F428699

General Info

Members Datasets Scaffolds Average Seq Length
380 198 380 232

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10081539|Ga0268266_100815393
Length 265
Sequence VFPNRPQWAGNGAWRGADPGSPDILPRRMNRPAPLTSPIVQISLDLTDLDEALATAQIAVDAGVDWLEAGTPLILAHGAKAVEKLHERFPTHPIIADAKIMDGGYHEAELMAKAGASWVVVMGRAHEATVRRVVDAGRDFGIKVMGDNMLATDRVANARWLAELGVDVVIHHIGYDERGLVKGLNPMQELDAVVAAVSVPVQAVGGLTIQQAIECPAHGAALVVLGAPLVIAADDFKPAGSDLGSILREICTEIRKTPMLDRARS

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
138 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.68
Nodule 0
Rhizoplane 5
Rhizosphere 81.05
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10024157 3300005293 Bacteria 1546
2 Ga0065715_10181649 3300005293 Bacteria 1457
3 Ga0070683_100044444 3300005329 Bacteria 4096
4 Ga0070690_100013247 3300005330 Bacteria 4869
5 Ga0070670_100002006 3300005331 Bacteria 16650
6 Ga0070670_100004508 3300005331 Bacteria 11673
7 Ga0070670_100149602 3300005331 Bacteria 2021
8 Ga0068869_100040746 3300005334 Bacteria 3323
9 Ga0068869_100088692 3300005334 Bacteria 2322
10 Ga0068869_100132083 3300005334 Bacteria 1920
11 Ga0070666_10089263 3300005335 Bacteria 2115
12 Ga0070682_100121666 3300005337 Bacteria 1753
13 Ga0070689_100450310 3300005340 Bacteria 1095
14 Ga0070687_100017538 3300005343 Bacteria 3295
15 Ga0070661_100005089 3300005344 Bacteria 9071
16 Ga0070661_100249627 3300005344 Bacteria 1369
17 Ga0070661_100380673 3300005344 Bacteria 1112
18 Ga0070692_10095233 3300005345 Bacteria 1624
19 Ga0070668_100540736 3300005347 Bacteria 1013
20 Ga0070669_100002229 3300005353 Bacteria 14029
21 Ga0070669_100092910 3300005353 Bacteria 2265
22 Ga0070675_100028677 3300005354 Bacteria 4481
23 Ga0070671_100093902 3300005355 Bacteria 2514
24 Ga0070671_100361469 3300005355 Bacteria 1239
25 Ga0070674_100004210 3300005356 Bacteria 8174
26 Ga0070674_100384808 3300005356 Bacteria 1142
27 Ga0070673_100062220 3300005364 Bacteria 2965
28 Ga0070673_100366148 3300005364 Bacteria 1282
29 Ga0070688_100037920 3300005365 Bacteria 2939
30 Ga0070659_100247118 3300005366 Bacteria 1478
31 Ga0070667_100077267 3300005367 Bacteria 2843
32 Ga0070667_100138102 3300005367 Bacteria 2132
33 Ga0070667_100258090 3300005367 Bacteria 1560
34 Ga0070701_10146574 3300005438 Bacteria 1355
35 Ga0070705_100451271 3300005440 Bacteria 965
36 Ga0070700_100026640 3300005441 Bacteria 3417
37 Ga0070700_100132659 3300005441 Bacteria 1683
38 Ga0070694_100001301 3300005444 Bacteria 14520
39 Ga0070694_100003139 3300005444 Bacteria 9839
40 Ga0070694_100048433 3300005444 Bacteria 2859
41 Ga0070694_100118761 3300005444 Bacteria 1895
42 Ga0070708_100110351 3300005445 Bacteria 2527
43 Ga0070708_100300204 3300005445 Bacteria 1512
44 Ga0070663_100339118 3300005455 Bacteria 1214
45 Ga0070663_100440053 3300005455 Bacteria 1072
46 Ga0070678_100052632 3300005456 Bacteria 2957
47 Ga0070678_100675894 3300005456 Bacteria 928
48 Ga0070662_100041715 3300005457 Bacteria 3275
49 Ga0070662_100563626 3300005457 Bacteria 955
50 Ga0070681_10148915 3300005458 Unclassified 2268
51 Ga0068867_100008378 3300005459 Bacteria 7292
52 Ga0070706_100071507 3300005467 Bacteria 3209
53 Ga0070706_100088604 3300005467 Bacteria 2869
54 Ga0070707_100000608 3300005468 Bacteria 35992
55 Ga0070707_100058450 3300005468 Bacteria 3698
56 Ga0070698_100397239 3300005471 Bacteria 1312
57 Ga0070684_100664539 3300005535 Bacteria 970
58 Ga0070672_100060755 3300005543 Bacteria 2977
59 Ga0070672_100160711 3300005543 Bacteria 1864
60 Ga0070686_100389827 3300005544 Bacteria 1057
61 Ga0070695_100136480 3300005545 Bacteria 1696
62 Ga0070695_100174814 3300005545 Bacteria 1517
63 Ga0070696_100393029 3300005546 Bacteria 1083
64 Ga0070693_100122069 3300005547 Unclassified 1617
65 Ga0070704_100018251 3300005549 Bacteria 4481
66 Ga0070704_100125882 3300005549 Unclassified 1977
67 Ga0070704_100924747 3300005549 Bacteria 785
68 Ga0070664_100001167 3300005564 Bacteria 20855
69 Ga0070664_100153956 3300005564 Bacteria 2030
70 Ga0068857_100082062 3300005577 Bacteria 2880
71 Ga0068857_100241277 3300005577 Bacteria 1655
72 Ga0068854_100632036 3300005578 Bacteria 917
73 Ga0070702_100033657 3300005615 Bacteria 2819
74 Ga0068859_100087866 3300005617 Bacteria 3157
75 Ga0068859_100479605 3300005617 Bacteria 1339
76 Ga0068864_100055474 3300005618 Bacteria 3422
77 Ga0068864_100234756 3300005618 Bacteria 1697
78 Ga0068861_100043342 3300005719 Unclassified 3377
79 Ga0068861_100382818 3300005719 Bacteria 1243
80 Ga0068870_10043331 3300005840 Bacteria 2347
81 Ga0068870_10065933 3300005840 Bacteria 1960
82 Ga0068863_100029770 3300005841 Bacteria 5213
83 Ga0068863_100350726 3300005841 Bacteria 1437
84 Ga0068860_100109915 3300005843 Bacteria 2634
85 Ga0068862_100007907 3300005844 Bacteria 8796
86 Ga0068862_100028310 3300005844 Bacteria 4717
87 Ga0068862_100044840 3300005844 Bacteria 3772
88 Ga0068862_100445656 3300005844 Bacteria 1219
89 Ga0081538_10064699 3300005981 Bacteria 2066
90 Ga0075365_10072308 3300006038 Bacteria 2323
91 Ga0075365_10097352 3300006038 Bacteria 2011
92 Ga0075368_10015866 3300006042 Bacteria 2799
93 Ga0075368_10019357 3300006042 Bacteria 2569
94 Ga0075368_10024556 3300006042 Bacteria 2310
95 Ga0075363_100031061 3300006048 Bacteria 2768
96 Ga0075364_10006657 3300006051 Bacteria 6810
97 Ga0075364_10007701 3300006051 Bacteria 6409
98 Ga0075364_10008901 3300006051 Bacteria 6013
99 Ga0070712_100034032 3300006175 Bacteria 3452
100 Ga0075362_10001457 3300006177 Bacteria 7578
101 Ga0075362_10004875 3300006177 Bacteria 4851
102 Ga0075367_10004084 3300006178 Bacteria 7066
103 Ga0075367_10005755 3300006178 Bacteria 6196
