101478142 394
89 3300046691 Ga0495670_0000015 Ga0495670_0000015_60649_61923 394
90 3300037471 Ga0395905_0149632 Ga0395905_0149632_89_1276 395
91 3300038443 Ga0395901_0179179 Ga0395901_0179179_463_1653 395
92 3300031911 Ga0307412_10000435 Ga0307412_100004353 396
93 3300048923 Ga0496120_0013400 Ga0496120_0013400_1056_2327 396
94 3300048925 Ga0496122_0098516 Ga0496122_0098516_577_1857 396
95 3300048926 Ga0496123_0115340 Ga0496123_0115340_78_1358 396
96 3300048927 Ga0496124_0000912 Ga0496124_0000912_1318_2589 396
97 3300048927 Ga0496124_0003256 Ga0496124_0003256_835_2115 396
98 3300048929 Ga0496126_0052820 Ga0496126_0052820_149_1420 396
99 3300005434 Ga0070709_10028646 Ga0070709_100286463 397
100 3300005435 Ga0070714_100051956 Ga0070714_1000519562 397
101 3300013102 Ga0157371_10018948 Ga0157371_100189483 397
102 3300013104 Ga0157370_10100815 Ga0157370_101008152 397
103 3300039437 Ga0436365_0450343 Ga0436365_0450343_1187_2449 397
104 3300044842 Ga0466957_0069733 Ga0466957_0069733_772_1965 397
105 iso_pu_bacteria 2751185897 2753766062 397
106 3300005335 Ga0070666_10057940 Ga0070666_100579402 398
107 3300005355 Ga0070671_100000793 Ga0070671_1000007932 398
108 3300005356 Ga0070674_100134297 Ga0070674_1001342972 398
109 3300005364 Ga0070673_100073594 Ga0070673_1000735943 398
110 3300005548 Ga0070665_100033642 Ga0070665_1000336423 398
111 3300005842 Ga0068858_100289923 Ga0068858_1002899232 398
112 3300009093 Ga0105240_10129669 Ga0105240_101296693 398
113 3300009177 Ga0105248_10010048 Ga0105248_100100482 398
114 3300013296 Ga0157374_10015202 Ga0157374_100152024 398
115 3300013306 Ga0163162_10059789 Ga0163162_100597895 398
116 3300013308 Ga0157375_10034730 Ga0157375_100347302 398
117 3300025315 Ga0207697_10023052 Ga0207697_100230523 398
118 3300025903 Ga0207680_10098822 Ga0207680_100988221 398
119 3300025913 Ga0207695_10166787 Ga0207695_101667871 398
120 3300025933 Ga0207706_10122028 Ga0207706_101220282 398
121 3300025940 Ga0207691_10032536 Ga0207691_100325363 398
122 3300026121 Ga0207683_10073349 Ga0207683_100733493 398
123 3300028379 Ga0268266_10066480 Ga0268266_100664802 398
124 3300048911 Ga0496108_0019997 Ga0496108_0019997_2717_3913 398
125 3300048916 Ga0496113_0005302 Ga0496113_0005302_1160_2356 398
126 3300048927 Ga0496124_0017394 Ga0496124_0017394_851_2131 398
127 3300025933 Ga0207706_10039828 Ga0207706_100398282 399
128 iso_pu_bacteria 2599185359 2600226893 399
129 iso_pu_bacteria 2818991466 2819715657 399
130 iso_pu_bacteria 2879163058 2879163767 399
131 iso_pu_bacteria 2928526807 2928529677 399
132 iso_pu_bacteria 2928968154 2928970836 399
133 3300005334 Ga0068869_100045875 Ga0068869_1000458751 401
134 3300005355 Ga0070671_100007194 Ga0070671_1000071949 401
135 3300005530 Ga0070679_100075943 Ga0070679_1000759433 401
136 3300005535 Ga0070684_100060150 Ga0070684_1000601504 401
137 3300005543 Ga0070672_100053566 Ga0070672_1000535663 401
138 3300005564 Ga0070664_100086600 Ga0070664_1000866001 401
139 3300005578 Ga0068854_100117349 Ga0068854_1001173492 401
140 3300025315 Ga0207697_10006722 Ga0207697_100067226 401
141 3300025919 Ga0207657_10060654 Ga0207657_100606542 401
142 3300025920 Ga0207649_10007807 Ga0207649_100078072 401
