F428699
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 380 | 198 | 380 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300028379|Ga0268266_10081539|Ga0268266_100815393 |
| Length | 265 |
| Sequence | VFPNRPQWAGNGAWRGADPGSPDILPRRMNRPAPLTSPIVQISLDLTDLDEALATAQIAVDAGVDWLEAGTPLILAHGAKAVEKLHERFPTHPIIADAKIMDGGYHEAELMAKAGASWVVVMGRAHEATVRRVVDAGRDFGIKVMGDNMLATDRVANARWLAELGVDVVIHHIGYDERGLVKGLNPMQELDAVVAAVSVPVQAVGGLTIQQAIECPAHGAALVVLGAPLVIAADDFKPAGSDLGSILREICTEIRKTPMLDRARS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 129 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 131 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 137 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 138 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 139 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 140 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 141 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 142 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 143 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 144 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 147 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 148 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 149 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 150 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 151 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 154 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 155 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 156 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 171 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 172 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 173 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 174 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 175 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 176 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 177 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 178 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 188 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 189 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 191 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 192 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 193 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 194 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 195 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 196 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 197 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 198 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.68 |
| Nodule | 0 |
| Rhizoplane | 5 |
| Rhizosphere | 81.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10024157 | 3300005293 | Bacteria | 1546 |
| 2 | Ga0065715_10181649 | 3300005293 | Bacteria | 1457 |
| 3 | Ga0070683_100044444 | 3300005329 | Bacteria | 4096 |
| 4 | Ga0070690_100013247 | 3300005330 | Bacteria | 4869 |
| 5 | Ga0070670_100002006 | 3300005331 | Bacteria | 16650 |
| 6 | Ga0070670_100004508 | 3300005331 | Bacteria | 11673 |
| 7 | Ga0070670_100149602 | 3300005331 | Bacteria | 2021 |
| 8 | Ga0068869_100040746 | 3300005334 | Bacteria | 3323 |
| 9 | Ga0068869_100088692 | 3300005334 | Bacteria | 2322 |
| 10 | Ga0068869_100132083 | 3300005334 | Bacteria | 1920 |
| 11 | Ga0070666_10089263 | 3300005335 | Bacteria | 2115 |
| 12 | Ga0070682_100121666 | 3300005337 | Bacteria | 1753 |
| 13 | Ga0070689_100450310 | 3300005340 | Bacteria | 1095 |
| 14 | Ga0070687_100017538 | 3300005343 | Bacteria | 3295 |
| 15 | Ga0070661_100005089 | 3300005344 | Bacteria | 9071 |
| 16 | Ga0070661_100249627 | 3300005344 | Bacteria | 1369 |
| 17 | Ga0070661_100380673 | 3300005344 | Bacteria | 1112 |
| 18 | Ga0070692_10095233 | 3300005345 | Bacteria | 1624 |
| 19 | Ga0070668_100540736 | 3300005347 | Bacteria | 1013 |
| 20 | Ga0070669_100002229 | 3300005353 | Bacteria | 14029 |
| 21 | Ga0070669_100092910 | 3300005353 | Bacteria | 2265 |
| 22 | Ga0070675_100028677 | 3300005354 | Bacteria | 4481 |
| 23 | Ga0070671_100093902 | 3300005355 | Bacteria | 2514 |
| 24 | Ga0070671_100361469 | 3300005355 | Bacteria | 1239 |
| 25 | Ga0070674_100004210 | 3300005356 | Bacteria | 8174 |
| 26 | Ga0070674_100384808 | 3300005356 | Bacteria | 1142 |
| 27 | Ga0070673_100062220 | 3300005364 | Bacteria | 2965 |
| 28 | Ga0070673_100366148 | 3300005364 | Bacteria | 1282 |
| 29 | Ga0070688_100037920 | 3300005365 | Bacteria | 2939 |
| 30 | Ga0070659_100247118 | 3300005366 | Bacteria | 1478 |
| 31 | Ga0070667_100077267 | 3300005367 | Bacteria | 2843 |
| 32 | Ga0070667_100138102 | 3300005367 | Bacteria | 2132 |
| 33 | Ga0070667_100258090 | 3300005367 | Bacteria | 1560 |
| 34 | Ga0070701_10146574 | 3300005438 | Bacteria | 1355 |
| 35 | Ga0070705_100451271 | 3300005440 | Bacteria | 965 |
| 36 | Ga0070700_100026640 | 3300005441 | Bacteria | 3417 |
| 37 | Ga0070700_100132659 | 3300005441 | Bacteria | 1683 |
| 38 | Ga0070694_100001301 | 3300005444 | Bacteria | 14520 |
| 39 | Ga0070694_100003139 | 3300005444 | Bacteria | 9839 |
| 40 | Ga0070694_100048433 | 3300005444 | Bacteria | 2859 |
| 41 | Ga0070694_100118761 | 3300005444 | Bacteria | 1895 |
| 42 | Ga0070708_100110351 | 3300005445 | Bacteria | 2527 |
| 43 | Ga0070708_100300204 | 3300005445 | Bacteria | 1512 |
| 44 | Ga0070663_100339118 | 3300005455 | Bacteria | 1214 |
| 45 | Ga0070663_100440053 | 3300005455 | Bacteria | 1072 |
| 46 | Ga0070678_100052632 | 3300005456 | Bacteria | 2957 |
| 47 | Ga0070678_100675894 | 3300005456 | Bacteria | 928 |
| 48 | Ga0070662_100041715 | 3300005457 | Bacteria | 3275 |
| 49 | Ga0070662_100563626 | 3300005457 | Bacteria | 955 |
| 50 | Ga0070681_10148915 | 3300005458 | Unclassified | 2268 |
| 51 | Ga0068867_100008378 | 3300005459 | Bacteria | 7292 |
| 52 | Ga0070706_100071507 | 3300005467 | Bacteria | 3209 |
| 53 | Ga0070706_100088604 | 3300005467 | Bacteria | 2869 |
| 54 | Ga0070707_100000608 | 3300005468 | Bacteria | 35992 |
| 55 | Ga0070707_100058450 | 3300005468 | Bacteria | 3698 |
| 56 | Ga0070698_100397239 | 3300005471 | Bacteria | 1312 |
| 57 | Ga0070684_100664539 | 3300005535 | Bacteria | 970 |
| 58 | Ga0070672_100060755 | 3300005543 | Bacteria | 2977 |
| 59 | Ga0070672_100160711 | 3300005543 | Bacteria | 1864 |
| 60 | Ga0070686_100389827 | 3300005544 | Bacteria | 1057 |
| 61 | Ga0070695_100136480 | 3300005545 | Bacteria | 1696 |
| 62 | Ga0070695_100174814 | 3300005545 | Bacteria | 1517 |
| 63 | Ga0070696_100393029 | 3300005546 | Bacteria | 1083 |
| 64 | Ga0070693_100122069 | 3300005547 | Unclassified | 1617 |
| 65 | Ga0070704_100018251 | 3300005549 | Bacteria | 4481 |
| 66 | Ga0070704_100125882 | 3300005549 | Unclassified | 1977 |
| 67 | Ga0070704_100924747 | 3300005549 | Bacteria | 785 |
| 68 | Ga0070664_100001167 | 3300005564 | Bacteria | 20855 |
| 69 | Ga0070664_100153956 | 3300005564 | Bacteria | 2030 |
| 70 | Ga0068857_100082062 | 3300005577 | Bacteria | 2880 |
| 71 | Ga0068857_100241277 | 3300005577 | Bacteria | 1655 |
| 72 | Ga0068854_100632036 | 3300005578 | Bacteria | 917 |
