F428641

General Info

Members Datasets Scaffolds Average Seq Length
380 208 760 162

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10452932|Ga0105241_104529323
Length 175
Sequence MDRLYAPWRMAYIDQPAPAKEHSHNGACVFCSKARSEDDSANLVVFKGIHSFVLMNVYPYTNGHVMVAPYDHTANLDDLSVDTLTEIMLLTRRAVDALRISIHPDGYNIGMNLGKVAGAGIADHLHMHIVPRWDGDTNFMPVIAETKILPDSLESSFNKLRAAWKTLEEQDRAKP

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.53
Rhizosphere 94.47
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10452932 3300009174 Unclassified 1135
2 JGI25406J46586_10083898 3300003203 Bacteria 972
3 Ga0070690_100000280 3300005330 Bacteria 26196
4 Ga0070670_100008461 3300005331 Bacteria 8777
5 Ga0070670_100011198 3300005331 Bacteria 7664
6 Ga0070677_10028125 3300005333 Unclassified 2121
7 Ga0068869_100480113 3300005334 Unclassified 1035
8 Ga0070666_10000124 3300005335 Bacteria 53897
9 Ga0070666_10001445 3300005335 Bacteria 14398
10 Ga0070666_10021108 3300005335 Bacteria 4218
11 Ga0068868_100020997 3300005338 Bacteria 4917
12 Ga0068868_100127197 3300005338 Bacteria 2083
13 Ga0068868_100875445 3300005338 Bacteria 815
14 Ga0070689_100025349 3300005340 Bacteria 4454
15 Ga0070661_100021850 3300005344 Bacteria 4577
16 Ga0070668_100108071 3300005347 Bacteria 2212
17 Ga0070668_100204959 3300005347 Unclassified 1620
18 Ga0070669_101490926 3300005353 Bacteria 588
19 Ga0070675_100023570 3300005354 Bacteria 4923
20 Ga0070675_100042760 3300005354 Bacteria 3703
21 Ga0070671_100665613 3300005355 Bacteria 902
22 Ga0070674_100167676 3300005356 Bacteria 1672
23 Ga0070673_100003012 3300005364 Bacteria 10406
24 Ga0070673_100109516 3300005364 Bacteria 2288
25 Ga0070688_100055313 3300005365 Unclassified 2488
26 Ga0070667_100001154 3300005367 Bacteria 23979
27 Ga0070667_100019513 3300005367 Bacteria 5625
28 Ga0070667_100064775 3300005367 Bacteria 3102
29 Ga0070667_100381518 3300005367 Unclassified 1280
30 Ga0070709_10285554 3300005434 Bacteria 1201
31 Ga0070709_10313460 3300005434 Unclassified 1149
32 Ga0070710_10182555 3300005437 Bacteria 1315
33 Ga0070710_10574046 3300005437 Bacteria 782
34 Ga0070711_100105487 3300005439 Bacteria 2058
35 Ga0070711_100667885 3300005439 Bacteria 872
36 Ga0070694_100768146 3300005444 Unclassified 788
37 Ga0070708_100102052 3300005445 Bacteria 2628
38 Ga0070708_100443117 3300005445 Bacteria 1225
39 Ga0070663_100034410 3300005455 Bacteria 3509
40 Ga0070663_100305481 3300005455 Unclassified 1275
41 Ga0070663_100354942 3300005455 Bacteria 1188
42 Ga0070678_100022055 3300005456 Bacteria 4209
43 Ga0070678_100031768 3300005456 Bacteria 3647
44 Ga0070662_100080395 3300005457 Unclassified 2426
45 Ga0070662_100094450 3300005457 Bacteria 2252
46 Ga0070681_10106858 3300005458 Bacteria 2740
47 Ga0068867_100008590 3300005459 Bacteria 7211
48 Ga0068867_100057609 3300005459 Bacteria 2878
49 Ga0068867_100129729 3300005459 Bacteria 1958
50 Ga0070685_10144819 3300005466 Unclassified 1500
51 Ga0070685_10290352 3300005466 Bacteria 1098
52 Ga0070706_100002585 3300005467 Bacteria 18178
53 Ga0070706_100006334 3300005467 Bacteria 11186
54 Ga0070706_100007815 3300005467 Bacteria 9996
55 Ga0070706_100470735 3300005467 Bacteria 1169
56 Ga0070706_101811700 3300005467 Unclassified 555
57 Ga0070707_100023595 3300005468 Bacteria 5818
58 Ga0070707_100226515 3300005468 Bacteria 1820
59 Ga0070707_101373831 3300005468 Unclassified 673
60 Ga0070698_100000505 3300005471 Bacteria 41461
61 Ga0070698_100052053 3300005471 Bacteria 4168
62 Ga0070679_100043603 3300005530 Bacteria 4467
63 Ga0070697_100034494 3300005536 Bacteria 4080
64 Ga0070697_101053563 3300005536 Bacteria 723
65 Ga0070672_100020424 3300005543 Bacteria 4831
66 Ga0070672_100141078 3300005543 Unclassified 1988
67 Ga0070686_100540162 3300005544 Bacteria 910
68 Ga0070695_100639300 3300005545 Unclassified 839
69 Ga0070665_100011503 3300005548 Bacteria 8949
70 Ga0070665_100026081 3300005548 Bacteria 5885
71 Ga0070665_100074511 3300005548 Bacteria 3400
72 Ga0070704_100236517 3300005549 Bacteria 1493