143 3300025933 Ga0207706_10188297 Ga0207706_101882971 401
144 3300025940 Ga0207691_10038413 Ga0207691_100384133 401
145 3300025945 Ga0207679_10009367 Ga0207679_100093675 401
146 3300025945 Ga0207679_10020127 Ga0207679_100201275 401
147 3300026035 Ga0207703_10213904 Ga0207703_102139041 401
148 3300026121 Ga0207683_10127534 Ga0207683_101275342 401
149 3300047318 Ga0495636_0020360 Ga0495636_0020360_128_1456 401
150 3300048912 Ga0496109_0152948 Ga0496109_0152948_536_1831 401
151 3300048915 Ga0496112_0246777 Ga0496112_0246777_30_1283 401
152 3300005330 Ga0070690_100141680 Ga0070690_1001416802 402
153 3300005335 Ga0070666_10018011 Ga0070666_100180114 402
154 3300006847 Ga0075431_100016109 Ga0075431_1000161098 402
155 3300046452 Ga0495617_000051 Ga0495617_000051_23499_24719 402
156 3300046515 Ga0495620_0000223 Ga0495620_0000223_17973_19193 402
157 3300048909 Ga0496106_0000591 Ga0496106_0000591_8259_9479 402
158 3300037471 Ga0395905_0028093 Ga0395905_0028093_796_2010 403
159 3300048915 Ga0496112_0038537 Ga0496112_0038537_265_1482 403
160 3300048925 Ga0496122_0055845 Ga0496122_0055845_834_2114 403
161 3300048926 Ga0496123_0107807 Ga0496123_0107807_172_1452 403
162 3300005327 Ga0070658_10013021 Ga0070658_100130212 404
163 3300005339 Ga0070660_100000726 Ga0070660_1000007269 404
164 3300005539 Ga0068853_100062415 Ga0068853_1000624153 404
165 3300025909 Ga0207705_10000002 Ga0207705_1000000237 404
166 3300025919 Ga0207657_10010899 Ga0207657_100108996 404
167 3300026142 Ga0207698_10005537 Ga0207698_100055377 404
168 3300044694 Ga0466963_0004040 Ga0466963_0004040_5586_6851 404
169 3300044842 Ga0466957_0004705 Ga0466957_0004705_2031_3296 404
170 3300045976 Ga0466967_0026805 Ga0466967_0026805_868_2133 404
171 3300037853 Ga0436364_1351302 Ga0436364_1351302_9736_10953 405
172 3300039437 Ga0436365_0451685 Ga0436365_0451685_5382_6599 405
173 3300005330 Ga0070690_100043020 Ga0070690_1000430202 406
174 3300005331 Ga0070670_100059038 Ga0070670_1000590383 407
175 3300005335 Ga0070666_10118300 Ga0070666_101183002 407
176 3300005355 Ga0070671_100003799 Ga0070671_1000037995 407
177 3300005618 Ga0068864_100002647 Ga0068864_10000264712 407
178 3300025903 Ga0207680_10041497 Ga0207680_100414973 407
179 3300025925 Ga0207650_10028912 Ga0207650_100289124 407
180 3300025931 Ga0207644_10000151 Ga0207644_1000015136 407
181 3300025941 Ga0207711_10002207 Ga0207711_1000220716 407
182 3300026088 Ga0207641_10066211 Ga0207641_100662112 407
183 3300026095 Ga0207676_10009721 Ga0207676_100097217 407
184 3300037312 Ga0395899_0150935 Ga0395899_0150935_352_1590 407
185 3300037418 Ga0395900_0036406 Ga0395900_0036406_2756_3997 407
186 3300037466 Ga0395898_0198069 Ga0395898_0198069_584_1825 407
187 3300037471 Ga0395905_0007846 Ga0395905_0007846_2503_3741 407
188 3300037471 Ga0395905_0031418 Ga0395905_0031418_1373_2614 407
189 3300038443 Ga0395901_0045287 Ga0395901_0045287_2056_3294 407
190 3300048912 Ga0496109_0011318 Ga0496109_0011318_4587_5816 407
191 3300048915 Ga0496112_0007854 Ga0496112_0007854_2904_4133 407
192 3300005339 Ga0070660_100009935 Ga0070660_1000099353 408
193 3300005344 Ga0070661_100049110 Ga0070661_1000491102 408
194 3300005355 Ga0070671_100022686 Ga0070671_1000226864 408