| 73 | Ga0070702_100033657 | 3300005615 | Bacteria | 2819 |
| 74 | Ga0068859_100087866 | 3300005617 | Bacteria | 3157 |
| 75 | Ga0068859_100479605 | 3300005617 | Bacteria | 1339 |
| 76 | Ga0068864_100055474 | 3300005618 | Bacteria | 3422 |
| 77 | Ga0068864_100234756 | 3300005618 | Bacteria | 1697 |
| 78 | Ga0068861_100043342 | 3300005719 | Unclassified | 3377 |
| 79 | Ga0068861_100382818 | 3300005719 | Bacteria | 1243 |
| 80 | Ga0068870_10043331 | 3300005840 | Bacteria | 2347 |
| 81 | Ga0068870_10065933 | 3300005840 | Bacteria | 1960 |
| 82 | Ga0068863_100029770 | 3300005841 | Bacteria | 5213 |
| 83 | Ga0068863_100350726 | 3300005841 | Bacteria | 1437 |
| 84 | Ga0068860_100109915 | 3300005843 | Bacteria | 2634 |
| 85 | Ga0068862_100007907 | 3300005844 | Bacteria | 8796 |
| 86 | Ga0068862_100028310 | 3300005844 | Bacteria | 4717 |
| 87 | Ga0068862_100044840 | 3300005844 | Bacteria | 3772 |
| 88 | Ga0068862_100445656 | 3300005844 | Bacteria | 1219 |
| 89 | Ga0081538_10064699 | 3300005981 | Bacteria | 2066 |
| 90 | Ga0075365_10072308 | 3300006038 | Bacteria | 2323 |
| 91 | Ga0075365_10097352 | 3300006038 | Bacteria | 2011 |
| 92 | Ga0075368_10015866 | 3300006042 | Bacteria | 2799 |
| 93 | Ga0075368_10019357 | 3300006042 | Bacteria | 2569 |
| 94 | Ga0075368_10024556 | 3300006042 | Bacteria | 2310 |
| 95 | Ga0075363_100031061 | 3300006048 | Bacteria | 2768 |
| 96 | Ga0075364_10006657 | 3300006051 | Bacteria | 6810 |
| 97 | Ga0075364_10007701 | 3300006051 | Bacteria | 6409 |
| 98 | Ga0075364_10008901 | 3300006051 | Bacteria | 6013 |
| 99 | Ga0070712_100034032 | 3300006175 | Bacteria | 3452 |
| 100 | Ga0075362_10001457 | 3300006177 | Bacteria | 7578 |
| 101 | Ga0075362_10004875 | 3300006177 | Bacteria | 4851 |
| 102 | Ga0075367_10004084 | 3300006178 | Bacteria | 7066 |
| 103 | Ga0075367_10005755 | 3300006178 | Bacteria | 6196 |
| 104 | Ga0075367_10019738 | 3300006178 | Bacteria | 3741 |
| 105 | Ga0075367_10021901 | 3300006178 | Bacteria | 3578 |
| 106 | Ga0075366_10000097 | 3300006195 | Bacteria | 35368 |
| 107 | Ga0075366_10004192 | 3300006195 | Bacteria | 7732 |
| 108 | Ga0075366_10014119 | 3300006195 | Bacteria | 4557 |
| 109 | Ga0075366_10042525 | 3300006195 | Bacteria | 2690 |
| 110 | Ga0075366_10076381 | 3300006195 | Bacteria | 1999 |
| 111 | Ga0075366_10174218 | 3300006195 | Bacteria | 1306 |
| 112 | Ga0097621_100744128 | 3300006237 | Bacteria | 905 |
| 113 | Ga0075370_10011138 | 3300006353 | Bacteria | 4717 |
| 114 | Ga0075370_10076310 | 3300006353 | Bacteria | 1922 |
| 115 | Ga0075428_100048696 | 3300006844 | Bacteria | 4651 |
| 116 | Ga0075428_100112046 | 3300006844 | Bacteria | 2972 |
| 117 | Ga0075428_100252277 | 3300006844 | Bacteria | 1901 |
| 118 | Ga0075428_100442914 | 3300006844 | Bacteria | 1391 |
| 119 | Ga0075428_100612088 | 3300006844 | Bacteria | 1163 |
| 120 | Ga0075428_100689610 | 3300006844 | Unclassified | 1088 |
| 121 | Ga0075428_100879918 | 3300006844 | Bacteria | 950 |
| 122 | Ga0075430_100163703 | 3300006846 | Bacteria | 1851 |
| 123 | Ga0075430_100168294 | 3300006846 | Bacteria | 1823 |
| 124 | Ga0075431_100016985 | 3300006847 | Bacteria | 7390 |
| 125 | Ga0075431_100018244 | 3300006847 | Bacteria | 7139 |
| 126 | Ga0075431_100087305 | 3300006847 | Bacteria | 3219 |
| 127 | Ga0075431_100091219 | 3300006847 | Bacteria | 3145 |
| 128 | Ga0075431_100248168 | 3300006847 | Unclassified | 1809 |
| 129 | Ga0075431_100268555 | 3300006847 | Bacteria | 1729 |
| 130 | Ga0075431_100275931 | 3300006847 | Bacteria | 1702 |
| 131 | Ga0075433_10021109 | 3300006852 | Bacteria | 5457 |
| 132 | Ga0075433_10112102 | 3300006852 | Bacteria | 2419 |
| 133 | Ga0075433_10139120 | 3300006852 | Bacteria | 2158 |
| 134 | Ga0075433_10884641 | 3300006852 | Unclassified | 779 |
| 135 | Ga0075434_100001020 | 3300006871 | Bacteria | 22799 |
| 136 | Ga0075434_100072373 | 3300006871 | Bacteria | 3439 |
| 137 | Ga0075429_100008186 | 3300006880 | Bacteria | 9088 |
| 138 | Ga0075429_100054743 | 3300006880 | Bacteria | 3470 |
| 139 | Ga0075429_100235262 | 3300006880 | Bacteria | 1605 |
| 140 | Ga0097620_100087873 | 3300006931 | Bacteria | 3157 |
| 141 | Ga0097620_100479543 | 3300006931 | Bacteria | 1339 |
| 142 | Ga0075435_100083551 | 3300007076 | Bacteria | 2626 |
| 143 | Ga0075435_100168618 | 3300007076 | Bacteria | 1847 |
| 144 | Ga0111539_10000386 | 3300009094 | Bacteria | 54473 |
| 145 | Ga0111539_10000877 | 3300009094 | Bacteria | 39291 |
| 146 | Ga0111539_10126329 | 3300009094 | Bacteria | 2996 |
| 147 | Ga0111539_10185833 | 3300009094 | Bacteria | 2427 |
| 148 | Ga0111539_10722407 | 3300009094 | Bacteria | 1159 |
| 149 | Ga0111539_11435667 | 3300009094 | Bacteria | 800 |
| 150 | Ga0105247_10111542 | 3300009101 | Unclassified | 1761 |
| 151 | Ga0114129_10004923 | 3300009147 | Bacteria | 18846 |
| 152 | Ga0114129_10013047 | 3300009147 | Bacteria | 11836 |
| 153 | Ga0114129_10045393 | 3300009147 | Bacteria | 6177 |
| 154 | Ga0114129_10060957 | 3300009147 | Bacteria | 5274 |
| 155 | Ga0114129_10079333 | 3300009147 | Bacteria | 4565 |
| 156 | Ga0114129_10090194 | 3300009147 | Bacteria | 4249 |
| 157 | Ga0114129_10134075 | 3300009147 | Bacteria | 3400 |
| 158 | Ga0114129_10218635 | 3300009147 | Bacteria | 2572 |
| 159 | Ga0114129_10953206 | 3300009147 | Bacteria | 1084 |
| 160 | Ga0105243_10004339 | 3300009148 | Bacteria | 11232 |
| 161 | Ga0105248_10017600 | 3300009177 | Bacteria | 7882 |
| 162 | Ga0105248_10098934 | 3300009177 | Unclassified | 3286 |
| 163 | Ga0105248_10300675 | 3300009177 | Bacteria | 1807 |
| 164 | Ga0105237_10000492 | 3300009545 | Bacteria | 55983 |
| 165 | Ga0105249_10000704 | 3300009553 | Bacteria | 30308 |
| 166 | Ga0105249_10344076 | 3300009553 | Bacteria | 1509 |
| 167 | Ga0105246_10106975 | 3300011119 | Bacteria | 2047 |
| 168 | Ga0105246_10178007 | 3300011119 | Bacteria | 1635 |
| 169 | Ga0157369_10155562 | 3300013105 | Bacteria | 2415 |
| 170 | Ga0163162_10431343 | 3300013306 | Bacteria | 1450 |
| 171 | Ga0157375_10054870 | 3300013308 | Bacteria | 3927 |
| 172 | Ga0157375_10141507 | 3300013308 | Bacteria | 2533 |
| 173 | Ga0163163_10097498 | 3300014325 | Bacteria | 2960 |
| 174 | Ga0163163_10345362 | 3300014325 | Bacteria | 1544 |
| 175 | Ga0163163_10854215 | 3300014325 | Bacteria | 973 |
| 176 | Ga0157380_10135142 | 3300014326 | Bacteria | 2110 |
| 177 | Ga0157380_10186679 | 3300014326 | Bacteria | 1827 |
| 178 | Ga0157377_10009003 | 3300014745 | Bacteria | 4887 |
| 179 | Ga0157379_10816807 | 3300014968 | Bacteria | 881 |
| 180 | Ga0224712_10085997 | 3300022467 | Bacteria | 1308 |
| 181 | Ga0207697_10070116 | 3300025315 | Bacteria | 1468 |
| 182 | Ga0207682_10016200 | 3300025893 | Bacteria | 2905 |
| 183 | Ga0207680_10013302 | 3300025903 | Bacteria | 4224 |
| 184 | Ga0207643_10078379 | 3300025908 | Bacteria | 1911 |
| 185 | Ga0207643_10079460 | 3300025908 | Bacteria | 1898 |
| 186 | Ga0207684_10043139 | 3300025910 | Bacteria | 3823 |
| 187 | Ga0207684_10060132 | 3300025910 | Bacteria | 3227 |