73 Ga0070664_100005721 3300005564 Bacteria 10018
74 Ga0070664_100096008 3300005564 Bacteria 2572
75 Ga0070664_100405923 3300005564 Unclassified 1246
76 Ga0068854_100006734 3300005578 Bacteria 7322
77 Ga0068856_100031268 3300005614 Bacteria 5207
78 Ga0068856_100169470 3300005614 Bacteria 2195
79 Ga0070702_100197260 3300005615 Bacteria 1329
80 Ga0068852_100057686 3300005616 Bacteria 3360
81 Ga0068859_100001014 3300005617 Bacteria 28729
82 Ga0068859_100068001 3300005617 Bacteria 3597
83 Ga0068859_101115075 3300005617 Bacteria 868
84 Ga0068864_100018546 3300005618 Bacteria 5816
85 Ga0068864_100140580 3300005618 Bacteria 2177
86 Ga0068864_100435863 3300005618 Unclassified 1251
87 Ga0068861_100055986 3300005719 Bacteria 3009
88 Ga0068870_10022094 3300005840 Bacteria 3122
89 Ga0068870_11080501 3300005840 Bacteria 576
90 Ga0068863_100012687 3300005841 Bacteria 8126
91 Ga0068863_100021092 3300005841 Bacteria 6223
92 Ga0068863_100054767 3300005841 Bacteria 3779
93 Ga0068858_100000656 3300005842 Bacteria 36151
94 Ga0068858_100062933 3300005842 Bacteria 3432
95 Ga0068858_100176640 3300005842 Unclassified 2015
96 Ga0068858_100273024 3300005842 Unclassified 1609
97 Ga0068858_101008900 3300005842 Unclassified 816
98 Ga0068860_100001089 3300005843 Bacteria 29937
99 Ga0068860_100108044 3300005843 Bacteria 2659
100 Ga0068860_100652035 3300005843 Bacteria 1061
101 Ga0068860_100695591 3300005843 Unclassified 1026
102 Ga0068860_101102282 3300005843 Unclassified 813
103 Ga0068862_100067450 3300005844 Bacteria 3084
104 Ga0070712_100278061 3300006175 Bacteria 1347
105 Ga0097621_100050660 3300006237 Bacteria 3377
106 Ga0097621_100330613 3300006237 Bacteria 1352
107 Ga0068871_100054456 3300006358 Bacteria 3245
108 Ga0068871_100210152 3300006358 Unclassified 1683
109 Ga0075428_100550227 3300006844 Bacteria 1234
110 Ga0075430_100055619 3300006846 Bacteria 3327
111 Ga0075431_100079901 3300006847 Bacteria 3376
112 Ga0075431_100374075 3300006847 Bacteria 1430
113 Ga0075433_10015695 3300006852 Bacteria 6222
114 Ga0075434_100024535 3300006871 Bacteria 5895
115 Ga0075434_100226226 3300006871 Bacteria 1890
116 Ga0075429_100030459 3300006880 Bacteria 4688
117 Ga0068865_100219456 3300006881 Bacteria 1486
118 Ga0068865_100232330 3300006881 Unclassified 1448
119 Ga0075436_100025535 3300006914 Bacteria 4067
120 Ga0075436_100323882 3300006914 Unclassified 1107
121 Ga0097620_100001014 3300006931 Bacteria 28729
122 Ga0097620_100068001 3300006931 Bacteria 3597
123 Ga0097620_101115218 3300006931 Bacteria 868
124 Ga0075435_101374450 3300007076 Unclassified 619
125 Ga0075435_101435733 3300007076 Bacteria 605
126 Ga0105251_10163740 3300009011 Bacteria 1003
127 Ga0111539_10064411 3300009094 Bacteria 4336
128 Ga0105245_10015621 3300009098 Bacteria 6621
129 Ga0105245_10129781 3300009098 Bacteria 2363
130 Ga0105245_10515872 3300009098 Unclassified 1213
131 Ga0105245_11191894 3300009098 Bacteria 809
132 Ga0114129_10013672 3300009147 Bacteria 11566
133 Ga0114129_10016013 3300009147 Bacteria 10665
134 Ga0114129_10331533 3300009147 Bacteria 2020
135 Ga0105243_10062024 3300009148 Bacteria 2992
136 Ga0105243_10102239 3300009148 Bacteria 2381
137 Ga0105241_10139493 3300009174 Bacteria 1972
138 Ga0105241_10308961 3300009174 Bacteria 1359
139 Ga0105241_11240601 3300009174 Bacteria 708
140 Ga0105242_10367633 3300009176 Bacteria 1333
141 Ga0105248_10051214 3300009177 Bacteria 4633
142 Ga0105248_10120334 3300009177 Bacteria 2962
143 Ga0105248_10233667 3300009177 Bacteria 2070
144 Ga0105248_10558312 3300009177 Unclassified 1292
145 Ga0105237_10000051 3300009545 Bacteria 160485
146 Ga0105237_10032765 3300009545 Bacteria 5262
147 Ga0105238_10022943 3300009551 Bacteria 6361
148 Ga0105238_10536580 3300009551 Unclassified 1173
149 Ga0105239_10546646 3300010375 Unclassified 1319
150 Ga0157370_10236189 3300013104 Bacteria 1692
151 Ga0157369_10403674 3300013105 Unclassified 1418
152 Ga0157374_10005700 3300013296 Bacteria 10506
153 Ga0157374_10072945 3300013296 Bacteria 3240