195 3300005455 Ga0070663_100083200 Ga0070663_1000832002 408
196 3300005841 Ga0068863_100014012 Ga0068863_1000140122 408
197 3300005842 Ga0068858_100199736 Ga0068858_1001997362 408
198 3300006358 Ga0068871_100039088 Ga0068871_1000390884 408
199 3300009093 Ga0105240_10173950 Ga0105240_101739502 408
200 3300013307 Ga0157372_10266456 Ga0157372_102664562 408
201 3300025909 Ga0207705_10000003 Ga0207705_10000003576 408
202 3300025909 Ga0207705_10001112 Ga0207705_100011122 408
203 3300025913 Ga0207695_10034241 Ga0207695_100342412 408
204 3300025919 Ga0207657_10010100 Ga0207657_100101003 408
205 3300025933 Ga0207706_10004393 Ga0207706_1000439312 408
206 3300025941 Ga0207711_10014963 Ga0207711_100149632 408
207 3300025949 Ga0207667_10039559 Ga0207667_100395592 408
208 3300026067 Ga0207678_10002336 Ga0207678_1000233612 408
209 3300026088 Ga0207641_10004390 Ga0207641_100043904 408
210 3300026142 Ga0207698_10021118 Ga0207698_100211182 408
211 3300037418 Ga0395900_0318692 Ga0395900_0318692_283_1512 408
212 3300037466 Ga0395898_0318547 Ga0395898_0318547_24_1253 408
213 3300037471 Ga0395905_0000358 Ga0395905_0000358_59071_60303 408
214 3300044693 Ga0466961_0038089 Ga0466961_0038089_1185_2420 408
215 3300005435 Ga0070714_100101864 Ga0070714_1001018642 409
216 3300005458 Ga0070681_10064640 Ga0070681_100646402 409
217 3300025929 Ga0207664_10032728 Ga0207664_100327282 409
218 3300037418 Ga0395900_0030978 Ga0395900_0030978_4185_5417 409
219 3300037466 Ga0395898_0025349 Ga0395898_0025349_4685_5917 409
220 3300037471 Ga0395905_0021568 Ga0395905_0021568_1433_2665 409
221 3300037471 Ga0395905_0080724 Ga0395905_0080724_495_1727 409
222 3300005327 Ga0070658_10070969 Ga0070658_100709692 410
223 3300005327 Ga0070658_10100950 Ga0070658_101009502 410
224 3300005331 Ga0070670_100002964 Ga0070670_1000029642 410
225 3300005455 Ga0070663_100127076 Ga0070663_1001270761 410
226 3300005456 Ga0070678_100086614 Ga0070678_1000866142 410
227 3300005458 Ga0070681_10011596 Ga0070681_100115965 410
228 3300005530 Ga0070679_100036155 Ga0070679_1000361555 410
229 3300005614 Ga0068856_100011453 Ga0068856_1000114535 410
230 3300009093 Ga0105240_10049323 Ga0105240_100493232 410
231 3300013100 Ga0157373_10058941 Ga0157373_100589412 410
232 3300013104 Ga0157370_10031131 Ga0157370_100311313 410
233 3300013104 Ga0157370_10115773 Ga0157370_101157732 410
234 3300013105 Ga0157369_10014845 Ga0157369_100148457 410
235 3300013105 Ga0157369_10114383 Ga0157369_101143832 410
236 3300021388 Ga0213875_10007660 Ga0213875_100076606 410
237 3300025909 Ga0207705_10014713 Ga0207705_100147133 410
238 3300025909 Ga0207705_10015701 Ga0207705_100157014 410
239 3300025909 Ga0207705_10082175 Ga0207705_100821752 410
240 3300025909 Ga0207705_10101002 Ga0207705_101010022 410
241 3300025912 Ga0207707_10281570 Ga0207707_102815701 410
242 3300025913 Ga0207695_10004994 Ga0207695_100049946 410
243 3300025919 Ga0207657_10001862 Ga0207657_100018625 410
244 3300025921 Ga0207652_10021319 Ga0207652_100213195 410
245 3300025921 Ga0207652_10091506 Ga0207652_100915062 410
246 3300025981 Ga0207640_10005167 Ga0207640_100051672 410
247 3300026067 Ga0207678_10005316 Ga0207678_100053166 410
248 3300026095 Ga0207676_10005530 Ga0207676_100055308 410