| 188 | Ga0207684_10149237 | 3300025910 | Unclassified | 2011 |
| 189 | Ga0207684_10160371 | 3300025910 | Bacteria | 1937 |
| 190 | Ga0207684_10170494 | 3300025910 | Bacteria | 1876 |
| 191 | Ga0207695_10223347 | 3300025913 | Bacteria | 1790 |
| 192 | Ga0207671_10000458 | 3300025914 | Bacteria | 55979 |
| 193 | Ga0207693_10016107 | 3300025915 | Bacteria | 5983 |
| 194 | Ga0207662_10002132 | 3300025918 | Bacteria | 9844 |
| 195 | Ga0207649_10492353 | 3300025920 | Bacteria | 931 |
| 196 | Ga0207646_10000989 | 3300025922 | Bacteria | 36524 |
| 197 | Ga0207681_10024072 | 3300025923 | Bacteria | 3903 |
| 198 | Ga0207681_10084977 | 3300025923 | Bacteria | 2245 |
| 199 | Ga0207650_10002488 | 3300025925 | Bacteria | 12814 |
| 200 | Ga0207650_10039230 | 3300025925 | Bacteria | 3461 |
| 201 | Ga0207650_10072581 | 3300025925 | Bacteria | 2590 |
| 202 | Ga0207650_10074394 | 3300025925 | Bacteria | 2560 |
| 203 | Ga0207650_10326112 | 3300025925 | Bacteria | 1258 |
| 204 | Ga0207659_10025830 | 3300025926 | Bacteria | 3953 |
| 205 | Ga0207659_10443357 | 3300025926 | Bacteria | 1092 |
| 206 | Ga0207644_10092378 | 3300025931 | Bacteria | 2258 |
| 207 | Ga0207644_10125987 | 3300025931 | Bacteria | 1955 |
| 208 | Ga0207690_10107000 | 3300025932 | Unclassified | 2008 |
| 209 | Ga0207706_10331631 | 3300025933 | Bacteria | 1324 |
| 210 | Ga0207706_10335996 | 3300025933 | Bacteria | 1314 |
| 211 | Ga0207709_10052296 | 3300025935 | Bacteria | 2508 |
| 212 | Ga0207670_10042043 | 3300025936 | Bacteria | 3009 |
| 213 | Ga0207669_10097731 | 3300025937 | Bacteria | 1932 |
| 214 | Ga0207691_10052332 | 3300025940 | Bacteria | 3730 |
| 215 | Ga0207691_10085038 | 3300025940 | Bacteria | 2839 |
| 216 | Ga0207691_10403909 | 3300025940 | Bacteria | 1165 |
| 217 | Ga0207711_10059915 | 3300025941 | Bacteria | 3279 |
| 218 | Ga0207689_10061646 | 3300025942 | Bacteria | 3085 |
| 219 | Ga0207689_10099525 | 3300025942 | Bacteria | 2389 |
| 220 | Ga0207661_10007488 | 3300025944 | Bacteria | 7766 |
| 221 | Ga0207679_10055921 | 3300025945 | Bacteria | 2911 |
| 222 | Ga0207679_10127257 | 3300025945 | Bacteria | 2038 |
| 223 | Ga0207679_10132602 | 3300025945 | Bacteria | 2001 |
| 224 | Ga0207679_10375597 | 3300025945 | Bacteria | 1245 |
| 225 | Ga0207679_10634131 | 3300025945 | Bacteria | 965 |
| 226 | Ga0207712_10289420 | 3300025961 | Bacteria | 1340 |
| 227 | Ga0207658_10294641 | 3300025986 | Bacteria | 1396 |
| 228 | Ga0207677_10180603 | 3300026023 | Bacteria | 1659 |
| 229 | Ga0207678_10009479 | 3300026067 | Bacteria | 8564 |
| 230 | Ga0207678_10127148 | 3300026067 | Bacteria | 2174 |
| 231 | Ga0207708_10021461 | 3300026075 | Bacteria | 4870 |
| 232 | Ga0207708_10175790 | 3300026075 | Bacteria | 1698 |
| 233 | Ga0207641_10092948 | 3300026088 | Bacteria | 2643 |
| 234 | Ga0207641_10321792 | 3300026088 | Bacteria | 1467 |
| 235 | Ga0207648_10002617 | 3300026089 | Bacteria | 19279 |
| 236 | Ga0207676_10098814 | 3300026095 | Bacteria | 2414 |
| 237 | Ga0207674_10032580 | 3300026116 | Bacteria | 5464 |
| 238 | Ga0207674_10092394 | 3300026116 | Bacteria | 3016 |
| 239 | Ga0207675_100030687 | 3300026118 | Bacteria | 5006 |
| 240 | Ga0207675_100078992 | 3300026118 | Bacteria | 3083 |
| 241 | Ga0207683_10013306 | 3300026121 | Bacteria | 7014 |
| 242 | Ga0207683_10141634 | 3300026121 | Bacteria | 2167 |
| 243 | Ga0207683_10412751 | 3300026121 | Unclassified | 1243 |
| 244 | Ga0209813_10014649 | 3300027866 | Bacteria | 2114 |
| 245 | Ga0209813_10052159 | 3300027866 | Bacteria | 1282 |
| 246 | Ga0207428_10000151 | 3300027907 | Bacteria | 94421 |
| 247 | Ga0207428_10006372 | 3300027907 | Bacteria | 10915 |
| 248 | Ga0207428_10022436 | 3300027907 | Bacteria | 5328 |
| 249 | Ga0207428_10267299 | 3300027907 | Bacteria | 1272 |
| 250 | Ga0268266_10081539 | 3300028379 | Bacteria | 2821 |
| 251 | Ga0268266_10276305 | 3300028379 | Bacteria | 1561 |
| 252 | Ga0268265_10321336 | 3300028380 | Bacteria | 1402 |
| 253 | Ga0268265_10645250 | 3300028380 | Bacteria | 1017 |
| 254 | Ga0307409_100408717 | 3300031995 | Bacteria | 1299 |
| 255 | Ga0307409_100612181 | 3300031995 | Bacteria | 1078 |
| 256 | Ga0307411_10491459 | 3300032005 | Bacteria | 1036 |
| 257 | Ga0373954_0235625 | 3300035118 | Bacteria | 901 |
| 258 | Ga0373943_0145963 | 3300035170 | Bacteria | 1278 |
| 259 | Ga0373931_0198498 | 3300035691 | Bacteria | 1197 |
| 260 | Ga0373927_0002329 | 3300035695 | Bacteria | 13873 |
| 261 | Ga0373947_0434352 | 3300035725 | Bacteria | 888 |
| 262 | Ga0373925_0000015 | 3300037068 | Bacteria | 178076 |
| 263 | Ga0395900_0762720 | 3300037418 | Bacteria | 897 |
| 264 | Ga0436365_1800696 | 3300039437 | Bacteria | 1777 |
| 265 | Ga0451797_0488507 | 3300041453 | Bacteria | 1158 |
| 266 | Ga0439441_056358 | 3300042001 | Unclassified | 820 |
| 267 | Ga0439446_0009553 | 3300042156 | Bacteria | 2599 |
| 268 | Ga0450908_026739 | 3300042184 | Bacteria | 1006 |
| 269 | Ga0439435_0020248 | 3300042436 | Bacteria | 1714 |
| 270 | Ga0439435_0051110 | 3300042436 | Unclassified | 1183 |
| 271 | Ga0439435_0094391 | 3300042436 | Bacteria | 912 |
| 272 | Ga0439464_0106189 | 3300042439 | Bacteria | 856 |
| 273 | Ga0453683_0089711 | 3300044673 | Unclassified | 1927 |
| 274 | Ga0495669_0074345 | 3300046684 | Bacteria | 1553 |
| 275 | Ga0496100_0053353 | 3300048903 | Bacteria | 2633 |
| 276 | Ga0496102_0079393 | 3300048905 | Bacteria | 3022 |
| 277 | Ga0496102_0505641 | 3300048905 | Bacteria | 1131 |
| 278 | Ga0496103_0241018 | 3300048906 | Bacteria | 1163 |
| 279 | Ga0496104_0061901 | 3300048907 | Bacteria | 3548 |
| 280 | Ga0496104_0273719 | 3300048907 | Bacteria | 1601 |
| 281 | Ga0496105_0057327 | 3300048908 | Bacteria | 3217 |
| 282 | Ga0496106_0237011 | 3300048909 | Bacteria | 1458 |
| 283 | Ga0496108_0006586 | 3300048911 | Bacteria | 9422 |
| 284 | Ga0496108_0185860 | 3300048911 | Bacteria | 1800 |
| 285 | Ga0496109_0000094 | 3300048912 | Bacteria | 92002 |
| 286 | Ga0496109_0030111 | 3300048912 | Bacteria | 4864 |
| 287 | Ga0496110_0002338 | 3300048913 | Bacteria | 14184 |
| 288 | Ga0496111_0007585 | 3300048914 | Bacteria | 7124 |
| 289 | Ga0496112_0027331 | 3300048915 | Bacteria | 5501 |
| 290 | Ga0496112_0096150 | 3300048915 | Bacteria | 2932 |
| 291 | Ga0496112_0175543 | 3300048915 | Bacteria | 2107 |
| 292 | Ga0496113_0056811 | 3300048916 | Bacteria | 2940 |
| 293 | Ga0501034_0011998 | 3300049571 | Bacteria | 8954 |
| 294 | Ga0501034_0055937 | 3300049571 | Bacteria | 3970 |
| 295 | Ga0501036_0207766 | 3300049572 | Bacteria | 1646 |
| 296 | Ga0501037_0001607 | 3300049573 | Bacteria | 16419 |
| 297 | Ga0501038_0120957 | 3300049574 | Bacteria | 2159 |
| 298 | Ga0501040_0305495 | 3300049576 | Bacteria | 1137 |
| 299 | Ga0501041_0061963 | 3300049577 | Bacteria | 2290 |
| 300 | Ga0501047_0060943 | 3300049581 | Bacteria | 3640 |
| 301 | Ga0501071_0076551 | 3300049587 | Bacteria | 2444 |
| 302 | Ga0501072_0006909 | 3300049588 | Bacteria | 8614 |
| 303 | Ga0501076_0013067 | 3300049592 | Bacteria | 6217 |
| 304 | Ga0501079_0023513 | 3300049741 | Bacteria | 4729 |
| 305 | Ga0501080_0168353 | 3300049742 | Bacteria | 2022 |