154 Ga0157378_10006864 3300013297 Bacteria 9931
155 Ga0157378_10195354 3300013297 Unclassified 1911
156 Ga0163162_10222192 3300013306 Unclassified 2019
157 Ga0157372_10473127 3300013307 Unclassified 1461
158 Ga0157375_10000201 3300013308 Bacteria 55923
159 Ga0157375_10011338 3300013308 Bacteria 7870
160 Ga0157375_10020568 3300013308 Bacteria 6032
161 Ga0157375_10033442 3300013308 Bacteria 4886
162 Ga0157375_10470337 3300013308 Bacteria 1422
163 Ga0163163_10048840 3300014325 Bacteria 4162
164 Ga0163163_10055107 3300014325 Bacteria 3929
165 Ga0163163_10522413 3300014325 Bacteria 1249
166 Ga0163163_12332391 3300014325 Unclassified 594
167 Ga0157380_10112208 3300014326 Bacteria 2293
168 Ga0157377_10090592 3300014745 Bacteria 1805
169 Ga0157377_10764416 3300014745 Unclassified 708
170 Ga0157379_10075703 3300014968 Bacteria 3014
171 Ga0157379_10077348 3300014968 Bacteria 2979
172 Ga0157379_10183533 3300014968 Bacteria 1890
173 Ga0157376_10007310 3300014969 Bacteria 7868
174 Ga0157376_10137040 3300014969 Unclassified 2191
175 Ga0206354_11287948 3300020081 Bacteria 2477
176 Ga0206353_10010820 3300020082 Unclassified 972
177 Ga0224712_10233683 3300022467 Bacteria 845
178 Ga0207682_10003540 3300025893 Bacteria 6755
179 Ga0207692_10760667 3300025898 Bacteria 632
180 Ga0207692_10911758 3300025898 Archaea 578
181 Ga0207688_10232206 3300025901 Unclassified 1114
182 Ga0207680_10001660 3300025903 Bacteria 10520
183 Ga0207680_10013678 3300025903 Bacteria 4175
184 Ga0207680_10019290 3300025903 Bacteria 3644
185 Ga0207699_10135512 3300025906 Bacteria 1612
186 Ga0207699_10259463 3300025906 Unclassified 1201
187 Ga0207645_10002788 3300025907 Bacteria 13602
188 Ga0207643_10004316 3300025908 Bacteria 7644
189 Ga0207684_10001478 3300025910 Bacteria 25294
190 Ga0207684_10038376 3300025910 Bacteria 4064
191 Ga0207684_10121996 3300025910 Bacteria 2234
192 Ga0207654_10622987 3300025911 Unclassified 771
193 Ga0207695_10036112 3300025913 Bacteria 5346
194 Ga0207671_10000040 3300025914 Bacteria 216380
195 Ga0207671_10247614 3300025914 Unclassified 1401
196 Ga0207693_10189643 3300025915 Bacteria 1618
197 Ga0207649_10118022 3300025920 Bacteria 1784
198 Ga0207646_10058739 3300025922 Bacteria 3435
199 Ga0207646_10676815 3300025922 Unclassified 923
200 Ga0207681_10000012 3300025923 Bacteria 361565
201 Ga0207694_10023356 3300025924 Unclassified 4694
202 Ga0207650_10032266 3300025925 Bacteria 3788
203 Ga0207650_10037229 3300025925 Bacteria 3544
204 Ga0207659_10069568 3300025926 Bacteria 2564
205 Ga0207659_10421782 3300025926 Unclassified 1119
206 Ga0207687_10025607 3300025927 Bacteria 3947
207 Ga0207687_10336770 3300025927 Unclassified 1225
208 Ga0207690_10125447 3300025932 Bacteria 1871
209 Ga0207706_10018763 3300025933 Bacteria 6222
210 Ga0207706_10100646 3300025933 Bacteria 2542
211 Ga0207709_10077174 3300025935 Bacteria 2135
212 Ga0207670_10066318 3300025936 Bacteria 2480
213 Ga0207669_10792181 3300025937 Bacteria 785
214 Ga0207704_10313367 3300025938 Unclassified 1207
215 Ga0207704_10366548 3300025938 Bacteria 1126
216 Ga0207691_10002139 3300025940 Bacteria 19338
217 Ga0207691_10029681 3300025940 Bacteria 5114
218 Ga0207691_10031890 3300025940 Bacteria 4918
219 Ga0207711_10010927 3300025941 Bacteria 7546
220 Ga0207711_10080600 3300025941 Bacteria 2843
221 Ga0207711_10243252 3300025941 Unclassified 1650
222 Ga0207661_10347509 3300025944 Unclassified 1337
223 Ga0207679_10030768 3300025945 Bacteria 3752
224 Ga0207679_10101216 3300025945 Bacteria 2254
225 Ga0207679_10309231 3300025945 Unclassified 1365
226 Ga0207679_10621170 3300025945 Bacteria 975
227 Ga0207667_10273569 3300025949 Bacteria 1726
228 Ga0207667_11604366 3300025949 Bacteria 619
229 Ga0207651_10105893 3300025960 Bacteria 2099
230 Ga0207668_10451653 3300025972 Bacteria 1097
231 Ga0207668_10544497 3300025972 Unclassified 1004
232 Ga0207640_10367104 3300025981 Unclassified 1162
233 Ga0207658_10107179 3300025986 Bacteria 2201
234 Ga0207658_10218182 3300025986 Bacteria 1603