249 3300028379 Ga0268266_10279503 Ga0268266_102795031 410
250 3300037418 Ga0395900_0188138 Ga0395900_0188138_601_1836 410
251 3300037418 Ga0395900_0221394 Ga0395900_0221394_444_1679 410
252 3300037466 Ga0395898_0026748 Ga0395898_0026748_1273_2517 410
253 3300037471 Ga0395905_0092739 Ga0395905_0092739_1068_2303 410
254 3300005329 Ga0070683_100047789 Ga0070683_1000477893 411
255 3300005539 Ga0068853_100012265 Ga0068853_1000122653 411
256 3300005563 Ga0068855_100271700 Ga0068855_1002717002 411
257 3300005577 Ga0068857_100028701 Ga0068857_1000287013 411
258 3300025904 Ga0207647_10005602 Ga0207647_100056026 411
259 3300025909 Ga0207705_10052415 Ga0207705_100524152 411
260 3300025913 Ga0207695_10047721 Ga0207695_100477215 411
261 3300025919 Ga0207657_10058648 Ga0207657_100586484 411
262 3300025949 Ga0207667_10007293 Ga0207667_1000729315 411
263 3300025949 Ga0207667_10118207 Ga0207667_101182072 411
264 3300026041 Ga0207639_10066367 Ga0207639_100663672 411
265 3300026067 Ga0207678_10240968 Ga0207678_102409682 411
266 3300026078 Ga0207702_10048935 Ga0207702_100489354 411
267 3300026116 Ga0207674_10003100 Ga0207674_1000310022 411
268 3300037471 Ga0395905_0002566 Ga0395905_0002566_3859_5100 411
269 3300037471 Ga0395905_0047246 Ga0395905_0047246_621_1856 411
270 3300044719 Ga0466971_0077878 Ga0466971_0077878_15_1262 411
271 3300045976 Ga0466967_0038584 Ga0466967_0038584_1592_2830 411
272 3300038443 Ga0395901_0012581 Ga0395901_0012581_6133_7374 413
273 3300044693 Ga0466961_0066433 Ga0466961_0066433_816_2066 413
274 3300045049 Ga0466959_0153138 Ga0466959_0153138_134_1384 413
275 3300005355 Ga0070671_100106242 Ga0070671_1001062422 414
276 3300005564 Ga0070664_100042322 Ga0070664_1000423223 414
277 3300005616 Ga0068852_100109043 Ga0068852_1001090432 414
278 3300013105 Ga0157369_10088448 Ga0157369_100884482 414
279 3300025904 Ga0207647_10029185 Ga0207647_100291853 414
280 3300025909 Ga0207705_10026238 Ga0207705_100262383 414
281 3300026142 Ga0207698_10043669 Ga0207698_100436694 414
282 3300005339 Ga0070660_100001819 Ga0070660_10000181913 415
283 3300005339 Ga0070660_100083329 Ga0070660_1000833292 415
284 3300005355 Ga0070671_100001688 Ga0070671_1000016887 415
285 3300005364 Ga0070673_100024636 Ga0070673_1000246364 415
286 3300005563 Ga0068855_100000348 Ga0068855_10000034827 415
287 3300005618 Ga0068864_100001733 Ga0068864_10000173311 415
288 3300009177 Ga0105248_10003466 Ga0105248_1000346611 415
289 3300025909 Ga0207705_10000208 Ga0207705_1000020843 415
290 3300025919 Ga0207657_10002855 Ga0207657_100028557 415
291 3300025919 Ga0207657_10143833 Ga0207657_101438332 415
292 3300025932 Ga0207690_10052532 Ga0207690_100525322 415
293 3300025941 Ga0207711_10001841 Ga0207711_100018419 415
294 3300025949 Ga0207667_10004895 Ga0207667_100048958 415
295 3300037312 Ga0395899_0008516 Ga0395899_0008516_1275_2522 415
296 3300037466 Ga0395898_0366921 Ga0395898_0366921_100_1347 415
297 3300044693 Ga0466961_0015406 Ga0466961_0015406_2894_4156 415
298 3300048903 Ga0496100_0076945 Ga0496100_0076945_604_1860 415
299 3300048904 Ga0496101_0014063 Ga0496101_0014063_1209_2465 415
300 3300048909 Ga0496106_0027899 Ga0496106_0027899_2894_4150 415