104 Ga0075367_10019738 3300006178 Bacteria 3741
105 Ga0075367_10021901 3300006178 Bacteria 3578
106 Ga0075366_10000097 3300006195 Bacteria 35368
107 Ga0075366_10004192 3300006195 Bacteria 7732
108 Ga0075366_10014119 3300006195 Bacteria 4557
109 Ga0075366_10042525 3300006195 Bacteria 2690
110 Ga0075366_10076381 3300006195 Bacteria 1999
111 Ga0075366_10174218 3300006195 Bacteria 1306
112 Ga0097621_100744128 3300006237 Bacteria 905
113 Ga0075370_10011138 3300006353 Bacteria 4717
114 Ga0075370_10076310 3300006353 Bacteria 1922
115 Ga0075428_100048696 3300006844 Bacteria 4651
116 Ga0075428_100112046 3300006844 Bacteria 2972
117 Ga0075428_100252277 3300006844 Bacteria 1901
118 Ga0075428_100442914 3300006844 Bacteria 1391
119 Ga0075428_100612088 3300006844 Bacteria 1163
120 Ga0075428_100689610 3300006844 Unclassified 1088
121 Ga0075428_100879918 3300006844 Bacteria 950
122 Ga0075430_100163703 3300006846 Bacteria 1851
123 Ga0075430_100168294 3300006846 Bacteria 1823
124 Ga0075431_100016985 3300006847 Bacteria 7390
125 Ga0075431_100018244 3300006847 Bacteria 7139
126 Ga0075431_100087305 3300006847 Bacteria 3219
127 Ga0075431_100091219 3300006847 Bacteria 3145
128 Ga0075431_100248168 3300006847 Unclassified 1809
129 Ga0075431_100268555 3300006847 Bacteria 1729
130 Ga0075431_100275931 3300006847 Bacteria 1702
131 Ga0075433_10021109 3300006852 Bacteria 5457
132 Ga0075433_10112102 3300006852 Bacteria 2419
133 Ga0075433_10139120 3300006852 Bacteria 2158
134 Ga0075433_10884641 3300006852 Unclassified 779
135 Ga0075434_100001020 3300006871 Bacteria 22799
136 Ga0075434_100072373 3300006871 Bacteria 3439
137 Ga0075429_100008186 3300006880 Bacteria 9088
138 Ga0075429_100054743 3300006880 Bacteria 3470
139 Ga0075429_100235262 3300006880 Bacteria 1605
140 Ga0097620_100087873 3300006931 Bacteria 3157
141 Ga0097620_100479543 3300006931 Bacteria 1339
142 Ga0075435_100083551 3300007076 Bacteria 2626
143 Ga0075435_100168618 3300007076 Bacteria 1847
144 Ga0111539_10000386 3300009094 Bacteria 54473
145 Ga0111539_10000877 3300009094 Bacteria 39291
146 Ga0111539_10126329 3300009094 Bacteria 2996
147 Ga0111539_10185833 3300009094 Bacteria 2427
148 Ga0111539_10722407 3300009094 Bacteria 1159
149 Ga0111539_11435667 3300009094 Bacteria 800
150 Ga0105247_10111542 3300009101 Unclassified 1761
151 Ga0114129_10004923 3300009147 Bacteria 18846
152 Ga0114129_10013047 3300009147 Bacteria 11836
153 Ga0114129_10045393 3300009147 Bacteria 6177
154 Ga0114129_10060957 3300009147 Bacteria 5274
155 Ga0114129_10079333 3300009147 Bacteria 4565
156 Ga0114129_10090194 3300009147 Bacteria 4249
157 Ga0114129_10134075 3300009147 Bacteria 3400
158 Ga0114129_10218635 3300009147 Bacteria 2572
159 Ga0114129_10953206 3300009147 Bacteria 1084
160 Ga0105243_10004339 3300009148 Bacteria 11232
161 Ga0105248_10017600 3300009177 Bacteria 7882
162 Ga0105248_10098934 3300009177 Unclassified 3286
163 Ga0105248_10300675 3300009177 Bacteria 1807
164 Ga0105237_10000492 3300009545 Bacteria 55983
165 Ga0105249_10000704 3300009553 Bacteria 30308
166 Ga0105249_10344076 3300009553 Bacteria 1509
167 Ga0105246_10106975 3300011119 Bacteria 2047
168 Ga0105246_10178007 3300011119 Bacteria 1635
169 Ga0157369_10155562 3300013105 Bacteria 2415
170 Ga0163162_10431343 3300013306 Bacteria 1450
171 Ga0157375_10054870 3300013308 Bacteria 3927
172 Ga0157375_10141507 3300013308 Bacteria 2533
173 Ga0163163_10097498 3300014325 Bacteria 2960
174 Ga0163163_10345362 3300014325 Bacteria 1544
175 Ga0163163_10854215 3300014325 Bacteria 973
176 Ga0157380_10135142 3300014326 Bacteria 2110
177 Ga0157380_10186679 3300014326 Bacteria 1827
178 Ga0157377_10009003 3300014745 Bacteria 4887
179 Ga0157379_10816807 3300014968 Bacteria 881
180 Ga0224712_10085997 3300022467 Bacteria 1308
181 Ga0207697_10070116 3300025315 Bacteria 1468
182 Ga0207682_10016200 3300025893 Bacteria 2905
183 Ga0207680_10013302 3300025903 Bacteria 4224
184 Ga0207643_10078379 3300025908 Bacteria 1911
185 Ga0207643_10079460 3300025908 Bacteria 1898
186 Ga0207684_10043139 3300025910 Bacteria 3823
187 Ga0207684_10060132 3300025910 Bacteria 3227
188 Ga0207684_10149237 3300025910 Unclassified 2011
189 Ga0207684_10160371 3300025910 Bacteria 1937
190 Ga0207684_10170494 3300025910 Bacteria 1876
191 Ga0207695_10223347 3300025913 Bacteria 1790
192 Ga0207671_10000458 3300025914 Bacteria 55979
193 Ga0207693_10016107 3300025915 Bacteria 5983
194 Ga0207662_10002132 3300025918 Bacteria 9844
195 Ga0207649_10492353 3300025920 Bacteria 931
196 Ga0207646_10000989 3300025922 Bacteria 36524
197 Ga0207681_10024072 3300025923 Bacteria 3903
198 Ga0207681_10084977 3300025923 Bacteria 2245
199 Ga0207650_10002488 3300025925 Bacteria 12814
200 Ga0207650_10039230 3300025925 Bacteria 3461
201 Ga0207650_10072581 3300025925 Bacteria 2590
202 Ga0207650_10074394 3300025925 Bacteria 2560
203 Ga0207650_10326112 3300025925 Bacteria 1258
204 Ga0207659_10025830 3300025926 Bacteria 3953
205 Ga0207659_10443357 3300025926 Bacteria 1092
206 Ga0207644_10092378 3300025931 Bacteria 2258
207 Ga0207644_10125987 3300025931 Bacteria 1955
208 Ga0207690_10107000 3300025932 Unclassified 2008
209 Ga0207706_10331631 3300025933 Bacteria 1324
210 Ga0207706_10335996 3300025933 Bacteria 1314
211 Ga0207709_10052296 3300025935 Bacteria 2508
212 Ga0207670_10042043 3300025936 Bacteria 3009
213 Ga0207669_10097731 3300025937 Bacteria 1932
214 Ga0207691_10052332 3300025940 Bacteria 3730
215 Ga0207691_10085038 3300025940 Bacteria 2839
216 Ga0207691_10403909 3300025940 Bacteria 1165
217 Ga0207711_10059915 3300025941 Bacteria 3279
218 Ga0207689_10061646 3300025942 Bacteria 3085
219 Ga0207689_10099525 3300025942 Bacteria 2389