235 Ga0207658_10353925 3300025986 Unclassified 1279
236 Ga0207658_10850400 3300025986 Bacteria 829
237 Ga0207677_10011335 3300026023 Bacteria 5078
238 Ga0207677_10217574 3300026023 Bacteria 1530
239 Ga0207703_10001102 3300026035 Bacteria 25601
240 Ga0207703_10170639 3300026035 Unclassified 1913
241 Ga0207678_10052194 3300026067 Bacteria 3528
242 Ga0207678_10156713 3300026067 Bacteria 1944
243 Ga0207708_10180945 3300026075 Bacteria 1674
244 Ga0207702_10004883 3300026078 Bacteria 11799
245 Ga0207702_10157494 3300026078 Bacteria 2071
246 Ga0207641_10028772 3300026088 Bacteria 4594
247 Ga0207641_10030206 3300026088 Bacteria 4487
248 Ga0207641_10156949 3300026088 Bacteria 2065
249 Ga0207648_10012543 3300026089 Bacteria 7928
250 Ga0207648_10049713 3300026089 Bacteria 3667
251 Ga0207648_10109707 3300026089 Bacteria 2422
252 Ga0207676_10035266 3300026095 Bacteria 3795
253 Ga0207676_10139393 3300026095 Bacteria 2074
254 Ga0207676_10605978 3300026095 Unclassified 1052
255 Ga0207675_100007729 3300026118 Bacteria 10146
256 Ga0207683_10018038 3300026121 Bacteria 6018
257 Ga0207683_10024187 3300026121 Bacteria 5228
258 Ga0207683_11640207 3300026121 Bacteria 592
259 Ga0207698_10180262 3300026142 Bacteria 1870
260 Ga0209968_1004919 3300027526 Bacteria 2004
261 Ga0268266_10028628 3300028379 Bacteria 4734
262 Ga0268266_10156236 3300028379 Bacteria 2060
263 Ga0268266_10306968 3300028379 Unclassified 1482
264 Ga0268266_10450246 3300028379 Unclassified 1224
265 Ga0268265_10465822 3300028380 Unclassified 1183
266 Ga0268264_10001715 3300028381 Bacteria 20197
267 Ga0268264_10139152 3300028381 Bacteria 2162
268 Ga0268264_10691326 3300028381 Unclassified 1012
269 Ga0265330_10023989 3300031235 Bacteria 2767
270 Ga0265316_10238562 3300031344 Bacteria 1337
271 Ga0265342_10077157 3300031712 Bacteria 1930
272 Ga0373957_0345501 3300035120 Bacteria 635
273 Ga0373955_0083478 3300035172 Bacteria 1810
274 Ga0373955_0108144 3300035172 Bacteria 1605
275 Ga0373955_0161318 3300035172 Unclassified 1323
276 Ga0373933_0192869 3300035724 Bacteria 1302
277 Ga0373937_0004216 3300036401 Bacteria 12193
278 Ga0373937_0016770 3300036401 Bacteria 6511
279 Ga0373937_0039239 3300036401 Bacteria 4316
280 Ga0373937_0515592 3300036401 Bacteria 1136
281 Ga0373937_1245439 3300036401 Unclassified 692
282 Ga0316584_0320757 3300036712 Bacteria 1118
283 Ga0373925_0243921 3300037068 Bacteria 1440
284 Ga0373925_1442931 3300037068 Viruses 564
285 Ga0495603_0279309 3300046455 Unclassified 960
286 Ga0495629_0088867 3300046459 Bacteria 2155
287 Ga0495629_0089060 3300046459 Bacteria 2153
288 Ga0495629_0547119 3300046459 Unclassified 777
289 Ga0495653_0486924 3300046463 Bacteria 771
290 Ga0495580_0000111 3300046472 Bacteria 55138
291 Ga0495580_0025224 3300046472 Bacteria 4346
292 Ga0495580_0048555 3300046472 Bacteria 3005
293 Ga0495580_0337772 3300046472 Bacteria 1022
294 Ga0495580_0532520 3300046472 Unclassified 782
295 Ga0495582_0449028 3300046473 Bacteria 744
296 Ga0495594_0425418 3300046499 Unclassified 755
297 Ga0495618_0564999 3300046514 Unclassified 680
298 Ga0495665_0114754 3300046531 Bacteria 1412
299 Ga0495633_0072345 3300046558 Unclassified 1608
300 Ga0495667_0480710 3300046559 Bacteria 779
301 Ga0495667_0496177 3300046559 Bacteria 765
302 Ga0495588_0530814 3300046674 Bacteria 617
303 Ga0495623_0203093 3300046679 Unclassified 1138
304 Ga0495647_0013801 3300046681 Bacteria 2806
305 Ga0495647_0021789 3300046681 Unclassified 2311
306 Ga0495647_0057123 3300046681 Bacteria 1531
307 Ga0495647_0250077 3300046681 Bacteria 789
308 Ga0495658_0065699 3300046683 Bacteria 2093
309 Ga0495658_0081504 3300046683 Unclassified 1900
310 Ga0495658_0149746 3300046683 Archaea 1432
311 Ga0495658_0414433 3300046683 Unclassified 859
312 Ga0495658_0589562 3300046683 Bacteria 712
313 Ga0495613_0187538 3300046689 Bacteria 1463
314 Ga0495613_0441360 3300046689 Viruses 883
315 Ga0495600_0190245 3300046809 Bacteria 1320
316 Ga0495684_0080160 3300047471 Bacteria 2478
317 Ga0495684_0588824 3300047471 Bacteria 752