301 3300048910 Ga0496107_0002482 Ga0496107_0002482_7227_8483 415
302 3300048912 Ga0496109_0015589 Ga0496109_0015589_2881_4137 415
303 3300048916 Ga0496113_0063780 Ga0496113_0063780_1269_2525 415
304 3300025893 Ga0207682_10020919 Ga0207682_100209191 416
305 3300005329 Ga0070683_100009638 Ga0070683_1000096382 417
306 3300005535 Ga0070684_100006143 Ga0070684_1000061438 417
307 3300013102 Ga0157371_10093437 Ga0157371_100934372 417
308 3300025920 Ga0207649_10091597 Ga0207649_100915972 417
309 3300037418 Ga0395900_0072904 Ga0395900_0072904_455_1708 417
310 3300044694 Ga0466963_0123656 Ga0466963_0123656_304_1644 417
311 3300044719 Ga0466971_0017664 Ga0466971_0017664_1337_2677 417
312 3300044735 Ga0466968_0005016 Ga0466968_0005016_2024_3349 417
313 3300044765 Ga0466970_0002859 Ga0466970_0002859_4090_5415 417
314 3300044842 Ga0466957_0007292 Ga0466957_0007292_1984_3324 417
315 3300045049 Ga0466959_0038972 Ga0466959_0038972_2033_3358 417
316 3300045836 Ga0466958_0028793 Ga0466958_0028793_935_2260 417
317 3300005563 Ga0068855_100246271 Ga0068855_1002462712 418
318 3300025932 Ga0207690_10043173 Ga0207690_100431733 418
319 3300005530 Ga0070679_100176522 Ga0070679_1001765221 419
320 3300025917 Ga0207660_10000716 Ga0207660_1000071621 419
321 3300002075 JGI24738J21930_10000830 JGI24738J21930_100008305 420
322 3300005327 Ga0070658_10000329 Ga0070658_1000032927 420
323 3300005329 Ga0070683_100007230 Ga0070683_1000072305 420
324 3300005331 Ga0070670_100032244 Ga0070670_1000322445 420
325 3300005335 Ga0070666_10000967 Ga0070666_1000096712 420
326 3300005336 Ga0070680_100067732 Ga0070680_1000677322 420
327 3300005337 Ga0070682_100054943 Ga0070682_1000549432 420
328 3300005339 Ga0070660_100001889 Ga0070660_1000018897 420
329 3300005344 Ga0070661_100001222 Ga0070661_10000122210 420
330 3300005355 Ga0070671_100082252 Ga0070671_1000822521 420
331 3300005366 Ga0070659_100000356 Ga0070659_10000035627 420
332 3300005367 Ga0070667_100010798 Ga0070667_1000107982 420
333 3300005435 Ga0070714_100097766 Ga0070714_1000977662 420
334 3300005455 Ga0070663_100008716 Ga0070663_1000087166 420
335 3300005457 Ga0070662_100000069 Ga0070662_10000006911 420
336 3300005535 Ga0070684_100034194 Ga0070684_1000341942 420
337 3300005539 Ga0068853_100001087 Ga0068853_1000010875 420
338 3300005547 Ga0070693_100001251 Ga0070693_1000012512 420
339 3300005548 Ga0070665_100007044 Ga0070665_10000704411 420
340 3300005563 Ga0068855_100000942 Ga0068855_10000094217 420
341 3300005564 Ga0070664_100000548 Ga0070664_10000054827 420
342 3300005578 Ga0068854_100127736 Ga0068854_1001277362 420
343 3300005614 Ga0068856_100000163 Ga0068856_1000001633 420
344 3300005616 Ga0068852_100000348 Ga0068852_10000034811 420
345 3300005842 Ga0068858_100083409 Ga0068858_1000834094 420
346 3300006237 Ga0097621_100114874 Ga0097621_1001148742 420
347 3300006358 Ga0068871_100102050 Ga0068871_1001020502 420
348 3300009174 Ga0105241_10236283 Ga0105241_102362832 420
349 3300009177 Ga0105248_10004624 Ga0105248_1000462416 420
350 3300009551 Ga0105238_10062564 Ga0105238_100625642 420
351 3300013100 Ga0157373_10036977 Ga0157373_100369772 420
352 3300013102 Ga0157371_10010498 Ga0157371_100104985 420