220 Ga0207661_10007488 3300025944 Bacteria 7766
221 Ga0207679_10055921 3300025945 Bacteria 2911
222 Ga0207679_10127257 3300025945 Bacteria 2038
223 Ga0207679_10132602 3300025945 Bacteria 2001
224 Ga0207679_10375597 3300025945 Bacteria 1245
225 Ga0207679_10634131 3300025945 Bacteria 965
226 Ga0207712_10289420 3300025961 Bacteria 1340
227 Ga0207658_10294641 3300025986 Bacteria 1396
228 Ga0207677_10180603 3300026023 Bacteria 1659
229 Ga0207678_10009479 3300026067 Bacteria 8564
230 Ga0207678_10127148 3300026067 Bacteria 2174
231 Ga0207708_10021461 3300026075 Bacteria 4870
232 Ga0207708_10175790 3300026075 Bacteria 1698
233 Ga0207641_10092948 3300026088 Bacteria 2643
234 Ga0207641_10321792 3300026088 Bacteria 1467
235 Ga0207648_10002617 3300026089 Bacteria 19279
236 Ga0207676_10098814 3300026095 Bacteria 2414
237 Ga0207674_10032580 3300026116 Bacteria 5464
238 Ga0207674_10092394 3300026116 Bacteria 3016
239 Ga0207675_100030687 3300026118 Bacteria 5006
240 Ga0207675_100078992 3300026118 Bacteria 3083
241 Ga0207683_10013306 3300026121 Bacteria 7014
242 Ga0207683_10141634 3300026121 Bacteria 2167
243 Ga0207683_10412751 3300026121 Unclassified 1243
244 Ga0209813_10014649 3300027866 Bacteria 2114
245 Ga0209813_10052159 3300027866 Bacteria 1282
246 Ga0207428_10000151 3300027907 Bacteria 94421
247 Ga0207428_10006372 3300027907 Bacteria 10915
248 Ga0207428_10022436 3300027907 Bacteria 5328
249 Ga0207428_10267299 3300027907 Bacteria 1272
250 Ga0268266_10081539 3300028379 Bacteria 2821
251 Ga0268266_10276305 3300028379 Bacteria 1561
252 Ga0268265_10321336 3300028380 Bacteria 1402
253 Ga0268265_10645250 3300028380 Bacteria 1017
254 Ga0307409_100408717 3300031995 Bacteria 1299
255 Ga0307409_100612181 3300031995 Bacteria 1078
256 Ga0307411_10491459 3300032005 Bacteria 1036
257 Ga0373954_0235625 3300035118 Bacteria 901
258 Ga0373943_0145963 3300035170 Bacteria 1278
259 Ga0373931_0198498 3300035691 Bacteria 1197
260 Ga0373927_0002329 3300035695 Bacteria 13873
261 Ga0373947_0434352 3300035725 Bacteria 888
262 Ga0373925_0000015 3300037068 Bacteria 178076
263 Ga0395900_0762720 3300037418 Bacteria 897
264 Ga0436365_1800696 3300039437 Bacteria 1777
265 Ga0451797_0488507 3300041453 Bacteria 1158
266 Ga0439441_056358 3300042001 Unclassified 820
267 Ga0439446_0009553 3300042156 Bacteria 2599
268 Ga0450908_026739 3300042184 Bacteria 1006
269 Ga0439435_0020248 3300042436 Bacteria 1714
270 Ga0439435_0051110 3300042436 Unclassified 1183
271 Ga0439435_0094391 3300042436 Bacteria 912
272 Ga0439464_0106189 3300042439 Bacteria 856
273 Ga0453683_0089711 3300044673 Unclassified 1927
274 Ga0495669_0074345 3300046684 Bacteria 1553
275 Ga0496100_0053353 3300048903 Bacteria 2633
276 Ga0496102_0079393 3300048905 Bacteria 3022
277 Ga0496102_0505641 3300048905 Bacteria 1131
278 Ga0496103_0241018 3300048906 Bacteria 1163
279 Ga0496104_0061901 3300048907 Bacteria 3548
280 Ga0496104_0273719 3300048907 Bacteria 1601
281 Ga0496105_0057327 3300048908 Bacteria 3217
282 Ga0496106_0237011 3300048909 Bacteria 1458
283 Ga0496108_0006586 3300048911 Bacteria 9422
284 Ga0496108_0185860 3300048911 Bacteria 1800
285 Ga0496109_0000094 3300048912 Bacteria 92002
286 Ga0496109_0030111 3300048912 Bacteria 4864
287 Ga0496110_0002338 3300048913 Bacteria 14184
288 Ga0496111_0007585 3300048914 Bacteria 7124
289 Ga0496112_0027331 3300048915 Bacteria 5501
290 Ga0496112_0096150 3300048915 Bacteria 2932
291 Ga0496112_0175543 3300048915 Bacteria 2107
292 Ga0496113_0056811 3300048916 Bacteria 2940
293 Ga0501034_0011998 3300049571 Bacteria 8954
294 Ga0501034_0055937 3300049571 Bacteria 3970
295 Ga0501036_0207766 3300049572 Bacteria 1646
296 Ga0501037_0001607 3300049573 Bacteria 16419
297 Ga0501038_0120957 3300049574 Bacteria 2159
298 Ga0501040_0305495 3300049576 Bacteria 1137
299 Ga0501041_0061963 3300049577 Bacteria 2290
300 Ga0501047_0060943 3300049581 Bacteria 3640
301 Ga0501071_0076551 3300049587 Bacteria 2444
302 Ga0501072_0006909 3300049588 Bacteria 8614
303 Ga0501076_0013067 3300049592 Bacteria 6217
304 Ga0501079_0023513 3300049741 Bacteria 4729
305 Ga0501080_0168353 3300049742 Bacteria 2022
306 Ga0501080_0168808 3300049742 Bacteria 2019
307 Ga0501045_0073565 3300049824 Bacteria 2517
308 Ga0501045_0196039 3300049824 Bacteria 1505
309 nmdc:mga03683_10372_c1 3300050489 Bacteria 3340
310 nmdc:mga03n38_30127_c1 3300050490 Bacteria 2278
311 nmdc:mga00v17_160636_c1 3300050491 Bacteria 1446
312 nmdc:mga00v17_192124_c1 3300050491 Bacteria 1319
313 nmdc:mga00v17_211151_c1 3300050491 Bacteria 1256
314 nmdc:mga00v17_34443_c1 3300050491 Bacteria 3008
315 nmdc:mga00v17_45343_c1 3300050491 Bacteria 2656
316 nmdc:mga0yw44_111584_c1 3300050492 Bacteria 1753
317 nmdc:mga0yw44_31850_c1 3300050492 Bacteria 3069
318 nmdc:mga0yw44_427529_c1 3300050492 Archaea 897
319 nmdc:mga0k408_3855_c1 3300050493 Bacteria 7949
320 nmdc:mga0k408_45750_c1 3300050493 Bacteria 2526
321 nmdc:mga0k408_614_c1 3300050493 Bacteria 19654
322 nmdc:mga06z11_245014_c1 3300050494 Archaea 1054
323 nmdc:mga06z11_8573_c1 3300050494 Bacteria 4273
324 nmdc:mga04h51_11146_c1 3300050495 Bacteria 2488
325 nmdc:mga04h51_74879_c1 3300050495 Bacteria 1190
326 nmdc:mga07m45_24240_c1 3300050496 Bacteria 3322
327 nmdc:mga07m45_26580_c1 3300050496 Bacteria 3182
328 nmdc:mga05p37_204593_c1 3300050507 Bacteria 2389
329 nmdc:mga05p37_21577_c1 3300050507 Bacteria 7803
330 nmdc:mga05p37_257540_c1 3300050507 Bacteria 2090
331 nmdc:mga05p37_380155_c1 3300050507 Bacteria 1655
332 nmdc:mga05p37_642_c1 3300050507 Bacteria 38709
333 nmdc:mga05p37_64590_c1 3300050507 Bacteria 4504
334 nmdc:mga05p37_755_c2 3300050507 Bacteria 10169