| 306 | Ga0501080_0168808 | 3300049742 | Bacteria | 2019 |
| 307 | Ga0501045_0073565 | 3300049824 | Bacteria | 2517 |
| 308 | Ga0501045_0196039 | 3300049824 | Bacteria | 1505 |
| 309 | nmdc:mga03683_10372_c1 | 3300050489 | Bacteria | 3340 |
| 310 | nmdc:mga03n38_30127_c1 | 3300050490 | Bacteria | 2278 |
| 311 | nmdc:mga00v17_160636_c1 | 3300050491 | Bacteria | 1446 |
| 312 | nmdc:mga00v17_192124_c1 | 3300050491 | Bacteria | 1319 |
| 313 | nmdc:mga00v17_211151_c1 | 3300050491 | Bacteria | 1256 |
| 314 | nmdc:mga00v17_34443_c1 | 3300050491 | Bacteria | 3008 |
| 315 | nmdc:mga00v17_45343_c1 | 3300050491 | Bacteria | 2656 |
| 316 | nmdc:mga0yw44_111584_c1 | 3300050492 | Bacteria | 1753 |
| 317 | nmdc:mga0yw44_31850_c1 | 3300050492 | Bacteria | 3069 |
| 318 | nmdc:mga0yw44_427529_c1 | 3300050492 | Archaea | 897 |
| 319 | nmdc:mga0k408_3855_c1 | 3300050493 | Bacteria | 7949 |
| 320 | nmdc:mga0k408_45750_c1 | 3300050493 | Bacteria | 2526 |
| 321 | nmdc:mga0k408_614_c1 | 3300050493 | Bacteria | 19654 |
| 322 | nmdc:mga06z11_245014_c1 | 3300050494 | Archaea | 1054 |
| 323 | nmdc:mga06z11_8573_c1 | 3300050494 | Bacteria | 4273 |
| 324 | nmdc:mga04h51_11146_c1 | 3300050495 | Bacteria | 2488 |
| 325 | nmdc:mga04h51_74879_c1 | 3300050495 | Bacteria | 1190 |
| 326 | nmdc:mga07m45_24240_c1 | 3300050496 | Bacteria | 3322 |
| 327 | nmdc:mga07m45_26580_c1 | 3300050496 | Bacteria | 3182 |
| 328 | nmdc:mga05p37_204593_c1 | 3300050507 | Bacteria | 2389 |
| 329 | nmdc:mga05p37_21577_c1 | 3300050507 | Bacteria | 7803 |
| 330 | nmdc:mga05p37_257540_c1 | 3300050507 | Bacteria | 2090 |
| 331 | nmdc:mga05p37_380155_c1 | 3300050507 | Bacteria | 1655 |
| 332 | nmdc:mga05p37_642_c1 | 3300050507 | Bacteria | 38709 |
| 333 | nmdc:mga05p37_64590_c1 | 3300050507 | Bacteria | 4504 |
| 334 | nmdc:mga05p37_755_c2 | 3300050507 | Bacteria | 10169 |
| 335 | nmdc:mga09592_120618_c1 | 3300050508 | Bacteria | 2252 |
| 336 | nmdc:mga09592_185469_c1 | 3300050508 | Bacteria | 1800 |
| 337 | nmdc:mga09592_225547_c1 | 3300050508 | Bacteria | 1623 |
| 338 | nmdc:mga09592_418912_c1 | 3300050508 | Bacteria | 1157 |
| 339 | nmdc:mga09592_42577_c2 | 3300050508 | Bacteria | 2357 |
| 340 | nmdc:mga09592_65748_c1 | 3300050508 | Bacteria | 3072 |
| 341 | nmdc:mga0qj67_167735_c1 | 3300050509 | Bacteria | 1782 |
| 342 | nmdc:mga0qj67_75624_c1 | 3300050509 | Bacteria | 2692 |
| 343 | nmdc:mga06r32_10471_c1 | 3300050510 | Bacteria | 8364 |
| 344 | nmdc:mga06r32_135731_c1 | 3300050510 | Bacteria | 2435 |
| 345 | nmdc:mga06r32_14149_c1 | 3300050510 | Bacteria | 7236 |
| 346 | nmdc:mga06r32_26105_c1 | 3300050510 | Bacteria | 5442 |
| 347 | nmdc:mga06r32_304004_c1 | 3300050510 | Bacteria | 1581 |
| 348 | nmdc:mga06r32_680401_c1 | 3300050510 | Bacteria | 995 |
| 349 | nmdc:mga06r32_81443_c1 | 3300050510 | Bacteria | 3152 |
| 350 | nmdc:mga08y16_174_c1 | 3300050511 | Bacteria | 56593 |
| 351 | nmdc:mga08y16_176727_c1 | 3300050511 | Bacteria | 2217 |
| 352 | nmdc:mga08y16_19484_c1 | 3300050511 | Bacteria | 7152 |
| 353 | nmdc:mga08y16_214870_c1 | 3300050511 | Bacteria | 1991 |
| 354 | nmdc:mga08y16_292594_c1 | 3300050511 | Bacteria | 1679 |
| 355 | nmdc:mga08y16_381810_c1 | 3300050511 | Bacteria | 1444 |
| 356 | nmdc:mga08y16_4950_c1 | 3300050511 | Bacteria | 13918 |
| 357 | nmdc:mga0n895_7344_c1 | 3300050512 | Bacteria | 9453 |
| 358 | nmdc:mga0n895_76627_c1 | 3300050512 | Bacteria | 3325 |
| 359 | nmdc:mga0n895_90091_c1 | 3300050512 | Unclassified | 3068 |
| 360 | nmdc:mga0rr50_181356_c1 | 3300050513 | Bacteria | 1721 |
| 361 | nmdc:mga0rr50_486337_c1 | 3300050513 | Bacteria | 1048 |
| 362 | nmdc:mga08x19_262546_c1 | 3300050514 | Bacteria | 1194 |
| 363 | nmdc:mga0a205_130132_c1 | 3300050515 | Bacteria | 2417 |
| 364 | nmdc:mga0a205_13632_c1 | 3300050515 | Bacteria | 7571 |
| 365 | nmdc:mga0a205_214314_c1 | 3300050515 | Unclassified | 1813 |
| 366 | nmdc:mga0a205_27370_c1 | 3300050515 | Bacteria | 5446 |
| 367 | nmdc:mga0sz30_88777_c1 | 3300050516 | Bacteria | 1343 |
| 368 | Ga0500610_0241738 | 3300053079 | Bacteria | 839 |
| 369 | Ga0495619_0079210 | 3300053085 | Bacteria | 2210 |
| 370 | Ga0500641_0001025 | 3300053096 | Bacteria | 9935 |
| 371 | Ga0500555_001074 | 3300053103 | Bacteria | 9174 |
| 372 | Ga0500555_027736 | 3300053103 | Bacteria | 1614 |
| 373 | Ga0500616_0000226 | 3300053153 | Bacteria | 88101 |
| 374 | Ga0500611_052757 | 3300053727 | Bacteria | 937 |
| 375 | Ga0500645_000268 | 3300053730 | Bacteria | 37551 |
| 376 | Ga0590071_000246 | 3300059421 | Bacteria | 15808 |
| 377 | Ga0590075_000041 | 3300059424 | Bacteria | 33435 |
| 378 | Ga0590077_000962 | 3300059426 | Bacteria | 7340 |
| 379 | Ga0590077_001465 | 3300059426 | Bacteria | 5516 |
| 380 | Ga0530510_0685152 | 3300061734 | Unclassified | 781 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100110351 | Ga0070708_1001103513 | 205 |
| 2 | 3300050510 | nmdc:mga06r32_680401_c1 | nmdc:mga06r32_680401_c1_269_973 | 211 |
| 3 | 3300005356 | Ga0070674_100384808 | Ga0070674_1003848081 | 212 |
| 4 | 3300042436 | Ga0439435_0051110 | Ga0439435_0051110_511_1170 | 212 |
| 5 | 3300005444 | Ga0070694_100003139 | Ga0070694_1000031394 | 213 |
| 6 | 3300005549 | Ga0070704_100018251 | Ga0070704_1000182513 | 213 |
| 7 | 3300005549 | Ga0070704_100924747 | Ga0070704_1009247471 | 214 |
| 8 | 3300006844 | Ga0075428_100612088 | Ga0075428_1006120882 | 214 |
| 9 | 3300009147 | Ga0114129_10060957 | Ga0114129_100609573 | 214 |
| 10 | 3300049571 | Ga0501034_0011998 | Ga0501034_0011998_6465_7199 | 214 |
| 11 | 3300049573 | Ga0501037_0001607 | Ga0501037_0001607_10533_11267 | 214 |
| 12 | 3300049574 | Ga0501038_0120957 | Ga0501038_0120957_501_1235 | 214 |
| 13 | 3300049581 | Ga0501047_0060943 | Ga0501047_0060943_131_865 | 214 |
| 14 | 3300050507 | nmdc:mga05p37_204593_c1 | nmdc:mga05p37_204593_c1_388_1068 | 214 |
| 15 | 3300005345 | Ga0070692_10095233 | Ga0070692_100952332 | 215 |
| 16 | 3300005438 | Ga0070701_10146574 | Ga0070701_101465742 | 215 |
| 17 | 3300005440 | Ga0070705_100451271 | Ga0070705_1004512712 | 215 |
| 18 | 3300005444 | Ga0070694_100118761 | Ga0070694_1001187612 | 215 |
| 19 | 3300005545 | Ga0070695_100136480 | Ga0070695_1001364802 | 215 |
| 20 | 3300005577 | Ga0068857_100082062 | Ga0068857_1000820623 | 215 |
| 21 | 3300005617 | Ga0068859_100087866 | Ga0068859_1000878663 | 215 |
| 22 | 3300005719 | Ga0068861_100043342 | Ga0068861_1000433422 | 215 |
| 23 | 3300005840 | Ga0068870_10043331 | Ga0068870_100433312 | 215 |
| 24 | 3300005844 | Ga0068862_100044840 | Ga0068862_1000448403 | 215 |
| 25 | 3300006931 | Ga0097620_100087873 | Ga0097620_1000878733 | 215 |
| 26 | 3300025908 | Ga0207643_10078379 | Ga0207643_100783792 | 215 |
| 27 | 3300026116 | Ga0207674_10092394 | Ga0207674_100923942 | 215 |
| 28 | 3300006847 | Ga0075431_100268555 | Ga0075431_1002685552 | 217 |
| 29 | 3300048907 | Ga0496104_0273719 | Ga0496104_0273719_349_1047 | 218 |
| 30 | 3300048915 | Ga0496112_0027331 | Ga0496112_0027331_1869_2567 | 218 |
| 31 | 3300005445 | Ga0070708_100300204 | Ga0070708_1003002041 | 219 |