353 3300014325 Ga0163163_10000246 Ga0163163_1000024651 420
354 3300025903 Ga0207680_10001932 Ga0207680_100019326 420
355 3300025904 Ga0207647_10013395 Ga0207647_100133952 420
356 3300025909 Ga0207705_10000095 Ga0207705_1000009574 420
357 3300025917 Ga0207660_10052569 Ga0207660_100525693 420
358 3300025919 Ga0207657_10002486 Ga0207657_100024869 420
359 3300025920 Ga0207649_10000014 Ga0207649_10000014167 420
360 3300025925 Ga0207650_10132955 Ga0207650_101329552 420
361 3300025929 Ga0207664_10030036 Ga0207664_100300362 420
362 3300025931 Ga0207644_10061942 Ga0207644_100619421 420
363 3300025932 Ga0207690_10000229 Ga0207690_1000022920 420
364 3300025933 Ga0207706_10000719 Ga0207706_1000071927 420
365 3300025941 Ga0207711_10015751 Ga0207711_100157512 420
366 3300025945 Ga0207679_10000116 Ga0207679_1000011618 420
367 3300025949 Ga0207667_10001695 Ga0207667_100016957 420
368 3300025981 Ga0207640_10032465 Ga0207640_100324654 420
369 3300025986 Ga0207658_10011656 Ga0207658_100116565 420
370 3300026035 Ga0207703_10051718 Ga0207703_100517184 420
371 3300026041 Ga0207639_10000406 Ga0207639_1000040610 420
372 3300026078 Ga0207702_10000272 Ga0207702_1000027212 420
373 3300026142 Ga0207698_10000266 Ga0207698_1000026627 420
374 3300028379 Ga0268266_10012591 Ga0268266_100125916 420
375 3300037418 Ga0395900_0026581 Ga0395900_0026581_3334_4602 420
376 3300037418 Ga0395900_0066233 Ga0395900_0066233_2417_3679 420
377 3300037471 Ga0395905_0143275 Ga0395905_0143275_894_2156 420
378 3300044693 Ga0466961_0006223 Ga0466961_0006223_5369_6655 420
379 3300044765 Ga0466970_0034083 Ga0466970_0034083_344_1630 420
380 3300048910 Ga0496107_0037449 Ga0496107_0037449_158_1420 420

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

262

438

0.94

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

78

254

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g8s-assembly2.cif.gz_B crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form 0.9248 44 416
2g8s-assembly2.cif.gz_B crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form 0.9197 44 416
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.9086 45 412
7cdy-assembly2.cif.gz_B crystal structure of glucose dehydrogenase 0.9015 45 417
7cdy-assembly1.cif.gz_A crystal structure of glucose dehydrogenase 0.9004 45 417
ID Description Score Start End Superfamily
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9049 36 416 2.120.10.30
af_P75804_19_370_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9025 36 416 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8667 44 417 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8544 44 417 2.120.10.30
2ismB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8333 44 414 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A653XSF3-F1-model_v4 Dehydrogenase 0.9802 34 418
AF-A0A031I3X8-F1-model_v4 Putative glucose/sorbosone dehydrogenase 0.9797 47 420
AF-A0A2E0N664-F1-model_v4 Glucose/Sorbosone dehydrogenase domain-containing protein 0.9781 292 416
AF-A0A031I3X8-F1-model_v4 Putative glucose/sorbosone dehydrogenase 0.9745 47 420
AF-A0A829RIC8-F1-model_v4 deleted 0.9729 272 418

Feature Viewer

pLDDT pTM Quality
88.31 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map