335 nmdc:mga09592_120618_c1 3300050508 Bacteria 2252
336 nmdc:mga09592_185469_c1 3300050508 Bacteria 1800
337 nmdc:mga09592_225547_c1 3300050508 Bacteria 1623
338 nmdc:mga09592_418912_c1 3300050508 Bacteria 1157
339 nmdc:mga09592_42577_c2 3300050508 Bacteria 2357
340 nmdc:mga09592_65748_c1 3300050508 Bacteria 3072
341 nmdc:mga0qj67_167735_c1 3300050509 Bacteria 1782
342 nmdc:mga0qj67_75624_c1 3300050509 Bacteria 2692
343 nmdc:mga06r32_10471_c1 3300050510 Bacteria 8364
344 nmdc:mga06r32_135731_c1 3300050510 Bacteria 2435
345 nmdc:mga06r32_14149_c1 3300050510 Bacteria 7236
346 nmdc:mga06r32_26105_c1 3300050510 Bacteria 5442
347 nmdc:mga06r32_304004_c1 3300050510 Bacteria 1581
348 nmdc:mga06r32_680401_c1 3300050510 Bacteria 995
349 nmdc:mga06r32_81443_c1 3300050510 Bacteria 3152
350 nmdc:mga08y16_174_c1 3300050511 Bacteria 56593
351 nmdc:mga08y16_176727_c1 3300050511 Bacteria 2217
352 nmdc:mga08y16_19484_c1 3300050511 Bacteria 7152
353 nmdc:mga08y16_214870_c1 3300050511 Bacteria 1991
354 nmdc:mga08y16_292594_c1 3300050511 Bacteria 1679
355 nmdc:mga08y16_381810_c1 3300050511 Bacteria 1444
356 nmdc:mga08y16_4950_c1 3300050511 Bacteria 13918
357 nmdc:mga0n895_7344_c1 3300050512 Bacteria 9453
358 nmdc:mga0n895_76627_c1 3300050512 Bacteria 3325
359 nmdc:mga0n895_90091_c1 3300050512 Unclassified 3068
360 nmdc:mga0rr50_181356_c1 3300050513 Bacteria 1721
361 nmdc:mga0rr50_486337_c1 3300050513 Bacteria 1048
362 nmdc:mga08x19_262546_c1 3300050514 Bacteria 1194
363 nmdc:mga0a205_130132_c1 3300050515 Bacteria 2417
364 nmdc:mga0a205_13632_c1 3300050515 Bacteria 7571
365 nmdc:mga0a205_214314_c1 3300050515 Unclassified 1813
366 nmdc:mga0a205_27370_c1 3300050515 Bacteria 5446
367 nmdc:mga0sz30_88777_c1 3300050516 Bacteria 1343
368 Ga0500610_0241738 3300053079 Bacteria 839
369 Ga0495619_0079210 3300053085 Bacteria 2210
370 Ga0500641_0001025 3300053096 Bacteria 9935
371 Ga0500555_001074 3300053103 Bacteria 9174
372 Ga0500555_027736 3300053103 Bacteria 1614
373 Ga0500616_0000226 3300053153 Bacteria 88101
374 Ga0500611_052757 3300053727 Bacteria 937
375 Ga0500645_000268 3300053730 Bacteria 37551
376 Ga0590071_000246 3300059421 Bacteria 15808
377 Ga0590075_000041 3300059424 Bacteria 33435
378 Ga0590077_000962 3300059426 Bacteria 7340
379 Ga0590077_001465 3300059426 Bacteria 5516
380 Ga0530510_0685152 3300061734 Unclassified 781

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100110351 Ga0070708_1001103513 205
2 3300050510 nmdc:mga06r32_680401_c1 nmdc:mga06r32_680401_c1_269_973 211
3 3300005356 Ga0070674_100384808 Ga0070674_1003848081 212
4 3300042436 Ga0439435_0051110 Ga0439435_0051110_511_1170 212
5 3300005444 Ga0070694_100003139 Ga0070694_1000031394 213
6 3300005549 Ga0070704_100018251 Ga0070704_1000182513 213
7 3300005549 Ga0070704_100924747 Ga0070704_1009247471 214
8 3300006844 Ga0075428_100612088 Ga0075428_1006120882 214
9 3300009147 Ga0114129_10060957 Ga0114129_100609573 214
10 3300049571 Ga0501034_0011998 Ga0501034_0011998_6465_7199 214
11 3300049573 Ga0501037_0001607 Ga0501037_0001607_10533_11267 214
12 3300049574 Ga0501038_0120957 Ga0501038_0120957_501_1235 214
13 3300049581 Ga0501047_0060943 Ga0501047_0060943_131_865 214
14 3300050507 nmdc:mga05p37_204593_c1 nmdc:mga05p37_204593_c1_388_1068 214
15 3300005345 Ga0070692_10095233 Ga0070692_100952332 215
16 3300005438 Ga0070701_10146574 Ga0070701_101465742 215
17 3300005440 Ga0070705_100451271 Ga0070705_1004512712 215
18 3300005444 Ga0070694_100118761 Ga0070694_1001187612 215
19 3300005545 Ga0070695_100136480 Ga0070695_1001364802 215
20 3300005577 Ga0068857_100082062 Ga0068857_1000820623 215
21 3300005617 Ga0068859_100087866 Ga0068859_1000878663 215
22 3300005719 Ga0068861_100043342 Ga0068861_1000433422 215
23 3300005840 Ga0068870_10043331 Ga0068870_100433312 215
24 3300005844 Ga0068862_100044840 Ga0068862_1000448403 215
25 3300006931 Ga0097620_100087873 Ga0097620_1000878733 215
26 3300025908 Ga0207643_10078379 Ga0207643_100783792 215
27 3300026116 Ga0207674_10092394 Ga0207674_100923942 215
28 3300006847 Ga0075431_100268555 Ga0075431_1002685552 217
29 3300048907 Ga0496104_0273719 Ga0496104_0273719_349_1047 218
30 3300048915 Ga0496112_0027331 Ga0496112_0027331_1869_2567 218
31 3300005445 Ga0070708_100300204 Ga0070708_1003002041 219
32 3300005468 Ga0070707_100058450 Ga0070707_1000584504 219
33 3300005471 Ga0070698_100397239 Ga0070698_1003972392 219
34 3300006847 Ga0075431_100248168 Ga0075431_1002481682 219
35 3300061734 Ga0530510_0685152 Ga0530510_0685152_48_737 219
36 3300005331 Ga0070670_100002006 Ga0070670_10000200610 220
37 3300005458 Ga0070681_10148915 Ga0070681_101489152 220
38 3300005547 Ga0070693_100122069 Ga0070693_1001220692 220
39 3300006844 Ga0075428_100112046 Ga0075428_1001120463 220
40 3300006846 Ga0075430_100163703 Ga0075430_1001637033 220
41 3300006847 Ga0075431_100018244 Ga0075431_1000182445 220
42 3300006880 Ga0075429_100008186 Ga0075429_1000081868 220
43 3300009147 Ga0114129_10004923 Ga0114129_100049239 220
44 3300025925 Ga0207650_10002488 Ga0207650_100024885 220
45 3300025932 Ga0207690_10107000 Ga0207690_101070002 220
46 3300042436 Ga0439435_0020248 Ga0439435_0020248_931_1623 220
47 3300050507 nmdc:mga05p37_257540_c1 nmdc:mga05p37_257540_c1_874_1566 220
48 3300050507 nmdc:mga05p37_755_c2 nmdc:mga05p37_755_c2_2877_3569 220
49 3300050508 nmdc:mga09592_42577_c2 nmdc:mga09592_42577_c2_755_1447 220
50 3300050509 nmdc:mga0qj67_75624_c1 nmdc:mga0qj67_75624_c1_1859_2551 220
51 3300050510 nmdc:mga06r32_14149_c1 nmdc:mga06r32_14149_c1_2168_2860 220
52 3300050511 nmdc:mga08y16_381810_c1 nmdc:mga08y16_381810_c1_449_1141 220
53 3300053096 Ga0500641_0001025 Ga0500641_0001025_4436_5167 220
54 3300005353 Ga0070669_100092910 Ga0070669_1000929102 221
55 3300005364 Ga0070673_100366148 Ga0070673_1003661482 221
56 3300005366 Ga0070659_100247118 Ga0070659_1002471181 221
57 3300005456 Ga0070678_100675894 Ga0070678_1006758942 221
58 3300005981 Ga0081538_10064699 Ga0081538_100646992 221
59 3300006844 Ga0075428_100689610 Ga0075428_1006896102 221
60 3300006847 Ga0075431_100087305 Ga0075431_1000873053 221
61 3300006847 Ga0075431_100091219 Ga0075431_1000912192 221
62 3300025933 Ga0207706_10331631 Ga0207706_103316311 221
63 3300037418 Ga0395900_0762720 Ga0395900_0762720_148_852 221
64 3300042436 Ga0439435_0094391 Ga0439435_0094391_112_822 221
65 3300042439 Ga0439464_0106189 Ga0439464_0106189_57_776 221
66 3300048905 Ga0496102_0079393 Ga0496102_0079393_469_1182 221
67 3300048906 Ga0496103_0241018 Ga0496103_0241018_182_895 221
68 3300048911 Ga0496108_0185860 Ga0496108_0185860_37_750 221
69 3300049576 Ga0501040_0305495 Ga0501040_0305495_376_1125 221
70 3300049588 Ga0501072_0006909 Ga0501072_0006909_4011_4757 221
71 3300049592 Ga0501076_0013067 Ga0501076_0013067_2024_2773 221
72 3300049741 Ga0501079_0023513 Ga0501079_0023513_134_883 221
73 3300049742 Ga0501080_0168808 Ga0501080_0168808_60_806 221
74 3300049824 Ga0501045_0073565 Ga0501045_0073565_1125_1871 221
75 3300050508 nmdc:mga09592_225547_c1 nmdc:mga09592_225547_c1_201_902 221
76 3300050510 nmdc:mga06r32_135731_c1 nmdc:mga06r32_135731_c1_1239_1958 221
77 3300050510 nmdc:mga06r32_81443_c1 nmdc:mga06r32_81443_c1_890_1606 221
78 3300059421 Ga0590071_000246 Ga0590071_000246_11537_12256 221
79 3300059424 Ga0590075_000041 Ga0590075_000041_13996_14715 221
80 3300059426 Ga0590077_001465 Ga0590077_001465_1073_1792 221
81 3300005329 Ga0070683_100044444 Ga0070683_1000444443 222
82 3300005331 Ga0070670_100004508 Ga0070670_1000045082 222
83 3300005335 Ga0070666_10089263 Ga0070666_100892632 222
84 3300005337 Ga0070682_100121666 Ga0070682_1001216662 222
85 3300005344 Ga0070661_100005089 Ga0070661_1000050894 222
86 3300005347 Ga0070668_100540736 Ga0070668_1005407362 222
87 3300005355 Ga0070671_100093902 Ga0070671_1000939023 222
88 3300005367 Ga0070667_100077267 Ga0070667_1000772673 222
89 3300005457 Ga0070662_100563626 Ga0070662_1005636261 222
90 3300005535 Ga0070684_100664539 Ga0070684_1006645392 222
91 3300005543 Ga0070672_100060755 Ga0070672_1000607551 222
92 3300005546 Ga0070696_100393029 Ga0070696_1003930292 222
93 3300005564 Ga0070664_100001167 Ga0070664_1000011676 222
94 3300005618 Ga0068864_100234756 Ga0068864_1002347561 222
95 3300006852 Ga0075433_10884641 Ga0075433_108846411 222
96 3300007076 Ga0075435_100083551 Ga0075435_1000835512 222
97 3300009177 Ga0105248_10017600 Ga0105248_100176008 222
98 3300009553 Ga0105249_10344076 Ga0105249_103440763 222
99 3300014325 Ga0163163_10097498 Ga0163163_100974982 222
100 3300014968 Ga0157379_10816807 Ga0157379_108168071 222
101 3300025903 Ga0207680_10013302 Ga0207680_100133023 222
102 3300025920 Ga0207649_10492353 Ga0207649_104923532 222
103 3300025925 Ga0207650_10074394 Ga0207650_100743943 222
104 3300025931 Ga0207644_10125987 Ga0207644_101259872 222
105 3300025940 Ga0207691_10085038 Ga0207691_100850384 222
106 3300025941 Ga0207711_10059915 Ga0207711_100599155 222
107 3300025944 Ga0207661_10007488 Ga0207661_100074886 222
108 3300025945 Ga0207679_10055921 Ga0207679_100559213 222
109 3300026095 Ga0207676_10098814 Ga0207676_100988143 222
110 3300032005 Ga0307411_10491459 Ga0307411_104914591 222
111 3300048903 Ga0496100_0053353 Ga0496100_0053353_195_923 222
112 3300048905 Ga0496102_0505641 Ga0496102_0505641_272_1000 222
113 3300048907 Ga0496104_0061901 Ga0496104_0061901_1542_2270 222
114 3300048908 Ga0496105_0057327 Ga0496105_0057327_2061_2789 222
115 3300048911 Ga0496108_0006586 Ga0496108_0006586_1339_2067 222
116 3300048912 Ga0496109_0030111 Ga0496109_0030111_1286_2014 222
117 3300048913 Ga0496110_0002338 Ga0496110_0002338_10269_10997 222
118 3300048914 Ga0496111_0007585 Ga0496111_0007585_5750_6478 222
119 3300048915 Ga0496112_0096150 Ga0496112_0096150_2001_2729 222
120 3300048916 Ga0496113_0056811 Ga0496113_0056811_493_1221 222
121 3300050512 nmdc:mga0n895_90091_c1 nmdc:mga0n895_90091_c1_1852_2553 222
122 3300050514 nmdc:mga08x19_262546_c1 nmdc:mga08x19_262546_c1_348_1043 222
123 3300006871 Ga0075434_100001020 Ga0075434_10000102016 223
124 3300026121 Ga0207683_10412751 Ga0207683_104127512 223
125 3300050512 nmdc:mga0n895_7344_c1 nmdc:mga0n895_7344_c1_1315_2022 223
126 3300050515 nmdc:mga0a205_214314_c1 nmdc:mga0a205_214314_c1_849_1556 223
127 3300006844 Ga0075428_100442914 Ga0075428_1004429142 224
128 3300006844 Ga0075428_100879918 Ga0075428_1008799182 224
129 3300006847 Ga0075431_100016985 Ga0075431_1000169855 224
130 3300006847 Ga0075431_100275931 Ga0075431_1002759312 224
131 3300009147 Ga0114129_10090194 Ga0114129_100901942 224
132 3300027907 Ga0207428_10006372 Ga0207428_100063725 224
133 3300042184 Ga0450908_026739 Ga0450908_026739_53_763 224
134 3300048912 Ga0496109_0000094 Ga0496109_0000094_11507_12199 224
135 3300050507 nmdc:mga05p37_21577_c1 nmdc:mga05p37_21577_c1_91_783 224
136 3300050507 nmdc:mga05p37_380155_c1 nmdc:mga05p37_380155_c1_226_918 224
137 3300050508 nmdc:mga09592_65748_c1 nmdc:mga09592_65748_c1_587_1279 224
138 3300050510 nmdc:mga06r32_26105_c1 nmdc:mga06r32_26105_c1_312_1004 224
139 3300050510 nmdc:mga06r32_304004_c1 nmdc:mga06r32_304004_c1_655_1347 224
140 3300050511 nmdc:mga08y16_4950_c1 nmdc:mga08y16_4950_c1_7459_8151 224
141 3300050513 nmdc:mga0rr50_486337_c1 nmdc:mga0rr50_486337_c1_226_918 224
142 3300053079 Ga0500610_0241738 Ga0500610_0241738_93_785 224
143 3300053103 Ga0500555_027736 Ga0500555_027736_388_1080 224
144 3300053727 Ga0500611_052757 Ga0500611_052757_47_739 224
145 3300005334 Ga0068869_100132083 Ga0068869_1001320832 225
146 3300005344 Ga0070661_100249627 Ga0070661_1002496272 225
147 3300005355 Ga0070671_100361469 Ga0070671_1003614692 225
148 3300005364 Ga0070673_100062220 Ga0070673_1000622202 225
149 3300005367 Ga0070667_100258090 Ga0070667_1002580902 225
150 3300005441 Ga0070700_100132659 Ga0070700_1001326592 225
151 3300005444 Ga0070694_100001301 Ga0070694_10000130116 225
152 3300005455 Ga0070663_100440053 Ga0070663_1004400531 225
153 3300005467 Ga0070706_100088604 Ga0070706_1000886042 225
154 3300005468 Ga0070707_100000608 Ga0070707_1000006084 225
155 3300005543 Ga0070672_100160711 Ga0070672_1001607111 225
156 3300005544 Ga0070686_100389827 Ga0070686_1003898272 225
157 3300005545 Ga0070695_100174814 Ga0070695_1001748142 225
158 3300005549 Ga0070704_100125882 Ga0070704_1001258822 225
159 3300005564 Ga0070664_100153956 Ga0070664_1001539561 225
160 3300005618 Ga0068864_100055474 Ga0068864_1000554742 225
161 3300005840 Ga0068870_10065933 Ga0068870_100659333 225
162 3300005841 Ga0068863_100350726 Ga0068863_1003507262 225
163 3300006042 Ga0075368_10015866 Ga0075368_100158663 225
164 3300006042 Ga0075368_10019357 Ga0075368_100193573 225
165 3300006175 Ga0070712_100034032 Ga0070712_1000340322 225
166 3300006195 Ga0075366_10004192 Ga0075366_100041922 225
167 3300006195 Ga0075366_10076381 Ga0075366_100763812 225
168 3300006195 Ga0075366_10174218 Ga0075366_101742182 225
169 3300006880 Ga0075429_100235262 Ga0075429_1002352621 225
170 3300009094 Ga0111539_10722407 Ga0111539_107224072 225
171 3300009177 Ga0105248_10300675 Ga0105248_103006752 225
172 3300009545 Ga0105237_10000492 Ga0105237_100004927 225
173 3300013105 Ga0157369_10155562 Ga0157369_101555622 225
174 3300013308 Ga0157375_10141507 Ga0157375_101415073 225
175 3300025893 Ga0207682_10016200 Ga0207682_100162002 225
176 3300025910 Ga0207684_10043139 Ga0207684_100431394 225
177 3300025914 Ga0207671_10000458 Ga0207671_100004587 225
178 3300025915 Ga0207693_10016107 Ga0207693_100161074 225
179 3300025922 Ga0207646_10000989 Ga0207646_1000098934 225
180 3300025925 Ga0207650_10072581 Ga0207650_100725811 225
181 3300025931 Ga0207644_10092378 Ga0207644_100923783 225
182 3300025933 Ga0207706_10335996 Ga0207706_103359963 225
183 3300025940 Ga0207691_10403909 Ga0207691_104039092 225
184 3300025945 Ga0207679_10132602 Ga0207679_101326022 225
185 3300025986 Ga0207658_10294641 Ga0207658_102946411 225
186 3300026067 Ga0207678_10009479 Ga0207678_100094793 225
187 3300026075 Ga0207708_10175790 Ga0207708_101757902 225
188 3300026088 Ga0207641_10321792 Ga0207641_103217922 225
189 3300026118 Ga0207675_100078992 Ga0207675_1000789923 225
190 3300026121 Ga0207683_10013306 Ga0207683_100133063 225
191 3300027866 Ga0209813_10052159 Ga0209813_100521592 225
192 3300028380 Ga0268265_10321336 Ga0268265_103213362 225
193 3300035118 Ga0373954_0235625 Ga0373954_0235625_174_890 225
194 3300044673 Ga0453683_0089711 Ga0453683_0089711_1105_1800 225
195 3300048909 Ga0496106_0237011 Ga0496106_0237011_10_720 225
196 3300050491 nmdc:mga00v17_192124_c1 nmdc:mga00v17_192124_c1_268_984 225
197 3300050491 nmdc:mga00v17_211151_c1 nmdc:mga00v17_211151_c1_495_1205 225
198 3300050493 nmdc:mga0k408_3855_c1 nmdc:mga0k408_3855_c1_2773_3483 225
199 3300050493 nmdc:mga0k408_45750_c1 nmdc:mga0k408_45750_c1_335_1051 225
200 3300050495 nmdc:mga04h51_74879_c1 nmdc:mga04h51_74879_c1_190_900 225
201 3300050496 nmdc:mga07m45_24240_c1 nmdc:mga07m45_24240_c1_959_1675 225
202 3300005467 Ga0070706_100071507 Ga0070706_1000715072 226
203 3300006852 Ga0075433_10112102 Ga0075433_101121022 226
204 3300007076 Ga0075435_100168618 Ga0075435_1001686182 226
205 3300025910 Ga0207684_10060132 Ga0207684_100601324 226
206 3300025910 Ga0207684_10160371 Ga0207684_101603712 226
207 3300050508 nmdc:mga09592_185469_c1 nmdc:mga09592_185469_c1_997_1695 226
208 3300050513 nmdc:mga0rr50_181356_c1 nmdc:mga0rr50_181356_c1_72_770 226
209 3300005330 Ga0070690_100013247 Ga0070690_1000132473 227
210 3300005334 Ga0068869_100040746 Ga0068869_1000407462 227
211 3300005343 Ga0070687_100017538 Ga0070687_1000175383 227
212 3300005354 Ga0070675_100028677 Ga0070675_1000286772 227
213 3300005356 Ga0070674_100004210 Ga0070674_1000042108 227
214 3300005365 Ga0070688_100037920 Ga0070688_1000379202 227
215 3300005367 Ga0070667_100138102 Ga0070667_1001381022 227
216 3300005441 Ga0070700_100026640 Ga0070700_1000266401 227
217 3300005455 Ga0070663_100339118 Ga0070663_1003391182 227
218 3300005456 Ga0070678_100052632 Ga0070678_1000526323 227
219 3300005457 Ga0070662_100041715 Ga0070662_1000417152 227
220 3300005459 Ga0068867_100008378 Ga0068867_1000083783 227
221 3300005615 Ga0070702_100033657 Ga0070702_1000336572 227
222 3300005719 Ga0068861_100382818 Ga0068861_1003828182 227
223 3300005841 Ga0068863_100029770 Ga0068863_1000297703 227
224 3300005843 Ga0068860_100109915 Ga0068860_1001099152 227
225 3300005844 Ga0068862_100007907 Ga0068862_1000079071 227
226 3300005844 Ga0068862_100445656 Ga0068862_1004456562 227
227 3300006042 Ga0075368_10024556 Ga0075368_100245562 227
228 3300006048 Ga0075363_100031061 Ga0075363_1000310612 227
229 3300006051 Ga0075364_10007701 Ga0075364_100077015 227
230 3300006177 Ga0075362_10004875 Ga0075362_100048753 227
231 3300006178 Ga0075367_10004084 Ga0075367_100040843 227
232 3300006195 Ga0075366_10000097 Ga0075366_1000009721 227
233 3300006237 Ga0097621_100744128 Ga0097621_1007441282 227
234 3300006353 Ga0075370_10076310 Ga0075370_100763102 227