| 32 | 3300005468 | Ga0070707_100058450 | Ga0070707_1000584504 | 219 |
| 33 | 3300005471 | Ga0070698_100397239 | Ga0070698_1003972392 | 219 |
| 34 | 3300006847 | Ga0075431_100248168 | Ga0075431_1002481682 | 219 |
| 35 | 3300061734 | Ga0530510_0685152 | Ga0530510_0685152_48_737 | 219 |
| 36 | 3300005331 | Ga0070670_100002006 | Ga0070670_10000200610 | 220 |
| 37 | 3300005458 | Ga0070681_10148915 | Ga0070681_101489152 | 220 |
| 38 | 3300005547 | Ga0070693_100122069 | Ga0070693_1001220692 | 220 |
| 39 | 3300006844 | Ga0075428_100112046 | Ga0075428_1001120463 | 220 |
| 40 | 3300006846 | Ga0075430_100163703 | Ga0075430_1001637033 | 220 |
| 41 | 3300006847 | Ga0075431_100018244 | Ga0075431_1000182445 | 220 |
| 42 | 3300006880 | Ga0075429_100008186 | Ga0075429_1000081868 | 220 |
| 43 | 3300009147 | Ga0114129_10004923 | Ga0114129_100049239 | 220 |
| 44 | 3300025925 | Ga0207650_10002488 | Ga0207650_100024885 | 220 |
| 45 | 3300025932 | Ga0207690_10107000 | Ga0207690_101070002 | 220 |
| 46 | 3300042436 | Ga0439435_0020248 | Ga0439435_0020248_931_1623 | 220 |
| 47 | 3300050507 | nmdc:mga05p37_257540_c1 | nmdc:mga05p37_257540_c1_874_1566 | 220 |
| 48 | 3300050507 | nmdc:mga05p37_755_c2 | nmdc:mga05p37_755_c2_2877_3569 | 220 |
| 49 | 3300050508 | nmdc:mga09592_42577_c2 | nmdc:mga09592_42577_c2_755_1447 | 220 |
| 50 | 3300050509 | nmdc:mga0qj67_75624_c1 | nmdc:mga0qj67_75624_c1_1859_2551 | 220 |
| 51 | 3300050510 | nmdc:mga06r32_14149_c1 | nmdc:mga06r32_14149_c1_2168_2860 | 220 |
| 52 | 3300050511 | nmdc:mga08y16_381810_c1 | nmdc:mga08y16_381810_c1_449_1141 | 220 |
| 53 | 3300053096 | Ga0500641_0001025 | Ga0500641_0001025_4436_5167 | 220 |
| 54 | 3300005353 | Ga0070669_100092910 | Ga0070669_1000929102 | 221 |
| 55 | 3300005364 | Ga0070673_100366148 | Ga0070673_1003661482 | 221 |
| 56 | 3300005366 | Ga0070659_100247118 | Ga0070659_1002471181 | 221 |
| 57 | 3300005456 | Ga0070678_100675894 | Ga0070678_1006758942 | 221 |
| 58 | 3300005981 | Ga0081538_10064699 | Ga0081538_100646992 | 221 |
| 59 | 3300006844 | Ga0075428_100689610 | Ga0075428_1006896102 | 221 |
| 60 | 3300006847 | Ga0075431_100087305 | Ga0075431_1000873053 | 221 |
| 61 | 3300006847 | Ga0075431_100091219 | Ga0075431_1000912192 | 221 |
| 62 | 3300025933 | Ga0207706_10331631 | Ga0207706_103316311 | 221 |
| 63 | 3300037418 | Ga0395900_0762720 | Ga0395900_0762720_148_852 | 221 |
| 64 | 3300042436 | Ga0439435_0094391 | Ga0439435_0094391_112_822 | 221 |
| 65 | 3300042439 | Ga0439464_0106189 | Ga0439464_0106189_57_776 | 221 |
| 66 | 3300048905 | Ga0496102_0079393 | Ga0496102_0079393_469_1182 | 221 |
| 67 | 3300048906 | Ga0496103_0241018 | Ga0496103_0241018_182_895 | 221 |
| 68 | 3300048911 | Ga0496108_0185860 | Ga0496108_0185860_37_750 | 221 |
| 69 | 3300049576 | Ga0501040_0305495 | Ga0501040_0305495_376_1125 | 221 |
| 70 | 3300049588 | Ga0501072_0006909 | Ga0501072_0006909_4011_4757 | 221 |
| 71 | 3300049592 | Ga0501076_0013067 | Ga0501076_0013067_2024_2773 | 221 |
| 72 | 3300049741 | Ga0501079_0023513 | Ga0501079_0023513_134_883 | 221 |
| 73 | 3300049742 | Ga0501080_0168808 | Ga0501080_0168808_60_806 | 221 |
| 74 | 3300049824 | Ga0501045_0073565 | Ga0501045_0073565_1125_1871 | 221 |
| 75 | 3300050508 | nmdc:mga09592_225547_c1 | nmdc:mga09592_225547_c1_201_902 | 221 |
| 76 | 3300050510 | nmdc:mga06r32_135731_c1 | nmdc:mga06r32_135731_c1_1239_1958 | 221 |
| 77 | 3300050510 | nmdc:mga06r32_81443_c1 | nmdc:mga06r32_81443_c1_890_1606 | 221 |
| 78 | 3300059421 | Ga0590071_000246 | Ga0590071_000246_11537_12256 | 221 |
| 79 | 3300059424 | Ga0590075_000041 | Ga0590075_000041_13996_14715 | 221 |
| 80 | 3300059426 | Ga0590077_001465 | Ga0590077_001465_1073_1792 | 221 |
| 81 | 3300005329 | Ga0070683_100044444 | Ga0070683_1000444443 | 222 |
| 82 | 3300005331 | Ga0070670_100004508 | Ga0070670_1000045082 | 222 |
| 83 | 3300005335 | Ga0070666_10089263 | Ga0070666_100892632 | 222 |
| 84 | 3300005337 | Ga0070682_100121666 | Ga0070682_1001216662 | 222 |
| 85 | 3300005344 | Ga0070661_100005089 | Ga0070661_1000050894 | 222 |
| 86 | 3300005347 | Ga0070668_100540736 | Ga0070668_1005407362 | 222 |
| 87 | 3300005355 | Ga0070671_100093902 | Ga0070671_1000939023 | 222 |
| 88 | 3300005367 | Ga0070667_100077267 | Ga0070667_1000772673 | 222 |
| 89 | 3300005457 | Ga0070662_100563626 | Ga0070662_1005636261 | 222 |
| 90 | 3300005535 | Ga0070684_100664539 | Ga0070684_1006645392 | 222 |
| 91 | 3300005543 | Ga0070672_100060755 | Ga0070672_1000607551 | 222 |
| 92 | 3300005546 | Ga0070696_100393029 | Ga0070696_1003930292 | 222 |
| 93 | 3300005564 | Ga0070664_100001167 | Ga0070664_1000011676 | 222 |
| 94 | 3300005618 | Ga0068864_100234756 | Ga0068864_1002347561 | 222 |
| 95 | 3300006852 | Ga0075433_10884641 | Ga0075433_108846411 | 222 |
| 96 | 3300007076 | Ga0075435_100083551 | Ga0075435_1000835512 | 222 |
| 97 | 3300009177 | Ga0105248_10017600 | Ga0105248_100176008 | 222 |
| 98 | 3300009553 | Ga0105249_10344076 | Ga0105249_103440763 | 222 |
| 99 | 3300014325 | Ga0163163_10097498 | Ga0163163_100974982 | 222 |
| 100 | 3300014968 | Ga0157379_10816807 | Ga0157379_108168071 | 222 |
| 101 | 3300025903 | Ga0207680_10013302 | Ga0207680_100133023 | 222 |
| 102 | 3300025920 | Ga0207649_10492353 | Ga0207649_104923532 | 222 |
| 103 | 3300025925 | Ga0207650_10074394 | Ga0207650_100743943 | 222 |
| 104 | 3300025931 | Ga0207644_10125987 | Ga0207644_101259872 | 222 |
| 105 | 3300025940 | Ga0207691_10085038 | Ga0207691_100850384 | 222 |
| 106 | 3300025941 | Ga0207711_10059915 | Ga0207711_100599155 | 222 |
| 107 | 3300025944 | Ga0207661_10007488 | Ga0207661_100074886 | 222 |
| 108 | 3300025945 | Ga0207679_10055921 | Ga0207679_100559213 | 222 |
| 109 | 3300026095 | Ga0207676_10098814 | Ga0207676_100988143 | 222 |
| 110 | 3300032005 | Ga0307411_10491459 | Ga0307411_104914591 | 222 |
| 111 | 3300048903 | Ga0496100_0053353 | Ga0496100_0053353_195_923 | 222 |
| 112 | 3300048905 | Ga0496102_0505641 | Ga0496102_0505641_272_1000 | 222 |
| 113 | 3300048907 | Ga0496104_0061901 | Ga0496104_0061901_1542_2270 | 222 |
| 114 | 3300048908 | Ga0496105_0057327 | Ga0496105_0057327_2061_2789 | 222 |
| 115 | 3300048911 | Ga0496108_0006586 | Ga0496108_0006586_1339_2067 | 222 |
| 116 | 3300048912 | Ga0496109_0030111 | Ga0496109_0030111_1286_2014 | 222 |
| 117 | 3300048913 | Ga0496110_0002338 | Ga0496110_0002338_10269_10997 | 222 |
| 118 | 3300048914 | Ga0496111_0007585 | Ga0496111_0007585_5750_6478 | 222 |
| 119 | 3300048915 | Ga0496112_0096150 | Ga0496112_0096150_2001_2729 | 222 |
| 120 | 3300048916 | Ga0496113_0056811 | Ga0496113_0056811_493_1221 | 222 |
| 121 | 3300050512 | nmdc:mga0n895_90091_c1 | nmdc:mga0n895_90091_c1_1852_2553 | 222 |
| 122 | 3300050514 | nmdc:mga08x19_262546_c1 | nmdc:mga08x19_262546_c1_348_1043 | 222 |
| 123 | 3300006871 | Ga0075434_100001020 | Ga0075434_10000102016 | 223 |
| 124 | 3300026121 | Ga0207683_10412751 | Ga0207683_104127512 | 223 |
| 125 | 3300050512 | nmdc:mga0n895_7344_c1 | nmdc:mga0n895_7344_c1_1315_2022 | 223 |