318 Ga0495593_0335270 3300047673 Bacteria 756
319 Ga0495602_0492713 3300048088 Bacteria 858
320 Ga0496100_0248720 3300048903 Bacteria 1314
321 Ga0496101_0002707 3300048904 Bacteria 10874
322 Ga0496102_0001300 3300048905 Bacteria 22454
323 Ga0496103_0122910 3300048906 Bacteria 1654
324 Ga0496104_0186486 3300048907 Bacteria 1985
325 Ga0496106_0000994 3300048909 Bacteria 20706
326 Ga0496106_0829592 3300048909 Bacteria 732
327 Ga0496107_0001103 3300048910 Bacteria 16250
328 Ga0496108_0011695 3300048911 Bacteria 7139
329 Ga0496108_0746571 3300048911 Bacteria 847
330 Ga0496109_0082620 3300048912 Bacteria 2961
331 Ga0496109_0101808 3300048912 Bacteria 2666
332 Ga0496109_0745932 3300048912 Unclassified 917
333 Ga0496110_0128819 3300048913 Bacteria 2284
334 Ga0496110_0926488 3300048913 Bacteria 778
335 Ga0496111_0039690 3300048914 Bacteria 3377
336 Ga0496111_0130315 3300048914 Bacteria 1861
337 Ga0496112_0308236 3300048915 Bacteria 1528
338 Ga0496113_0158201 3300048916 Bacteria 1790
339 Ga0496114_0515261 3300048917 Bacteria 1058
340 Ga0496115_0814790 3300048918 Bacteria 726
341 Ga0501040_0557352 3300049576 Bacteria 827
342 Ga0501040_1211844 3300049576 Bacteria 548
343 Ga0501041_0872222 3300049577 Bacteria 578
344 Ga0501042_1226373 3300049578 Bacteria 547
345 Ga0501069_0515304 3300049585 Unclassified 714
346 Ga0501071_0541088 3300049587 Bacteria 894
347 Ga0501075_0086793 3300049591 Bacteria 2371
348 Ga0501075_0097701 3300049591 Bacteria 2229
349 Ga0501075_0512578 3300049591 Bacteria 915
350 Ga0501076_0113951 3300049592 Bacteria 2187
351 Ga0501076_0212387 3300049592 Bacteria 1581
352 Ga0501079_0238462 3300049741 Bacteria 1421
353 Ga0501080_0263907 3300049742 Bacteria 1568
354 Ga0501081_0038166 3300049743 Bacteria 3280
355 Ga0501081_0086989 3300049743 Bacteria 2195
356 Ga0501081_0206928 3300049743 Bacteria 1424
357 Ga0501081_0268312 3300049743 Bacteria 1248
358 Ga0501081_0587843 3300049743 Bacteria 833
359 Ga0501081_1073331 3300049743 Bacteria 609
360 nmdc:mga05p37_172093_c1 3300050507 Bacteria 2641
361 nmdc:mga05p37_38150_c1 3300050507 Bacteria 5891
362 nmdc:mga05p37_46142_c1 3300050507 Bacteria 5358
363 nmdc:mga09592_589876_c1 3300050508 Bacteria 953
364 nmdc:mga0qj67_7411_c1 3300050509 Bacteria 8111
365 nmdc:mga06r32_508177_c1 3300050510 Bacteria 1182
366 nmdc:mga08y16_118244_c1 3300050511 Bacteria 2758
367 nmdc:mga0n895_22753_c1 3300050512 Bacteria 5878
368 nmdc:mga0n895_521907_c1 3300050512 Unclassified 1195
369 nmdc:mga0rr50_1199911_c1 3300050513 Bacteria 645
370 nmdc:mga0rr50_910550_c1 3300050513 Unclassified 750
371 nmdc:mga08x19_62147_c1 3300050514 Bacteria 2421
372 nmdc:mga0a205_76777_c1 3300050515 Bacteria 3229
373 Ga0495601_0049920 3300053077 Bacteria 2639
374 Ga0495612_0132469 3300053078 Bacteria 1078
375 Ga0495595_0216607 3300053084 Bacteria 955
376 Ga0495619_0037710 3300053085 Bacteria 3151
377 Ga0495619_0616149 3300053085 Bacteria 742
378 Ga0501084_0061234 3300054114 Bacteria 3151
379 Ga0501082_0409801 3300060353 Bacteria 1183
380 Ga0530510_0251894 3300061734 Unclassified 1316
381 Ga0105241_10452932
382 JGI25406J46586_10083898
383 Ga0070690_100000280
384 Ga0070670_100008461
385 Ga0070670_100011198
386 Ga0070677_10028125
387 Ga0068869_100480113
388 Ga0070666_10000124
389 Ga0070666_10001445
390 Ga0070666_10021108
391 Ga0068868_100020997
392 Ga0068868_100127197
393 Ga0068868_100875445
394 Ga0070689_100025349
395 Ga0070661_100021850
396 Ga0070668_100108071
397 Ga0070668_100204959
398 Ga0070669_101490926
399 Ga0070675_100023570
400 Ga0070675_100042760
401 Ga0070671_100665613
402 Ga0070674_100167676
403 Ga0070673_100003012
404 Ga0070673_100109516
405 Ga0070688_100055313
406 Ga0070667_100001154
407 Ga0070667_100019513
408 Ga0070667_100064775
409 Ga0070667_100381518
410 Ga0070709_10285554
411 Ga0070709_10313460
412 Ga0070710_10182555
413 Ga0070710_10574046
414 Ga0070711_100105487
415 Ga0070711_100667885
416 Ga0070694_100768146
417 Ga0070708_100102052
418 Ga0070708_100443117
419 Ga0070663_100034410