235 3300006844 Ga0075428_100252277 Ga0075428_1002522772 227
236 3300006846 Ga0075430_100168294 Ga0075430_1001682941 227
237 3300006880 Ga0075429_100054743 Ga0075429_1000547433 227
238 3300009094 Ga0111539_10000386 Ga0111539_1000038642 227
239 3300009101 Ga0105247_10111542 Ga0105247_101115422 227
240 3300009147 Ga0114129_10045393 Ga0114129_100453932 227
241 3300009147 Ga0114129_10079333 Ga0114129_100793335 227
242 3300009147 Ga0114129_10218635 Ga0114129_102186352 227
243 3300009147 Ga0114129_10953206 Ga0114129_109532062 227
244 3300009148 Ga0105243_10004339 Ga0105243_100043398 227
245 3300009177 Ga0105248_10098934 Ga0105248_100989342 227
246 3300011119 Ga0105246_10106975 Ga0105246_101069752 227
247 3300013306 Ga0163162_10431343 Ga0163162_104313432 227
248 3300013308 Ga0157375_10054870 Ga0157375_100548703 227
249 3300014325 Ga0163163_10345362 Ga0163163_103453621 227
250 3300014326 Ga0157380_10135142 Ga0157380_101351423 227
251 3300014745 Ga0157377_10009003 Ga0157377_100090031 227
252 3300025908 Ga0207643_10079460 Ga0207643_100794602 227
253 3300025910 Ga0207684_10149237 Ga0207684_101492372 227
254 3300025918 Ga0207662_10002132 Ga0207662_100021326 227
255 3300025923 Ga0207681_10084977 Ga0207681_100849772 227
256 3300025926 Ga0207659_10025830 Ga0207659_100258304 227
257 3300025935 Ga0207709_10052296 Ga0207709_100522963 227
258 3300025936 Ga0207670_10042043 Ga0207670_100420432 227
259 3300025937 Ga0207669_10097731 Ga0207669_100977312 227
260 3300025940 Ga0207691_10052332 Ga0207691_100523324 227
261 3300025942 Ga0207689_10061646 Ga0207689_100616462 227
262 3300026023 Ga0207677_10180603 Ga0207677_101806032 227
263 3300026067 Ga0207678_10127148 Ga0207678_101271483 227
264 3300026075 Ga0207708_10021461 Ga0207708_100214613 227
265 3300026088 Ga0207641_10092948 Ga0207641_100929482 227
266 3300026089 Ga0207648_10002617 Ga0207648_100026174 227
267 3300026118 Ga0207675_100030687 Ga0207675_1000306872 227
268 3300026121 Ga0207683_10141634 Ga0207683_101416342 227
269 3300027866 Ga0209813_10014649 Ga0209813_100146492 227
270 3300027907 Ga0207428_10000151 Ga0207428_1000015134 227
271 3300028379 Ga0268266_10276305 Ga0268266_102763052 227
272 3300035691 Ga0373931_0198498 Ga0373931_0198498_464_1168 227
273 3300046684 Ga0495669_0074345 Ga0495669_0074345_674_1378 227
274 3300050490 nmdc:mga03n38_30127_c1 nmdc:mga03n38_30127_c1_83_787 227
275 3300050492 nmdc:mga0yw44_111584_c1 nmdc:mga0yw44_111584_c1_30_734 227
276 3300050493 nmdc:mga0k408_614_c1 nmdc:mga0k408_614_c1_14594_15298 227
277 3300050495 nmdc:mga04h51_11146_c1 nmdc:mga04h51_11146_c1_1038_1742 227
278 3300050496 nmdc:mga07m45_26580_c1 nmdc:mga07m45_26580_c1_1000_1704 227
279 3300050507 nmdc:mga05p37_642_c1 nmdc:mga05p37_642_c1_15055_15762 227
280 3300050509 nmdc:mga0qj67_167735_c1 nmdc:mga0qj67_167735_c1_20_724 227
281 3300050510 nmdc:mga06r32_10471_c1 nmdc:mga06r32_10471_c1_3648_4352 227
282 3300050511 nmdc:mga08y16_174_c1 nmdc:mga08y16_174_c1_51920_52624 227
283 3300050515 nmdc:mga0a205_13632_c1 nmdc:mga0a205_13632_c1_3752_4456 227
284 3300050516 nmdc:mga0sz30_88777_c1 nmdc:mga0sz30_88777_c1_622_1326 227
285 3300005334 Ga0068869_100088692 Ga0068869_1000886922 228
286 3300025910 Ga0207684_10170494 Ga0207684_101704942 228
287 3300025926 Ga0207659_10443357 Ga0207659_104433572 228
288 3300025942 Ga0207689_10099525 Ga0207689_100995252 228
289 3300050511 nmdc:mga08y16_292594_c1 nmdc:mga08y16_292594_c1_758_1447 228
290 3300005331 Ga0070670_100149602 Ga0070670_1001496021 229
291 3300005578 Ga0068854_100632036 Ga0068854_1006320361 229
292 3300009094 Ga0111539_10126329 Ga0111539_101263293 229
293 3300009094 Ga0111539_11435667 Ga0111539_114356671 229
294 3300022467 Ga0224712_10085997 Ga0224712_100859972 229
295 3300025913 Ga0207695_10223347 Ga0207695_102233473 229
296 3300025925 Ga0207650_10326112 Ga0207650_103261122 229
297 3300025945 Ga0207679_10127257 Ga0207679_101272572 229
298 3300031995 Ga0307409_100408717 Ga0307409_1004087172 229
299 3300031995 Ga0307409_100612181 Ga0307409_1006121812 229
300 3300042156 Ga0439446_0009553 Ga0439446_0009553_1530_2222 229
301 3300050511 nmdc:mga08y16_214870_c1 nmdc:mga08y16_214870_c1_827_1519 229
302 3300005293 Ga0065715_10181649 Ga0065715_101816493 230
303 3300005344 Ga0070661_100380673 Ga0070661_1003806732 230
304 3300005353 Ga0070669_100002229 Ga0070669_1000022296 230
305 3300005444 Ga0070694_100048433 Ga0070694_1000484332 230
306 3300005577 Ga0068857_100241277 Ga0068857_1002412773 230
307 3300005617 Ga0068859_100479605 Ga0068859_1004796053 230
308 3300005844 Ga0068862_100028310 Ga0068862_1000283104 230
309 3300006844 Ga0075428_100048696 Ga0075428_1000486965 230
310 3300006852 Ga0075433_10021109 Ga0075433_100211093 230
311 3300006931 Ga0097620_100479543 Ga0097620_1004795431 230
312 3300009094 Ga0111539_10000877 Ga0111539_100008777 230
313 3300009094 Ga0111539_10185833 Ga0111539_101858333 230
314 3300009147 Ga0114129_10013047 Ga0114129_1001304712 230
315 3300009553 Ga0105249_10000704 Ga0105249_1000070418 230
316 3300011119 Ga0105246_10178007 Ga0105246_101780072 230
317 3300014326 Ga0157380_10186679 Ga0157380_101866792 230
318 3300025315 Ga0207697_10070116 Ga0207697_100701162 230
319 3300025923 Ga0207681_10024072 Ga0207681_100240722 230
320 3300025945 Ga0207679_10375597 Ga0207679_103755973 230
321 3300025961 Ga0207712_10289420 Ga0207712_102894201 230
322 3300026116 Ga0207674_10032580 Ga0207674_100325802 230
323 3300027907 Ga0207428_10022436 Ga0207428_100224364 230
324 3300027907 Ga0207428_10267299 Ga0207428_102672993 230
325 3300050508 nmdc:mga09592_120618_c1 nmdc:mga09592_120618_c1_245_937 230
326 3300050511 nmdc:mga08y16_176727_c1 nmdc:mga08y16_176727_c1_863_1555 230
327 3300050511 nmdc:mga08y16_19484_c1 nmdc:mga08y16_19484_c1_4784_5476 230
328 3300050512 nmdc:mga0n895_76627_c1 nmdc:mga0n895_76627_c1_1774_2466 230
329 3300050515 nmdc:mga0a205_27370_c1 nmdc:mga0a205_27370_c1_1673_2365 230
330 3300005293 Ga0065715_10024157 Ga0065715_100241573 231
331 3300005340 Ga0070689_100450310 Ga0070689_1004503101 231
332 3300006038 Ga0075365_10072308 Ga0075365_100723082 231
333 3300006038 Ga0075365_10097352 Ga0075365_100973523 231
334 3300006051 Ga0075364_10006657 Ga0075364_100066574 231
335 3300006051 Ga0075364_10008901 Ga0075364_100089013 231
336 3300006177 Ga0075362_10001457 Ga0075362_100014575 231
337 3300006178 Ga0075367_10005755 Ga0075367_100057553 231
338 3300006178 Ga0075367_10019738 Ga0075367_100197384 231
339 3300006178 Ga0075367_10021901 Ga0075367_100219012 231
340 3300006195 Ga0075366_10014119 Ga0075366_100141193 231
341 3300006195 Ga0075366_10042525 Ga0075366_100425253 231
342 3300006353 Ga0075370_10011138 Ga0075370_100111383 231
343 3300006852 Ga0075433_10139120 Ga0075433_101391203 231
344 3300006871 Ga0075434_100072373 Ga0075434_1000723733 231
345 3300009147 Ga0114129_10134075 Ga0114129_101340752 231
346 3300014325 Ga0163163_10854215 Ga0163163_108542152 231
347 3300025925 Ga0207650_10039230 Ga0207650_100392302 231
348 3300025945 Ga0207679_10634131 Ga0207679_106341311 231
349 3300028379 Ga0268266_10081539 Ga0268266_100815393 231
350 3300028380 Ga0268265_10645250 Ga0268265_106452502 231
351 3300035170 Ga0373943_0145963 Ga0373943_0145963_437_1192 231
352 3300035695 Ga0373927_0002329 Ga0373927_0002329_1439_2194 231
353 3300035725 Ga0373947_0434352 Ga0373947_0434352_44_799 231
354 3300037068 Ga0373925_0000015 Ga0373925_0000015_67260_68015 231
355 3300039437 Ga0436365_1800696 Ga0436365_1800696_1022_1744 231
356 3300041453 Ga0451797_0488507 Ga0451797_0488507_186_899 231
357 3300042001 Ga0439441_056358 Ga0439441_056358_84_779 231
358 3300048915 Ga0496112_0175543 Ga0496112_0175543_386_1099 231
359 3300049571 Ga0501034_0055937 Ga0501034_0055937_255_956 231
360 3300049572 Ga0501036_0207766 Ga0501036_0207766_147_851 231
361 3300049577 Ga0501041_0061963 Ga0501041_0061963_199_903 231
362 3300049587 Ga0501071_0076551 Ga0501071_0076551_1556_2260 231
363 3300049742 Ga0501080_0168353 Ga0501080_0168353_1237_1941 231
364 3300049824 Ga0501045_0196039 Ga0501045_0196039_134_838 231
365 3300050489 nmdc:mga03683_10372_c1 nmdc:mga03683_10372_c1_373_1077 231
366 3300050491 nmdc:mga00v17_160636_c1 nmdc:mga00v17_160636_c1_663_1367 231
367 3300050491 nmdc:mga00v17_34443_c1 nmdc:mga00v17_34443_c1_1327_2031 231
368 3300050491 nmdc:mga00v17_45343_c1 nmdc:mga00v17_45343_c1_498_1229 231
369 3300050492 nmdc:mga0yw44_31850_c1 nmdc:mga0yw44_31850_c1_2301_3032 231
370 3300050492 nmdc:mga0yw44_427529_c1 nmdc:mga0yw44_427529_c1_173_877 231
371 3300050494 nmdc:mga06z11_245014_c1 nmdc:mga06z11_245014_c1_189_893 231
372 3300050494 nmdc:mga06z11_8573_c1 nmdc:mga06z11_8573_c1_1962_2693 231
373 3300050507 nmdc:mga05p37_64590_c1 nmdc:mga05p37_64590_c1_1674_2408 231
374 3300050508 nmdc:mga09592_418912_c1 nmdc:mga09592_418912_c1_197_931 231
375 3300050515 nmdc:mga0a205_130132_c1 nmdc:mga0a205_130132_c1_1650_2357 231
376 3300053085 Ga0495619_0079210 Ga0495619_0079210_124_834 231
377 3300053103 Ga0500555_001074 Ga0500555_001074_6655_7380 231
378 3300053153 Ga0500616_0000226 Ga0500616_0000226_59050_59775 231
379 3300053730 Ga0500645_000268 Ga0500645_000268_25460_26185 231
380 3300059426 Ga0590077_000962 Ga0590077_000962_4738_5457 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00215

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family

38

239

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f4w-assembly1.cif.gz_B the 1.65a crystal structure of 3-hexulose-6-phosphate synthase from salmonella typhimurium 0.9086 6 227
3f4w-assembly1.cif.gz_B the 1.65a crystal structure of 3-hexulose-6-phosphate synthase from salmonella typhimurium 0.8963 6 227
1xbz-assembly1.cif.gz_A crystal structure of 3-keto-l-gulonate 6-phosphate decarboxylase e112d/r139v/t169a mutant with bound l-xylulose 5-phosphate 0.8925 9 228
1q6q-assembly1.cif.gz_A structure of 3-keto-l-gulonate 6-phosphate decarboxylase with bound xylitol 5-phosphate 0.892 8 228
1so6-assembly1.cif.gz_A crystal structure of e112q/h136a double mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate 0.8852 9 228
ID Description Score Start End Superfamily
af_Q2G0K7_1_209_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9202 10 225 3.20.20.70
3f4wB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9086 6 227 3.20.20.70
af_Q2G0K7_1_209_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9035 10 225 3.20.20.70
3f4wB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8963 6 227 3.20.20.70
3ajxA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.896 6 225 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A354TCM2-F1-model_v4 D-arabino 3-hexulose 6-phosphate aldehyde lyase 1 10 118 GO:0004590
GO:0006207
GO:0019854
GO:0033982
AF-A0A4Q5Y8B4-F1-model_v4 D-arabino 3-hexulose 6-phosphate aldehyde lyase 0.9992 10 86 GO:0004590
GO:0006207
GO:0019854
GO:0033982
AF-A0A843JGB0-F1-model_v4 Orotidine 5'-phosphate decarboxylase 0.9957 10 119 GO:0004590
GO:0006207
GO:0019854
GO:0033982
AF-A0A5E4J6A4-F1-model_v4 Bifunctional enzyme Fae/Hps 0.9922 16 115 GO:0004590
GO:0006207
GO:0019854
GO:0033982
GO:0042558
AF-A0A7W0F2L9-F1-model_v4 Bifunctional hexulose-6-phosphate synthase/ribonuclease regulator 0.991 10 102 GO:0004590
GO:0006207
GO:0019854
GO:0033982

Feature Viewer

pLDDT pTM Quality
88.12 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map