| 126 | 3300050515 | nmdc:mga0a205_214314_c1 | nmdc:mga0a205_214314_c1_849_1556 | 223 |
| 127 | 3300006844 | Ga0075428_100442914 | Ga0075428_1004429142 | 224 |
| 128 | 3300006844 | Ga0075428_100879918 | Ga0075428_1008799182 | 224 |
| 129 | 3300006847 | Ga0075431_100016985 | Ga0075431_1000169855 | 224 |
| 130 | 3300006847 | Ga0075431_100275931 | Ga0075431_1002759312 | 224 |
| 131 | 3300009147 | Ga0114129_10090194 | Ga0114129_100901942 | 224 |
| 132 | 3300027907 | Ga0207428_10006372 | Ga0207428_100063725 | 224 |
| 133 | 3300042184 | Ga0450908_026739 | Ga0450908_026739_53_763 | 224 |
| 134 | 3300048912 | Ga0496109_0000094 | Ga0496109_0000094_11507_12199 | 224 |
| 135 | 3300050507 | nmdc:mga05p37_21577_c1 | nmdc:mga05p37_21577_c1_91_783 | 224 |
| 136 | 3300050507 | nmdc:mga05p37_380155_c1 | nmdc:mga05p37_380155_c1_226_918 | 224 |
| 137 | 3300050508 | nmdc:mga09592_65748_c1 | nmdc:mga09592_65748_c1_587_1279 | 224 |
| 138 | 3300050510 | nmdc:mga06r32_26105_c1 | nmdc:mga06r32_26105_c1_312_1004 | 224 |
| 139 | 3300050510 | nmdc:mga06r32_304004_c1 | nmdc:mga06r32_304004_c1_655_1347 | 224 |
| 140 | 3300050511 | nmdc:mga08y16_4950_c1 | nmdc:mga08y16_4950_c1_7459_8151 | 224 |
| 141 | 3300050513 | nmdc:mga0rr50_486337_c1 | nmdc:mga0rr50_486337_c1_226_918 | 224 |
| 142 | 3300053079 | Ga0500610_0241738 | Ga0500610_0241738_93_785 | 224 |
| 143 | 3300053103 | Ga0500555_027736 | Ga0500555_027736_388_1080 | 224 |
| 144 | 3300053727 | Ga0500611_052757 | Ga0500611_052757_47_739 | 224 |
| 145 | 3300005334 | Ga0068869_100132083 | Ga0068869_1001320832 | 225 |
| 146 | 3300005344 | Ga0070661_100249627 | Ga0070661_1002496272 | 225 |
| 147 | 3300005355 | Ga0070671_100361469 | Ga0070671_1003614692 | 225 |
| 148 | 3300005364 | Ga0070673_100062220 | Ga0070673_1000622202 | 225 |
| 149 | 3300005367 | Ga0070667_100258090 | Ga0070667_1002580902 | 225 |
| 150 | 3300005441 | Ga0070700_100132659 | Ga0070700_1001326592 | 225 |
| 151 | 3300005444 | Ga0070694_100001301 | Ga0070694_10000130116 | 225 |
| 152 | 3300005455 | Ga0070663_100440053 | Ga0070663_1004400531 | 225 |
| 153 | 3300005467 | Ga0070706_100088604 | Ga0070706_1000886042 | 225 |
| 154 | 3300005468 | Ga0070707_100000608 | Ga0070707_1000006084 | 225 |
| 155 | 3300005543 | Ga0070672_100160711 | Ga0070672_1001607111 | 225 |
| 156 | 3300005544 | Ga0070686_100389827 | Ga0070686_1003898272 | 225 |
| 157 | 3300005545 | Ga0070695_100174814 | Ga0070695_1001748142 | 225 |
| 158 | 3300005549 | Ga0070704_100125882 | Ga0070704_1001258822 | 225 |
| 159 | 3300005564 | Ga0070664_100153956 | Ga0070664_1001539561 | 225 |
| 160 | 3300005618 | Ga0068864_100055474 | Ga0068864_1000554742 | 225 |
| 161 | 3300005840 | Ga0068870_10065933 | Ga0068870_100659333 | 225 |
| 162 | 3300005841 | Ga0068863_100350726 | Ga0068863_1003507262 | 225 |
| 163 | 3300006042 | Ga0075368_10015866 | Ga0075368_100158663 | 225 |
| 164 | 3300006042 | Ga0075368_10019357 | Ga0075368_100193573 | 225 |
| 165 | 3300006175 | Ga0070712_100034032 | Ga0070712_1000340322 | 225 |
| 166 | 3300006195 | Ga0075366_10004192 | Ga0075366_100041922 | 225 |
| 167 | 3300006195 | Ga0075366_10076381 | Ga0075366_100763812 | 225 |
| 168 | 3300006195 | Ga0075366_10174218 | Ga0075366_101742182 | 225 |
| 169 | 3300006880 | Ga0075429_100235262 | Ga0075429_1002352621 | 225 |
| 170 | 3300009094 | Ga0111539_10722407 | Ga0111539_107224072 | 225 |
| 171 | 3300009177 | Ga0105248_10300675 | Ga0105248_103006752 | 225 |
| 172 | 3300009545 | Ga0105237_10000492 | Ga0105237_100004927 | 225 |
| 173 | 3300013105 | Ga0157369_10155562 | Ga0157369_101555622 | 225 |
| 174 | 3300013308 | Ga0157375_10141507 | Ga0157375_101415073 | 225 |
| 175 | 3300025893 | Ga0207682_10016200 | Ga0207682_100162002 | 225 |
| 176 | 3300025910 | Ga0207684_10043139 | Ga0207684_100431394 | 225 |
| 177 | 3300025914 | Ga0207671_10000458 | Ga0207671_100004587 | 225 |
| 178 | 3300025915 | Ga0207693_10016107 | Ga0207693_100161074 | 225 |
| 179 | 3300025922 | Ga0207646_10000989 | Ga0207646_1000098934 | 225 |
| 180 | 3300025925 | Ga0207650_10072581 | Ga0207650_100725811 | 225 |
| 181 | 3300025931 | Ga0207644_10092378 | Ga0207644_100923783 | 225 |
| 182 | 3300025933 | Ga0207706_10335996 | Ga0207706_103359963 | 225 |
| 183 | 3300025940 | Ga0207691_10403909 | Ga0207691_104039092 | 225 |
| 184 | 3300025945 | Ga0207679_10132602 | Ga0207679_101326022 | 225 |
| 185 | 3300025986 | Ga0207658_10294641 | Ga0207658_102946411 | 225 |
| 186 | 3300026067 | Ga0207678_10009479 | Ga0207678_100094793 | 225 |
| 187 | 3300026075 | Ga0207708_10175790 | Ga0207708_101757902 | 225 |
| 188 | 3300026088 | Ga0207641_10321792 | Ga0207641_103217922 | 225 |
| 189 | 3300026118 | Ga0207675_100078992 | Ga0207675_1000789923 | 225 |
| 190 | 3300026121 | Ga0207683_10013306 | Ga0207683_100133063 | 225 |
| 191 | 3300027866 | Ga0209813_10052159 | Ga0209813_100521592 | 225 |
| 192 | 3300028380 | Ga0268265_10321336 | Ga0268265_103213362 | 225 |
| 193 | 3300035118 | Ga0373954_0235625 | Ga0373954_0235625_174_890 | 225 |
| 194 | 3300044673 | Ga0453683_0089711 | Ga0453683_0089711_1105_1800 | 225 |
| 195 | 3300048909 | Ga0496106_0237011 | Ga0496106_0237011_10_720 | 225 |
| 196 | 3300050491 | nmdc:mga00v17_192124_c1 | nmdc:mga00v17_192124_c1_268_984 | 225 |
| 197 | 3300050491 | nmdc:mga00v17_211151_c1 | nmdc:mga00v17_211151_c1_495_1205 | 225 |
| 198 | 3300050493 | nmdc:mga0k408_3855_c1 | nmdc:mga0k408_3855_c1_2773_3483 | 225 |
| 199 | 3300050493 | nmdc:mga0k408_45750_c1 | nmdc:mga0k408_45750_c1_335_1051 | 225 |
| 200 | 3300050495 | nmdc:mga04h51_74879_c1 | nmdc:mga04h51_74879_c1_190_900 | 225 |
| 201 | 3300050496 | nmdc:mga07m45_24240_c1 | nmdc:mga07m45_24240_c1_959_1675 | 225 |
| 202 | 3300005467 | Ga0070706_100071507 | Ga0070706_1000715072 | 226 |
| 203 | 3300006852 | Ga0075433_10112102 | Ga0075433_101121022 | 226 |
| 204 | 3300007076 | Ga0075435_100168618 | Ga0075435_1001686182 | 226 |
| 205 | 3300025910 | Ga0207684_10060132 | Ga0207684_100601324 | 226 |
| 206 | 3300025910 | Ga0207684_10160371 | Ga0207684_101603712 | 226 |
| 207 | 3300050508 | nmdc:mga09592_185469_c1 | nmdc:mga09592_185469_c1_997_1695 | 226 |
| 208 | 3300050513 | nmdc:mga0rr50_181356_c1 | nmdc:mga0rr50_181356_c1_72_770 | 226 |
| 209 | 3300005330 | Ga0070690_100013247 | Ga0070690_1000132473 | 227 |
| 210 | 3300005334 | Ga0068869_100040746 | Ga0068869_1000407462 | 227 |
| 211 | 3300005343 | Ga0070687_100017538 | Ga0070687_1000175383 | 227 |
| 212 | 3300005354 | Ga0070675_100028677 | Ga0070675_1000286772 | 227 |
| 213 | 3300005356 | Ga0070674_100004210 | Ga0070674_1000042108 | 227 |
| 214 | 3300005365 | Ga0070688_100037920 | Ga0070688_1000379202 | 227 |
| 215 | 3300005367 | Ga0070667_100138102 | Ga0070667_1001381022 | 227 |
| 216 | 3300005441 | Ga0070700_100026640 | Ga0070700_1000266401 | 227 |
| 217 | 3300005455 | Ga0070663_100339118 | Ga0070663_1003391182 | 227 |
| 218 | 3300005456 | Ga0070678_100052632 | Ga0070678_1000526323 | 227 |
| 219 | 3300005457 | Ga0070662_100041715 | Ga0070662_1000417152 | 227 |
| 220 | 3300005459 | Ga0068867_100008378 | Ga0068867_1000083783 | 227 |