420 Ga0070663_100305481
421 Ga0070663_100354942
422 Ga0070678_100022055
423 Ga0070678_100031768
424 Ga0070662_100080395
425 Ga0070662_100094450
426 Ga0070681_10106858
427 Ga0068867_100008590
428 Ga0068867_100057609
429 Ga0068867_100129729
430 Ga0070685_10144819
431 Ga0070685_10290352
432 Ga0070706_100002585
433 Ga0070706_100006334
434 Ga0070706_100007815
435 Ga0070706_100470735
436 Ga0070706_101811700
437 Ga0070707_100023595
438 Ga0070707_100226515
439 Ga0070707_101373831
440 Ga0070698_100000505
441 Ga0070698_100052053
442 Ga0070679_100043603
443 Ga0070697_100034494
444 Ga0070697_101053563
445 Ga0070672_100020424
446 Ga0070672_100141078
447 Ga0070686_100540162
448 Ga0070695_100639300
449 Ga0070665_100011503
450 Ga0070665_100026081
451 Ga0070665_100074511
452 Ga0070704_100236517
453 Ga0070664_100005721
454 Ga0070664_100096008
455 Ga0070664_100405923
456 Ga0068854_100006734
457 Ga0068856_100031268
458 Ga0068856_100169470
459 Ga0070702_100197260
460 Ga0068852_100057686
461 Ga0068859_100001014
462 Ga0068859_100068001
463 Ga0068859_101115075
464 Ga0068864_100018546
465 Ga0068864_100140580
466 Ga0068864_100435863
467 Ga0068861_100055986
468 Ga0068870_10022094
469 Ga0068870_11080501
470 Ga0068863_100012687
471 Ga0068863_100021092
472 Ga0068863_100054767
473 Ga0068858_100000656
474 Ga0068858_100062933
475 Ga0068858_100176640
476 Ga0068858_100273024
477 Ga0068858_101008900
478 Ga0068860_100001089
479 Ga0068860_100108044
480 Ga0068860_100652035
481 Ga0068860_100695591
482 Ga0068860_101102282
483 Ga0068862_100067450
484 Ga0070712_100278061
485 Ga0097621_100050660
486 Ga0097621_100330613
487 Ga0068871_100054456
488 Ga0068871_100210152
489 Ga0075428_100550227
490 Ga0075430_100055619
491 Ga0075431_100079901
492 Ga0075431_100374075
493 Ga0075433_10015695
494 Ga0075434_100024535
495 Ga0075434_100226226
496 Ga0075429_100030459
497 Ga0068865_100219456
498 Ga0068865_100232330
499 Ga0075436_100025535
500 Ga0075436_100323882
501 Ga0097620_100001014
502 Ga0097620_100068001
503 Ga0097620_101115218
504 Ga0075435_101374450
505 Ga0075435_101435733
506 Ga0105251_10163740
507 Ga0111539_10064411
508 Ga0105245_10015621
509 Ga0105245_10129781
510 Ga0105245_10515872
511 Ga0105245_11191894
512 Ga0114129_10013672
513 Ga0114129_10016013
514 Ga0114129_10331533
515 Ga0105243_10062024
516 Ga0105243_10102239
517 Ga0105241_10139493
518 Ga0105241_10308961
519 Ga0105241_11240601
520 Ga0105242_10367633
521 Ga0105248_10051214
522 Ga0105248_10120334
523 Ga0105248_10233667
524 Ga0105248_10558312
525 Ga0105237_10000051
526 Ga0105237_10032765
527 Ga0105238_10022943
528 Ga0105238_10536580
529 Ga0105239_10546646
530 Ga0157370_10236189
531 Ga0157369_10403674
532 Ga0157374_10005700
533 Ga0157374_10072945
534 Ga0157378_10006864
535 Ga0157378_10195354
536 Ga0163162_10222192
537 Ga0157372_10473127
538 Ga0157375_10000201
539 Ga0157375_10011338
540 Ga0157375_10020568
541 Ga0157375_10033442
542 Ga0157375_10470337
543 Ga0163163_10048840
544 Ga0163163_10055107
545 Ga0163163_10522413
546 Ga0163163_12332391
547 Ga0157380_10112208
548 Ga0157377_10090592
549 Ga0157377_10764416
550 Ga0157379_10075703
551 Ga0157379_10077348
552 Ga0157379_10183533
553 Ga0157376_10007310
554 Ga0157376_10137040
555 Ga0206354_11287948
556 Ga0206353_10010820
557 Ga0224712_10233683
558 Ga0207682_10003540
559 Ga0207692_10760667
560 Ga0207692_10911758
561 Ga0207688_10232206
562 Ga0207680_10001660
563 Ga0207680_10013678
564 Ga0207680_10019290
565 Ga0207699_10135512
566 Ga0207699_10259463
567 Ga0207645_10002788
568 Ga0207643_10004316
569 Ga0207684_10001478
570 Ga0207684_10038376
571 Ga0207684_10121996
572 Ga0207654_10622987
573 Ga0207695_10036112
574 Ga0207671_10000040
575 Ga0207671_10247614
576 Ga0207693_10189643
577 Ga0207649_10118022
578 Ga0207646_10058739
579 Ga0207646_10676815
580 Ga0207681_10000012
581 Ga0207694_10023356
582 Ga0207650_10032266
583 Ga0207650_10037229
584 Ga0207659_10069568
585 Ga0207659_10421782
586 Ga0207687_10025607
587 Ga0207687_10336770
588 Ga0207690_10125447
589 Ga0207706_10018763
590 Ga0207706_10100646
591 Ga0207709_10077174
592 Ga0207670_10066318
593 Ga0207669_10792181
594 Ga0207704_10313367
595 Ga0207704_10366548
596 Ga0207691_10002139
597 Ga0207691_10029681
598 Ga0207691_10031890
599 Ga0207711_10010927
600 Ga0207711_10080600
601 Ga0207711_10243252
602 Ga0207661_10347509
603 Ga0207679_10030768
604 Ga0207679_10101216
605 Ga0207679_10309231
606 Ga0207679_10621170
607 Ga0207667_10273569
608 Ga0207667_11604366
609 Ga0207651_10105893
610 Ga0207668_10451653
611 Ga0207668_10544497
612 Ga0207640_10367104
613 Ga0207658_10107179
614 Ga0207658_10218182
615 Ga0207658_10353925
616 Ga0207658_10850400
617 Ga0207677_10011335
618 Ga0207677_10217574
619 Ga0207703_10001102
620 Ga0207703_10170639
621 Ga0207678_10052194
622 Ga0207678_10156713
623 Ga0207708_10180945
624 Ga0207702_10004883
625 Ga0207702_10157494
626 Ga0207641_10028772
627 Ga0207641_10030206
628 Ga0207641_10156949
629 Ga0207648_10012543
630 Ga0207648_10049713
631 Ga0207648_10109707
632 Ga0207676_10035266
633 Ga0207676_10139393
634 Ga0207676_10605978
635 Ga0207675_100007729
636 Ga0207683_10018038
637 Ga0207683_10024187
638 Ga0207683_11640207
639 Ga0207698_10180262
640 Ga0209968_1004919
641 Ga0268266_10028628
642 Ga0268266_10156236
643 Ga0268266_10306968
644 Ga0268266_10450246
645 Ga0268265_10465822
646 Ga0268264_10001715
647 Ga0268264_10139152
648 Ga0268264_10691326
649 Ga0265330_10023989
650 Ga0265316_10238562
651 Ga0265342_10077157
652 Ga0373957_0345501
653 Ga0373955_0083478
654 Ga0373955_0108144
655 Ga0373955_0161318
656 Ga0373933_0192869
657 Ga0373937_0004216
658 Ga0373937_0016770
659 Ga0373937_0039239
660 Ga0373937_0515592
661 Ga0373937_1245439
662 Ga0316584_0320757
663 Ga0373925_0243921
664 Ga0373925_1442931
665 Ga0495603_0279309
666 Ga0495629_0088867
667 Ga0495629_0089060
668 Ga0495629_0547119
669 Ga0495653_0486924
670 Ga0495580_0000111
671 Ga0495580_0025224
672 Ga0495580_0048555
673 Ga0495580_0337772
674 Ga0495580_0532520
675 Ga0495582_0449028
676 Ga0495594_0425418
677 Ga0495618_0564999
678 Ga0495665_0114754
679 Ga0495633_0072345
680 Ga0495667_0480710
681 Ga0495667_0496177
682 Ga0495588_0530814
683 Ga0495623_0203093
684 Ga0495647_0013801
685 Ga0495647_0021789
686 Ga0495647_0057123
687 Ga0495647_0250077
688 Ga0495658_0065699
689 Ga0495658_0081504
690 Ga0495658_0149746
691 Ga0495658_0414433
692 Ga0495658_0589562
693 Ga0495613_0187538
694 Ga0495613_0441360
695 Ga0495600_0190245
696 Ga0495684_0080160
697 Ga0495684_0588824
698 Ga0495593_0335270
699 Ga0495602_0492713
700 Ga0496100_0248720
701 Ga0496101_0002707
702 Ga0496102_0001300
703 Ga0496103_0122910
704 Ga0496104_0186486
705 Ga0496106_0000994
706 Ga0496106_0829592
707 Ga0496107_0001103
708 Ga0496108_0011695
709 Ga0496108_0746571
710 Ga0496109_0082620
711 Ga0496109_0101808
712 Ga0496109_0745932
713 Ga0496110_0128819
714 Ga0496110_0926488
715 Ga0496111_0039690
716 Ga0496111_0130315
717 Ga0496112_0308236
718 Ga0496113_0158201
719 Ga0496114_0515261
720 Ga0496115_0814790
721 Ga0501040_0557352
722 Ga0501040_1211844
723 Ga0501041_0872222
724 Ga0501042_1226373
725 Ga0501069_0515304
726 Ga0501071_0541088
727 Ga0501075_0086793
728 Ga0501075_0097701
729 Ga0501075_0512578
730 Ga0501076_0113951
731 Ga0501076_0212387
732 Ga0501079_0238462
733 Ga0501080_0263907
734 Ga0501081_0038166
735 Ga0501081_0086989
736 Ga0501081_0206928
737 Ga0501081_0268312
738 Ga0501081_0587843
739 Ga0501081_1073331
740 nmdc:mga05p37_172093_c1
741 nmdc:mga05p37_38150_c1
742 nmdc:mga05p37_46142_c1
743 nmdc:mga09592_589876_c1
744 nmdc:mga0qj67_7411_c1
745 nmdc:mga06r32_508177_c1
746 nmdc:mga08y16_118244_c1
747 nmdc:mga0n895_22753_c1
748 nmdc:mga0n895_521907_c1
749 nmdc:mga0rr50_1199911_c1
750 nmdc:mga0rr50_910550_c1
751 nmdc:mga08x19_62147_c1
752 nmdc:mga0a205_76777_c1
753 Ga0495601_0049920
754 Ga0495612_0132469
755 Ga0495595_0216607
756 Ga0495619_0037710
757 Ga0495619_0616149
758 Ga0501084_0061234
759 Ga0501082_0409801
760 Ga0530510_0251894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

37

135

0.93

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

17

101

0.85

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

27

140

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_D-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.9152 44 167
6af2-assembly1.cif.gz_A crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.9092 44 168
6af2-assembly1.cif.gz_C crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8904 25 168
3wo5-assembly1.cif.gz_B-2 crystal structure of s147q of rv2613c from mycobacterium tuberculosis 0.8868 29 167
6af2-assembly1.cif.gz_B-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.884 26 168
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9367 44 134 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9243 65 137 3.30.428.10
2fhiA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8755 44 163 3.30.428.10
3wo5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8666 23 167 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8652 32 137 3.30.428.10
ID Description Score Start End GO Terms
AF-E8WT57-F1-model_v4 Histidine triad (HIT) protein 0.9419 44 138 GO:0000166
GO:0003824
AF-A0A382C948-F1-model_v4 HIT domain-containing protein 0.9394 44 134 GO:0003824
AF-A0A1V5IJS7-F1-model_v4 Purine nucleoside phosphoramidase 0.9379 44 138 GO:0003824
AF-A0A6N7FQV9-F1-model_v4 HIT domain-containing protein 0.9369 44 138 GO:0003824
AF-A0A7Z9Q002-F1-model_v4 HIT domain-containing protein 0.9305 44 138 GO:0003824
GO:0006793

Map