| 221 | 3300005615 | Ga0070702_100033657 | Ga0070702_1000336572 | 227 |
| 222 | 3300005719 | Ga0068861_100382818 | Ga0068861_1003828182 | 227 |
| 223 | 3300005841 | Ga0068863_100029770 | Ga0068863_1000297703 | 227 |
| 224 | 3300005843 | Ga0068860_100109915 | Ga0068860_1001099152 | 227 |
| 225 | 3300005844 | Ga0068862_100007907 | Ga0068862_1000079071 | 227 |
| 226 | 3300005844 | Ga0068862_100445656 | Ga0068862_1004456562 | 227 |
| 227 | 3300006042 | Ga0075368_10024556 | Ga0075368_100245562 | 227 |
| 228 | 3300006048 | Ga0075363_100031061 | Ga0075363_1000310612 | 227 |
| 229 | 3300006051 | Ga0075364_10007701 | Ga0075364_100077015 | 227 |
| 230 | 3300006177 | Ga0075362_10004875 | Ga0075362_100048753 | 227 |
| 231 | 3300006178 | Ga0075367_10004084 | Ga0075367_100040843 | 227 |
| 232 | 3300006195 | Ga0075366_10000097 | Ga0075366_1000009721 | 227 |
| 233 | 3300006237 | Ga0097621_100744128 | Ga0097621_1007441282 | 227 |
| 234 | 3300006353 | Ga0075370_10076310 | Ga0075370_100763102 | 227 |
| 235 | 3300006844 | Ga0075428_100252277 | Ga0075428_1002522772 | 227 |
| 236 | 3300006846 | Ga0075430_100168294 | Ga0075430_1001682941 | 227 |
| 237 | 3300006880 | Ga0075429_100054743 | Ga0075429_1000547433 | 227 |
| 238 | 3300009094 | Ga0111539_10000386 | Ga0111539_1000038642 | 227 |
| 239 | 3300009101 | Ga0105247_10111542 | Ga0105247_101115422 | 227 |
| 240 | 3300009147 | Ga0114129_10045393 | Ga0114129_100453932 | 227 |
| 241 | 3300009147 | Ga0114129_10079333 | Ga0114129_100793335 | 227 |
| 242 | 3300009147 | Ga0114129_10218635 | Ga0114129_102186352 | 227 |
| 243 | 3300009147 | Ga0114129_10953206 | Ga0114129_109532062 | 227 |
| 244 | 3300009148 | Ga0105243_10004339 | Ga0105243_100043398 | 227 |
| 245 | 3300009177 | Ga0105248_10098934 | Ga0105248_100989342 | 227 |
| 246 | 3300011119 | Ga0105246_10106975 | Ga0105246_101069752 | 227 |
| 247 | 3300013306 | Ga0163162_10431343 | Ga0163162_104313432 | 227 |
| 248 | 3300013308 | Ga0157375_10054870 | Ga0157375_100548703 | 227 |
| 249 | 3300014325 | Ga0163163_10345362 | Ga0163163_103453621 | 227 |
| 250 | 3300014326 | Ga0157380_10135142 | Ga0157380_101351423 | 227 |
| 251 | 3300014745 | Ga0157377_10009003 | Ga0157377_100090031 | 227 |
| 252 | 3300025908 | Ga0207643_10079460 | Ga0207643_100794602 | 227 |
| 253 | 3300025910 | Ga0207684_10149237 | Ga0207684_101492372 | 227 |
| 254 | 3300025918 | Ga0207662_10002132 | Ga0207662_100021326 | 227 |
| 255 | 3300025923 | Ga0207681_10084977 | Ga0207681_100849772 | 227 |
| 256 | 3300025926 | Ga0207659_10025830 | Ga0207659_100258304 | 227 |
| 257 | 3300025935 | Ga0207709_10052296 | Ga0207709_100522963 | 227 |
| 258 | 3300025936 | Ga0207670_10042043 | Ga0207670_100420432 | 227 |
| 259 | 3300025937 | Ga0207669_10097731 | Ga0207669_100977312 | 227 |
| 260 | 3300025940 | Ga0207691_10052332 | Ga0207691_100523324 | 227 |
| 261 | 3300025942 | Ga0207689_10061646 | Ga0207689_100616462 | 227 |
| 262 | 3300026023 | Ga0207677_10180603 | Ga0207677_101806032 | 227 |
| 263 | 3300026067 | Ga0207678_10127148 | Ga0207678_101271483 | 227 |
| 264 | 3300026075 | Ga0207708_10021461 | Ga0207708_100214613 | 227 |
| 265 | 3300026088 | Ga0207641_10092948 | Ga0207641_100929482 | 227 |
| 266 | 3300026089 | Ga0207648_10002617 | Ga0207648_100026174 | 227 |
| 267 | 3300026118 | Ga0207675_100030687 | Ga0207675_1000306872 | 227 |
| 268 | 3300026121 | Ga0207683_10141634 | Ga0207683_101416342 | 227 |
| 269 | 3300027866 | Ga0209813_10014649 | Ga0209813_100146492 | 227 |
| 270 | 3300027907 | Ga0207428_10000151 | Ga0207428_1000015134 | 227 |
| 271 | 3300028379 | Ga0268266_10276305 | Ga0268266_102763052 | 227 |
| 272 | 3300035691 | Ga0373931_0198498 | Ga0373931_0198498_464_1168 | 227 |
| 273 | 3300046684 | Ga0495669_0074345 | Ga0495669_0074345_674_1378 | 227 |
| 274 | 3300050490 | nmdc:mga03n38_30127_c1 | nmdc:mga03n38_30127_c1_83_787 | 227 |
| 275 | 3300050492 | nmdc:mga0yw44_111584_c1 | nmdc:mga0yw44_111584_c1_30_734 | 227 |
| 276 | 3300050493 | nmdc:mga0k408_614_c1 | nmdc:mga0k408_614_c1_14594_15298 | 227 |
| 277 | 3300050495 | nmdc:mga04h51_11146_c1 | nmdc:mga04h51_11146_c1_1038_1742 | 227 |
| 278 | 3300050496 | nmdc:mga07m45_26580_c1 | nmdc:mga07m45_26580_c1_1000_1704 | 227 |
| 279 | 3300050507 | nmdc:mga05p37_642_c1 | nmdc:mga05p37_642_c1_15055_15762 | 227 |
| 280 | 3300050509 | nmdc:mga0qj67_167735_c1 | nmdc:mga0qj67_167735_c1_20_724 | 227 |
| 281 | 3300050510 | nmdc:mga06r32_10471_c1 | nmdc:mga06r32_10471_c1_3648_4352 | 227 |
| 282 | 3300050511 | nmdc:mga08y16_174_c1 | nmdc:mga08y16_174_c1_51920_52624 | 227 |
| 283 | 3300050515 | nmdc:mga0a205_13632_c1 | nmdc:mga0a205_13632_c1_3752_4456 | 227 |
| 284 | 3300050516 | nmdc:mga0sz30_88777_c1 | nmdc:mga0sz30_88777_c1_622_1326 | 227 |
| 285 | 3300005334 | Ga0068869_100088692 | Ga0068869_1000886922 | 228 |
| 286 | 3300025910 | Ga0207684_10170494 | Ga0207684_101704942 | 228 |
| 287 | 3300025926 | Ga0207659_10443357 | Ga0207659_104433572 | 228 |
| 288 | 3300025942 | Ga0207689_10099525 | Ga0207689_100995252 | 228 |
| 289 | 3300050511 | nmdc:mga08y16_292594_c1 | nmdc:mga08y16_292594_c1_758_1447 | 228 |
| 290 | 3300005331 | Ga0070670_100149602 | Ga0070670_1001496021 | 229 |
| 291 | 3300005578 | Ga0068854_100632036 | Ga0068854_1006320361 | 229 |
| 292 | 3300009094 | Ga0111539_10126329 | Ga0111539_101263293 | 229 |
| 293 | 3300009094 | Ga0111539_11435667 | Ga0111539_114356671 | 229 |
| 294 | 3300022467 | Ga0224712_10085997 | Ga0224712_100859972 | 229 |
| 295 | 3300025913 | Ga0207695_10223347 | Ga0207695_102233473 | 229 |
| 296 | 3300025925 | Ga0207650_10326112 | Ga0207650_103261122 | 229 |
| 297 | 3300025945 | Ga0207679_10127257 | Ga0207679_101272572 | 229 |
| 298 | 3300031995 | Ga0307409_100408717 | Ga0307409_1004087172 | 229 |
| 299 | 3300031995 | Ga0307409_100612181 | Ga0307409_1006121812 | 229 |
| 300 | 3300042156 | Ga0439446_0009553 | Ga0439446_0009553_1530_2222 | 229 |
| 301 | 3300050511 | nmdc:mga08y16_214870_c1 | nmdc:mga08y16_214870_c1_827_1519 | 229 |
| 302 | 3300005293 | Ga0065715_10181649 | Ga0065715_101816493 | 230 |
| 303 | 3300005344 | Ga0070661_100380673 | Ga0070661_1003806732 | 230 |
| 304 | 3300005353 | Ga0070669_100002229 | Ga0070669_1000022296 | 230 |
| 305 | 3300005444 | Ga0070694_100048433 | Ga0070694_1000484332 | 230 |
| 306 | 3300005577 | Ga0068857_100241277 | Ga0068857_1002412773 | 230 |
| 307 | 3300005617 | Ga0068859_100479605 | Ga0068859_1004796053 | 230 |
| 308 | 3300005844 | Ga0068862_100028310 | Ga0068862_1000283104 | 230 |
| 309 | 3300006844 | Ga0075428_100048696 | Ga0075428_1000486965 | 230 |
| 310 | 3300006852 | Ga0075433_10021109 | Ga0075433_100211093 | 230 |
| 311 | 3300006931 | Ga0097620_100479543 | Ga0097620_1004795431 | 230 |
| 312 | 3300009094 | Ga0111539_10000877 | Ga0111539_100008777 | 230 |
| 313 | 3300009094 | Ga0111539_10185833 | Ga0111539_101858333 | 230 |
| 314 | 3300009147 | Ga0114129_10013047 | Ga0114129_1001304712 | 230 |
| 315 | 3300009553 | Ga0105249_10000704 | Ga0105249_1000070418 | 230 |
| 316 | 3300011119 | Ga0105246_10178007 | Ga0105246_101780072 | 230 |
| 317 | 3300014326 | Ga0157380_10186679 | Ga0157380_101866792 | 230 |
| 318 | 3300025315 | Ga0207697_10070116 | Ga0207697_100701162 | 230 |
| 319 | 3300025923 | Ga0207681_10024072 | Ga0207681_100240722 | 230 |
| 320 | 3300025945 | Ga0207679_10375597 | Ga0207679_103755973 | 230 |
| 321 | 3300025961 | Ga0207712_10289420 | Ga0207712_102894201 | 230 |
| 322 | 3300026116 | Ga0207674_10032580 | Ga0207674_100325802 | 230 |
| 323 | 3300027907 | Ga0207428_10022436 | Ga0207428_100224364 | 230 |
| 324 | 3300027907 | Ga0207428_10267299 | Ga0207428_102672993 | 230 |
| 325 | 3300050508 | nmdc:mga09592_120618_c1 | nmdc:mga09592_120618_c1_245_937 | 230 |
| 326 | 3300050511 | nmdc:mga08y16_176727_c1 | nmdc:mga08y16_176727_c1_863_1555 | 230 |
| 327 | 3300050511 | nmdc:mga08y16_19484_c1 | nmdc:mga08y16_19484_c1_4784_5476 | 230 |
| 328 | 3300050512 | nmdc:mga0n895_76627_c1 | nmdc:mga0n895_76627_c1_1774_2466 | 230 |
| 329 | 3300050515 | nmdc:mga0a205_27370_c1 | nmdc:mga0a205_27370_c1_1673_2365 | 230 |
| 330 | 3300005293 | Ga0065715_10024157 | Ga0065715_100241573 | 231 |
| 331 | 3300005340 | Ga0070689_100450310 | Ga0070689_1004503101 | 231 |
| 332 | 3300006038 | Ga0075365_10072308 | Ga0075365_100723082 | 231 |
| 333 | 3300006038 | Ga0075365_10097352 | Ga0075365_100973523 | 231 |
| 334 | 3300006051 | Ga0075364_10006657 | Ga0075364_100066574 | 231 |
| 335 | 3300006051 | Ga0075364_10008901 | Ga0075364_100089013 | 231 |
| 336 | 3300006177 | Ga0075362_10001457 | Ga0075362_100014575 | 231 |
| 337 | 3300006178 | Ga0075367_10005755 | Ga0075367_100057553 | 231 |
| 338 | 3300006178 | Ga0075367_10019738 | Ga0075367_100197384 | 231 |
| 339 | 3300006178 | Ga0075367_10021901 | Ga0075367_100219012 | 231 |
| 340 | 3300006195 | Ga0075366_10014119 | Ga0075366_100141193 | 231 |
| 341 | 3300006195 | Ga0075366_10042525 | Ga0075366_100425253 | 231 |
| 342 | 3300006353 | Ga0075370_10011138 | Ga0075370_100111383 | 231 |
| 343 | 3300006852 | Ga0075433_10139120 | Ga0075433_101391203 | 231 |
| 344 | 3300006871 | Ga0075434_100072373 | Ga0075434_1000723733 | 231 |
| 345 | 3300009147 | Ga0114129_10134075 | Ga0114129_101340752 | 231 |
| 346 | 3300014325 | Ga0163163_10854215 | Ga0163163_108542152 | 231 |
| 347 | 3300025925 | Ga0207650_10039230 | Ga0207650_100392302 | 231 |
| 348 | 3300025945 | Ga0207679_10634131 | Ga0207679_106341311 | 231 |
| 349 | 3300028379 | Ga0268266_10081539 | Ga0268266_100815393 | 231 |
| 350 | 3300028380 | Ga0268265_10645250 | Ga0268265_106452502 | 231 |
| 351 | 3300035170 | Ga0373943_0145963 | Ga0373943_0145963_437_1192 | 231 |
| 352 | 3300035695 | Ga0373927_0002329 | Ga0373927_0002329_1439_2194 | 231 |
| 353 | 3300035725 | Ga0373947_0434352 | Ga0373947_0434352_44_799 | 231 |
| 354 | 3300037068 | Ga0373925_0000015 | Ga0373925_0000015_67260_68015 | 231 |
| 355 | 3300039437 | Ga0436365_1800696 | Ga0436365_1800696_1022_1744 | 231 |
| 356 | 3300041453 | Ga0451797_0488507 | Ga0451797_0488507_186_899 | 231 |
| 357 | 3300042001 | Ga0439441_056358 | Ga0439441_056358_84_779 | 231 |
| 358 | 3300048915 | Ga0496112_0175543 | Ga0496112_0175543_386_1099 | 231 |
| 359 | 3300049571 | Ga0501034_0055937 | Ga0501034_0055937_255_956 | 231 |
| 360 | 3300049572 | Ga0501036_0207766 | Ga0501036_0207766_147_851 | 231 |
| 361 | 3300049577 | Ga0501041_0061963 | Ga0501041_0061963_199_903 | 231 |
| 362 | 3300049587 | Ga0501071_0076551 | Ga0501071_0076551_1556_2260 | 231 |
| 363 | 3300049742 | Ga0501080_0168353 | Ga0501080_0168353_1237_1941 | 231 |
| 364 | 3300049824 | Ga0501045_0196039 | Ga0501045_0196039_134_838 | 231 |
| 365 | 3300050489 | nmdc:mga03683_10372_c1 | nmdc:mga03683_10372_c1_373_1077 | 231 |
| 366 | 3300050491 | nmdc:mga00v17_160636_c1 | nmdc:mga00v17_160636_c1_663_1367 | 231 |
| 367 | 3300050491 | nmdc:mga00v17_34443_c1 | nmdc:mga00v17_34443_c1_1327_2031 | 231 |
| 368 | 3300050491 | nmdc:mga00v17_45343_c1 | nmdc:mga00v17_45343_c1_498_1229 | 231 |
| 369 | 3300050492 | nmdc:mga0yw44_31850_c1 | nmdc:mga0yw44_31850_c1_2301_3032 | 231 |
| 370 | 3300050492 | nmdc:mga0yw44_427529_c1 | nmdc:mga0yw44_427529_c1_173_877 | 231 |
| 371 | 3300050494 | nmdc:mga06z11_245014_c1 | nmdc:mga06z11_245014_c1_189_893 | 231 |
| 372 | 3300050494 | nmdc:mga06z11_8573_c1 | nmdc:mga06z11_8573_c1_1962_2693 | 231 |
| 373 | 3300050507 | nmdc:mga05p37_64590_c1 | nmdc:mga05p37_64590_c1_1674_2408 | 231 |
| 374 | 3300050508 | nmdc:mga09592_418912_c1 | nmdc:mga09592_418912_c1_197_931 | 231 |
| 375 | 3300050515 | nmdc:mga0a205_130132_c1 | nmdc:mga0a205_130132_c1_1650_2357 | 231 |
| 376 | 3300053085 | Ga0495619_0079210 | Ga0495619_0079210_124_834 | 231 |
| 377 | 3300053103 | Ga0500555_001074 | Ga0500555_001074_6655_7380 | 231 |
| 378 | 3300053153 | Ga0500616_0000226 | Ga0500616_0000226_59050_59775 | 231 |
| 379 | 3300053730 | Ga0500645_000268 | Ga0500645_000268_25460_26185 | 231 |
| 380 | 3300059426 | Ga0590077_000962 | Ga0590077_000962_4738_5457 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f4w-assembly1.cif.gz_B | the 1.65a crystal structure of 3-hexulose-6-phosphate synthase from salmonella typhimurium | 0.9086 | 6 | 227 |
| 3f4w-assembly1.cif.gz_B | the 1.65a crystal structure of 3-hexulose-6-phosphate synthase from salmonella typhimurium | 0.8963 | 6 | 227 |
| 1xbz-assembly1.cif.gz_A | crystal structure of 3-keto-l-gulonate 6-phosphate decarboxylase e112d/r139v/t169a mutant with bound l-xylulose 5-phosphate | 0.8925 | 9 | 228 |
| 1q6q-assembly1.cif.gz_A | structure of 3-keto-l-gulonate 6-phosphate decarboxylase with bound xylitol 5-phosphate | 0.892 | 8 | 228 |
| 1so6-assembly1.cif.gz_A | crystal structure of e112q/h136a double mutant of 3-keto-l-gulonate 6-phosphate decarboxylase with bound l-threonohydroxamate 4-phosphate | 0.8852 | 9 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0K7_1_209_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9202 | 10 | 225 | 3.20.20.70 |
| 3f4wB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9086 | 6 | 227 | 3.20.20.70 |
| af_Q2G0K7_1_209_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9035 | 10 | 225 | 3.20.20.70 |
| 3f4wB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8963 | 6 | 227 | 3.20.20.70 |
| 3ajxA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.896 | 6 | 225 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354TCM2-F1-model_v4 | D-arabino 3-hexulose 6-phosphate aldehyde lyase | 1 | 10 | 118 |
GO:0004590
GO:0006207 GO:0019854 GO:0033982 |
| AF-A0A4Q5Y8B4-F1-model_v4 | D-arabino 3-hexulose 6-phosphate aldehyde lyase | 0.9992 | 10 | 86 |
GO:0004590
GO:0006207 GO:0019854 GO:0033982 |
| AF-A0A843JGB0-F1-model_v4 | Orotidine 5'-phosphate decarboxylase | 0.9957 | 10 | 119 |
GO:0004590
GO:0006207 GO:0019854 GO:0033982 |
| AF-A0A5E4J6A4-F1-model_v4 | Bifunctional enzyme Fae/Hps | 0.9922 | 16 | 115 |
GO:0004590
GO:0006207 GO:0019854 GO:0033982 GO:0042558 |
| AF-A0A7W0F2L9-F1-model_v4 | Bifunctional hexulose-6-phosphate synthase/ribonuclease regulator | 0.991 | 10 | 102 |
GO:0004590
GO:0006207 GO:0019854 GO:0033982 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar