F428589

General Info

Members Datasets Scaffolds Average Seq Length
380 198 760 394

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100060456|Ga0070698_1000604562
Length 448
Sequence MHVTAIIAAGGRGERFGGAQPKQLLAVGGRPILERSVAAFLAHPSVDAVVVALPQALADDPPEYLRSAKAFALQQDGRSASLSGERNKTLRIVAGGERRQDSVANAFRAADAKSDVIVIHDAARPFASADLISRTIAAAAESGAALAAIQARDTVKRVAGGPAKAGRHDAGGAPAAQSDVVSGFSTDVASAESVSRTVAETLPRETIFLAQTPQAFRRQVLADALKLADAATDEAALAERAGHPVRLVDGEATNIKITTPEDLAIAEAIAAITNQSTIXXQHSTISRPARTGRAGTGYDLHRLVEGRPLVIGGVTIPSDRGALGHSDADVVCHAITDAILGAACLGDIGRHFPDSDPQWKNASSIDLLRRAAALAGEQRFEVGNVDVTVILERPKITDHVDAMRANVAAAIGIDVDRVSIKGKTNEGVDAIGRGEAIAAHAIALIRAI

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
125 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.42
Nodule 0
Rhizoplane 3.95
Rhizosphere 92.63
Stem 0
Stem Tuber 0
Unclassified 4.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100060456 3300005471 Bacteria 3824
2 Ga0065712_10071660 3300005290 Bacteria 5120
3 Ga0065712_10075884 3300005290 Bacteria 3770
4 Ga0065715_10019473 3300005293 Bacteria 2339
5 Ga0065707_10134857 3300005295 Bacteria 1859
6 Ga0070676_10017460 3300005328 Bacteria 3972
7 Ga0070683_100000094 3300005329 Bacteria 58242
8 Ga0070683_100024706 3300005329 Bacteria 5385
9 Ga0070690_100033060 3300005330 Bacteria 3235
10 Ga0070670_100013591 3300005331 Bacteria 6978
11 Ga0070670_100018452 3300005331 Bacteria 5986
12 Ga0070677_10026045 3300005333 Bacteria 2190
13 Ga0070666_10014193 3300005335 Bacteria 5069
14 Ga0070666_10091381 3300005335 Unclassified 2091
15 Ga0068868_100017620 3300005338 Bacteria 5326
16 Ga0070689_100246457 3300005340 Bacteria 1473
17 Ga0070691_10030595 3300005341 Bacteria 2522
18 Ga0070661_100022927 3300005344 Bacteria 4472
19 Ga0070668_100124957 3300005347 Bacteria 2060
20 Ga0070669_100001826 3300005353 Bacteria 15339
21 Ga0070669_100031377 3300005353 Bacteria 3839
22 Ga0070675_100003283 3300005354 Bacteria 12267
23 Ga0070675_100068220 3300005354 Bacteria 2945
24 Ga0070671_100039024 3300005355 Bacteria 3942
25 Ga0070674_100018130 3300005356 Bacteria 4444
26 Ga0070673_100009823 3300005364 Bacteria 6445
27 Ga0070673_100012525 3300005364 Bacteria 5826
28 Ga0070673_100149364 3300005364 Bacteria 1978
29 Ga0070688_100021368 3300005365 Bacteria 3780
30 Ga0070709_10189437 3300005434 Bacteria 1450
31 Ga0070714_100052069 3300005435 Bacteria 3491
32 Ga0070701_10056265 3300005438 Unclassified 2057
33 Ga0070705_100016927 3300005440 Bacteria 3797
34 Ga0070700_100015383 3300005441 Bacteria 4336
35 Ga0070694_100008663 3300005444 Bacteria 6230
36 Ga0070694_100186824 3300005444 Bacteria 1536
37 Ga0070663_100008778 3300005455 Bacteria 6234
38 Ga0070663_100068871 3300005455 Bacteria 2569
39 Ga0070662_100077505 3300005457 Bacteria 2467
40 Ga0070662_100102749 3300005457 Unclassified 2166
41 Ga0068867_100036196 3300005459 Bacteria 3581
42 Ga0070685_10110811 3300005466 Bacteria 1690
43 Ga0070706_100038062 3300005467 Bacteria 4442
44 Ga0070707_100204633 3300005468 Bacteria 1924
45 Ga0070707_100226595 3300005468 Bacteria 1820
46 Ga0070698_100045451 3300005471 Bacteria 4494
47 Ga0070698_100151024 3300005471 Bacteria 2271
48 Ga0070679_100103364 3300005530 Bacteria 2835
49 Ga0070679_100326601 3300005530 Bacteria 1483
50 Ga0070684_100006365 3300005535 Bacteria 9130
51 Ga0068853_100327405 3300005539 Bacteria 1421
52 Ga0070672_100036831 3300005543 Bacteria 3730
53 Ga0070686_100000486 3300005544 Bacteria 24080
54 Ga0070686_100022667 3300005544 Bacteria 3744
55 Ga0070686_100180746 3300005544 Bacteria 1498
56 Ga0070695_100004225 3300005545 Bacteria 8406
57 Ga0070695_100011528 3300005545 Bacteria 5287
58 Ga0070696_100038380 3300005546 Bacteria 3305
59 Ga0070696_100140456 3300005546 Bacteria 1765
60 Ga0070665_100001142 3300005548 Bacteria 32621
61 Ga0070665_100010573 3300005548 Bacteria 9341
62 Ga0070665_100140845 3300005548 Bacteria 2415
63 Ga0070704_100055636 3300005549 Bacteria 2806
64 Ga0068855_100030065 3300005563 Bacteria 6496
65 Ga0070664_100000479 3300005564 Bacteria 30222
66 Ga0068854_100025415 3300005578 Bacteria 4063
67 Ga0068859_100077049 3300005617 Bacteria 3375
68 Ga0068859_100163549 3300005617 Bacteria 2304
69 Ga0068864_100022888 3300005618 Bacteria 5242
70 Ga0068864_100033968 3300005618 Bacteria 4337
71 Ga0068864_100043580 3300005618 Bacteria 3842
72 Ga0068861_100065087 3300005719 Bacteria 2807
73 Ga0068861_100191080 3300005719 Bacteria 1711
74 Ga0068863_100002641 3300005841 Bacteria 17739
75 Ga0068858_100003549 3300005842 Bacteria 15439
76 Ga0068858_100019034 3300005842 Bacteria 6424
77 Ga0068860_100064076 3300005843 Bacteria 3491
78 Ga0068860_100252401 3300005843 Bacteria 1718
79 Ga0068860_100307270 3300005843 Bacteria 1555
80 Ga0068862_100208911 3300005844 Bacteria 1763
81 Ga0068862_100224843 3300005844 Bacteria 1701
82 Ga0081455_10014307 3300005937 Bacteria 7785
83 Ga0075365_10011728 3300006038 Bacteria 5167
84 Ga0075368_10007369 3300006042 Bacteria 3879
85 Ga0075364_10009447 3300006051 Bacteria 5853
86 Ga0075432_10009737 3300006058 Bacteria 3270
87 Ga0075362_10002121 3300006177 Bacteria 6550
88 Ga0075366_10016608 3300006195 Bacteria 4232
89 Ga0075366_10055107 3300006195 Bacteria 2361
90 Ga0097621_100034096 3300006237 Bacteria 4058
91 Ga0075370_10072177 3300006353 Bacteria 1976
92 Ga0075428_100003278 3300006844 Bacteria 17699
93 Ga0075428_100006407 3300006844 Bacteria 13096
94 Ga0075428_100008684 3300006844 Bacteria 11272
95 Ga0075428_100011207 3300006844 Bacteria 9977
96 Ga0075428_100040779 3300006844 Bacteria 5107
97 Ga0075428_100138017 3300006844 Bacteria 2651
98 Ga0075428_100174086 3300006844 Bacteria 2332
99 Ga0075428_100179549 3300006844 Bacteria 2292
100 Ga0075430_100006929 3300006846 Bacteria 9552
101 Ga0075430_100017575 3300006846 Bacteria 6090
102 Ga0075430_100030132 3300006846 Bacteria 4607
103 Ga0075430_100102420 3300006846 Bacteria 2390
104 Ga0075431_100010222 3300006847 Bacteria 9436
105 Ga0075431_100016629 3300006847 Bacteria 7467
106 Ga0075431_100023957 3300006847 Bacteria 6249
107 Ga0075431_100285982 3300006847 Bacteria 1669
108 Ga0075433_10012684 3300006852 Bacteria 6819
109 Ga0075433_10170686 3300006852 Bacteria 1936
110 Ga0075434_100004448 3300006871 Bacteria 12637
111 Ga0075434_100011873 3300006871 Bacteria 8235
112 Ga0075434_100027951 3300006871 Bacteria 5537
113 Ga0075434_100107854 3300006871 Bacteria 2795
114 Ga0075429_100017917 3300006880 Bacteria 6123
115 Ga0075429_100024781 3300006880 Bacteria 5207
116 Ga0075429_100120001 3300006880 Unclassified 2298
117 Ga0075429_100129658 3300006880 Bacteria 2206
118 Ga0075436_100004960 3300006914 Bacteria 9147
119 Ga0075436_100027940 3300006914 Bacteria 3884
120 Ga0097620_100077051 3300006931 Bacteria 3375
121 Ga0097620_100163555 3300006931 Bacteria 2304
122 Ga0075435_100000342 3300007076 Bacteria 28702
123 Ga0075435_100002624 3300007076 Bacteria 11969
124 Ga0075435_100007253 3300007076 Bacteria 7892
125 Ga0075435_100009945 3300007076 Bacteria 6927
126 Ga0075435_100024657 3300007076 Bacteria 4671
127 Ga0075435_100153786 3300007076 Bacteria 1935
128 Ga0105240_10067634 3300009093 Bacteria 4428
129 Ga0111539_10000782 3300009094 Bacteria 41367
130 Ga0111539_10006147 3300009094 Bacteria 15502
131 Ga0111539_10009526 3300009094 Bacteria 12259
132 Ga0111539_10017454 3300009094 Bacteria 8885
133 Ga0111539_10031704 3300009094 Bacteria 6420
134 Ga0111539_10039107 3300009094 Bacteria 5719
135 Ga0111539_10078023 3300009094 Bacteria 3897
136 Ga0111539_10107199 3300009094 Bacteria 3278
137 Ga0105245_10027005 3300009098 Bacteria 5056
138 Ga0105245_10207174 3300009098 Bacteria 1886
139 Ga0105247_10033647 3300009101 Bacteria 3118
140 Ga0114129_10000509 3300009147 Bacteria 47512
141 Ga0114129_10001561 3300009147 Bacteria 31102
142 Ga0114129_10001667 3300009147 Bacteria 30241
143 Ga0114129_10009415 3300009147 Bacteria 13923
144 Ga0114129_10014680 3300009147 Bacteria 11160
145 Ga0114129_10020525 3300009147 Bacteria 9396
146 Ga0114129_10020539 3300009147 Bacteria 9394
147 Ga0114129_10029596 3300009147 Bacteria 7755
148 Ga0114129_10040307 3300009147 Bacteria 6584
149 Ga0114129_10041875 3300009147 Bacteria 6449
150 Ga0114129_10059145 3300009147 Bacteria 5358
151 Ga0114129_10062817 3300009147 Bacteria 5187
152 Ga0114129_10081065 3300009147 Bacteria 4511
153 Ga0114129_10082441 3300009147 Bacteria 4469
154 Ga0114129_10086004 3300009147 Bacteria 4362
155 Ga0114129_10118349 3300009147 Bacteria 3649
156 Ga0114129_10279610 3300009147 Bacteria 2230
157 Ga0105243_10021101 3300009148 Bacteria 4943
158 Ga0105243_10106095 3300009148 Bacteria 2341
159 Ga0105241_10257383 3300009174 Bacteria 1482
160 Ga0105242_10008251 3300009176 Bacteria 8001
161 Ga0105242_10024880 3300009176 Bacteria 4732
162 Ga0105248_10004266 3300009177 Bacteria 15819
163 Ga0105248_10025354 3300009177 Bacteria 6592
164 Ga0105248_10025846 3300009177 Bacteria 6530
165 Ga0105248_10026047 3300009177 Bacteria 6506
166 Ga0105248_10029719 3300009177 Bacteria 6098
167 Ga0105248_10045913 3300009177 Bacteria 4898
168 Ga0105248_10203538 3300009177 Unclassified 2230
169 Ga0157374_10010815 3300013296 Bacteria 7872
170 Ga0163162_10038396 3300013306 Bacteria 4779
171 Ga0163162_10147097 3300013306 Unclassified 2473
172 Ga0157372_10106318 3300013307 Bacteria 3210
173 Ga0157375_10157583 3300013308 Bacteria 2410
174 Ga0157375_10184768 3300013308 Bacteria 2237
175 Ga0163163_10022775 3300014325 Bacteria 5937
176 Ga0163163_10196738 3300014325 Bacteria 2064
177 Ga0157380_10021600 3300014326 Bacteria 4830
178 Ga0157380_10036565 3300014326 Bacteria 3800
179 Ga0157377_10016372 3300014745 Unclassified 3813
180 Ga0157379_10009065 3300014968 Bacteria 8670
181 Ga0157379_10028505 3300014968 Bacteria 4966
182 Ga0157376_10009009 3300014969 Bacteria 7228
183 Ga0157376_10062570 3300014969 Bacteria 3132
184 Ga0157376_10160548 3300014969 Bacteria 2037
185 Ga0207710_10061171 3300025900 Bacteria 1708
186 Ga0207645_10006056 3300025907 Bacteria 8695
187 Ga0207645_10022267 3300025907 Bacteria 4125
188 Ga0207645_10063812 3300025907 Bacteria 2354
189 Ga0207662_10018880 3300025918 Bacteria 3916
190 Ga0207646_10191156 3300025922 Bacteria 1849
191 Ga0207681_10002093 3300025923 Bacteria 12782
192 Ga0207681_10006653 3300025923 Bacteria 7098
193 Ga0207681_10058668 3300025923 Bacteria 2636
194 Ga0207650_10011879 3300025925 Bacteria 6000
195 Ga0207650_10077357 3300025925 Bacteria 2515
196 Ga0207659_10002281 3300025926 Bacteria 11427
197 Ga0207659_10156528 3300025926 Bacteria 1785
198 Ga0207644_10077224 3300025931 Bacteria 2452
199 Ga0207690_10183828 3300025932 Bacteria 1576
200 Ga0207706_10047583 3300025933 Bacteria 3794
201 Ga0207706_10077323 3300025933 Bacteria 2927
202 Ga0207686_10011990 3300025934 Bacteria 4758
203 Ga0207691_10005509 3300025940 Bacteria 12231
204 Ga0207691_10035445 3300025940 Bacteria 4631
205 Ga0207691_10125114 3300025940 Bacteria 2275
206 Ga0207711_10052635 3300025941 Bacteria 3490
207 Ga0207689_10070281 3300025942 Bacteria 2876
208 Ga0207689_10078607 3300025942 Bacteria 2711
209 Ga0207661_10004428 3300025944 Bacteria 9857
210 Ga0207661_10129537 3300025944 Unclassified 2159
211 Ga0207679_10029717 3300025945 Bacteria 3807
212 Ga0207679_10068517 3300025945 Bacteria 2666
213 Ga0207640_10005617 3300025981 Bacteria 6838
214 Ga0207658_10099263 3300025986 Bacteria 2277
215 Ga0207703_10011797 3300026035 Bacteria 6802
216 Ga0207639_10319664 3300026041 Bacteria 1378
217 Ga0207708_10006630 3300026075 Bacteria 8570
218 Ga0207708_10023752 3300026075 Bacteria 4635
219 Ga0207708_10034704 3300026075 Bacteria 3837
220 Ga0207641_10006730 3300026088 Bacteria 9631
221 Ga0207641_10090587 3300026088 Bacteria 2675
222 Ga0207641_10205679 3300026088 Bacteria 1818
223 Ga0207648_10006114 3300026089 Bacteria 12004
224 Ga0207648_10193383 3300026089 Bacteria 1804
225 Ga0207676_10007127 3300026095 Bacteria 7919
226 Ga0207676_10041996 3300026095 Bacteria 3515
227 Ga0207675_100006610 3300026118 Bacteria 10968
228 Ga0207675_100064681 3300026118 Bacteria 3419
229 Ga0207675_100089832 3300026118 Bacteria 2888
230 Ga0207675_100092574 3300026118 Bacteria 2843
231 Ga0207675_100142432 3300026118 Bacteria 2278
232 Ga0207428_10000515 3300027907 Bacteria 46261
233 Ga0207428_10003949 3300027907 Bacteria 14224
234 Ga0207428_10006925 3300027907 Bacteria 10390
235 Ga0207428_10020107 3300027907 Bacteria 5680
236 Ga0207428_10049604 3300027907 Bacteria 3362
237 Ga0207428_10150237 3300027907 Bacteria 1773
238 Ga0268266_10006352 3300028379 Bacteria 10833
239 Ga0268266_10026746 3300028379 Bacteria 4909
240 Ga0268265_10001769 3300028380 Bacteria 17327
241 Ga0268265_10016572 3300028380 Bacteria 5066
242 Ga0268265_10110723 3300028380 Bacteria 2241
243 Ga0268264_10128129 3300028381 Bacteria 2246
244 Ga0268264_10213363 3300028381 Bacteria 1773
245 Ga0265328_10027580 3300031239 Bacteria 2128
246 Ga0307408_100010625 3300031548 Bacteria 6073
247 Ga0265314_10039279 3300031711 Bacteria 3411
248 Ga0307409_100073314 3300031995 Bacteria 2730
249 Ga0307409_100079588 3300031995 Bacteria 2642
250 Ga0307416_100009990 3300032002 Bacteria 6246
251 Ga0307416_100020984 3300032002 Bacteria 4677
252 Ga0307416_100256003 3300032002 Bacteria 1707
253 Ga0307411_10096501 3300032005 Bacteria 2078
254 Ga0373930_0001454 3300034816 Bacteria 3530
255 Ga0373959_0000462 3300034820 Bacteria 7521
256 Ga0373928_0001762 3300035084 Bacteria 4215
257 Ga0373949_0001799 3300035090 Bacteria 5866
258 Ga0373951_0004126 3300035091 Bacteria 3475
259 Ga0373932_0000492 3300035112 Bacteria 12172
260 Ga0373939_0000624 3300035114 Bacteria 8805
261 Ga0373960_0038160 3300035121 Bacteria 1375
262 Ga0373946_0074232 3300035171 Bacteria 1476
263 Ga0373942_0003638 3300035207 Bacteria 3616
264 Ga0373961_0001309 3300035241 Bacteria 7546
265 Ga0373962_0001089 3300035242 Bacteria 6306
266 Ga0373962_0028516 3300035242 Bacteria 1515
267 Ga0373931_0011799 3300035691 Bacteria 4224
268 Ga0373935_0140758 3300035692 Bacteria 1630
269 Ga0373933_0054434 3300035724 Bacteria 2398
270 Ga0373947_0023299 3300035725 Bacteria 3600
271 Ga0373937_0043758 3300036401 Bacteria 4089
272 Ga0373937_0051416 3300036401 Bacteria 3777
273 Ga0373937_0493146 3300036401 Bacteria 1164
274 Ga0439450_001421 3300042008 Bacteria 3501
275 Ga0439446_0012038 3300042156 Bacteria 2359
276 Ga0439464_0001960 3300042439 Bacteria 4983
277 Ga0451576_0018252 3300045051 Bacteria 7693
278 Ga0466967_0308442 3300045976 Bacteria 1524
279 Ga0495603_0072055 3300046455 Bacteria 2030
280 Ga0495653_0039335 3300046463 Bacteria 3705
281 Ga0495639_0052810 3300046475 Bacteria 1851
282 Ga0495594_0026185 3300046499 Bacteria 3137
283 Ga0495645_0001970 3300046543 Bacteria 13950
284 Ga0495645_0039944 3300046543 Bacteria 3422
285 Ga0495634_0072955 3300046642 Unclassified 2257
286 Ga0495647_0013278 3300046681 Bacteria 2851
287 Ga0495658_0040899 3300046683 Bacteria 2579
288 Ga0495613_0173004 3300046689 Unclassified 1532
289 Ga0495674_0286410 3300047319 Bacteria 1349
290 Ga0496102_0036630 3300048905 Bacteria 4421
291 Ga0496104_0003182 3300048907 Bacteria 14111
292 Ga0496104_0036452 3300048907 Bacteria 4599
293 Ga0496105_0018660 3300048908 Bacteria 5584
294 Ga0496106_0192477 3300048909 Bacteria 1622
295 Ga0496108_0022693 3300048911 Bacteria 5162
296 Ga0496108_0026415 3300048911 Bacteria 4788
297 Ga0496109_0000869 3300048912 Bacteria 25170
298 Ga0496109_0155789 3300048912 Bacteria 2140
299 Ga0496111_0003983 3300048914 Bacteria 9274
300 Ga0496112_0017967 3300048915 Bacteria 6654
301 Ga0496112_0153463 3300048915 Bacteria 2270
302 Ga0496113_0341895 3300048916 Bacteria 1200
303 Ga0496114_0210816 3300048917 Bacteria 1704
304 Ga0496115_0075100 3300048918 Bacteria 2745
305 Ga0501033_0118719 3300049570 Unclassified 1921
306 Ga0501034_0008933 3300049571 Bacteria 10534
307 Ga0501034_0361353 3300049571 Bacteria 1379
308 Ga0501036_0040183 3300049572 Bacteria 3956
309 Ga0501038_0249325 3300049574 Unclassified 1407
310 Ga0501039_0075043 3300049575 Bacteria 2628
311 Ga0501041_0038073 3300049577 Bacteria 2915
312 Ga0501047_0039914 3300049581 Bacteria 4540
313 Ga0501048_0116438 3300049582 Bacteria 1888
314 Ga0501071_0019754 3300049587 Bacteria 4677
315 Ga0501072_0044194 3300049588 Bacteria 3503
316 Ga0501072_0058348 3300049588 Bacteria 3042
317 Ga0501073_0117233 3300049589 Bacteria 1845
318 Ga0501075_0018277 3300049591 Bacteria 5072
319 Ga0501075_0199393 3300049591 Bacteria 1526
320 Ga0501076_0034614 3300049592 Bacteria 3949
321 Ga0501077_0037244 3300049593 Bacteria 3099
322 Ga0501079_0073205 3300049741 Bacteria 2648
323 Ga0501079_0108951 3300049741 Bacteria 2151
324 Ga0501045_0032581 3300049824 Bacteria 3777
325 nmdc:mga00v17_17495_c1 3300050491 Bacteria 4060
326 nmdc:mga00v17_48566_c1 3300050491 Bacteria 2572
327 nmdc:mga00v17_6993_c1 3300050491 Bacteria 6004
328 nmdc:mga0k408_11712_c1 3300050493 Bacteria 4782
329 nmdc:mga0k408_22772_c1 3300050493 Bacteria 3530
330 nmdc:mga07m45_141298_c1 3300050496 Unclassified 1394
331 nmdc:mga05p37_10752_c1 3300050507 Bacteria 10865
332 nmdc:mga05p37_11844_c1 3300050507 Bacteria 10394
333 nmdc:mga05p37_14461_c1 3300050507 Bacteria 9476
334 nmdc:mga05p37_15056_c1 3300050507 Bacteria 9285
335 nmdc:mga05p37_16639_c1 3300050507 Bacteria 8858
336 nmdc:mga05p37_174_c1 3300050507 Bacteria 62666
337 nmdc:mga05p37_1991_c1 3300050507 Bacteria 23842
338 nmdc:mga05p37_29304_c1 3300050507 Bacteria 6717
339 nmdc:mga05p37_29438_c1 3300050507 Bacteria 6701
340 nmdc:mga05p37_46021_c1 3300050507 Bacteria 5366
341 nmdc:mga05p37_8028_c1 3300050507 Bacteria 12461
342 nmdc:mga05p37_80306_c1 3300050507 Bacteria 4018
343 nmdc:mga05p37_98559_c1 3300050507 Bacteria 3600
344 nmdc:mga09592_112157_c1 3300050508 Bacteria 2339
345 nmdc:mga09592_134315_c1 3300050508 Unclassified 2131
346 nmdc:mga09592_135969_c1 3300050508 Bacteria 2117
347 nmdc:mga09592_142349_c1 3300050508 Unclassified 2067
348 nmdc:mga09592_20761_c1 3300050508 Bacteria 5406
349 nmdc:mga0qj67_114751_c1 3300050509 Unclassified 2176
350 nmdc:mga0qj67_12486_c1 3300050509 Bacteria 6399
351 nmdc:mga0qj67_217641_c1 3300050509 Bacteria 1551
352 nmdc:mga06r32_131020_c1 3300050510 Bacteria 2480
353 nmdc:mga06r32_43891_c1 3300050510 Bacteria 4255
354 nmdc:mga06r32_8040_c1 3300050510 Bacteria 9490
355 nmdc:mga08y16_116244_c1 3300050511 Bacteria 2784
356 nmdc:mga08y16_1538_c1 3300050511 Bacteria 23197
357 nmdc:mga08y16_15742_c1 3300050511 Bacteria 7953
358 nmdc:mga08y16_1664_c1 3300050511 Bacteria 22540
359 nmdc:mga08y16_19434_c1 3300050511 Bacteria 7162
360 nmdc:mga08y16_70562_c1 3300050511 Bacteria 3642
361 nmdc:mga0n895_19919_c1 3300050512 Bacteria 6246
362 nmdc:mga0n895_227_c1 3300050512 Bacteria 35542
363 nmdc:mga0n895_27407_c1 3300050512 Bacteria 5413
364 nmdc:mga0n895_462584_c1 3300050512 Bacteria 1280
365 nmdc:mga0n895_76353_c1 3300050512 Bacteria 3332
366 nmdc:mga0rr50_132_c1 3300050513 Bacteria 40800
367 nmdc:mga0rr50_17276_c1 3300050513 Bacteria 4814
368 nmdc:mga0rr50_175_c1 3300050513 Bacteria 34417
369 nmdc:mga0rr50_30695_c1 3300050513 Bacteria 3809
370 nmdc:mga08x19_1177_c1 3300050514 Bacteria 16391
371 nmdc:mga08x19_98629_c1 3300050514 Bacteria 1936
372 nmdc:mga0a205_21028_c1 3300050515 Bacteria 6168
373 nmdc:mga0a205_2602_c1 3300050515 Bacteria 15939
374 nmdc:mga0a205_289063_c1 3300050515 Bacteria 1514
375 Ga0495601_0106597 3300053077 Bacteria 1813
376 Ga0501084_0044263 3300054114 Bacteria 3727
377 Ga0501082_0181361 3300060353 Bacteria 1831
378 Ga0501082_0345218 3300060353 Unclassified 1297
379 Ga0530510_0015374 3300061734 Bacteria 5408
380 Ga0530510_0278215 3300061734 Bacteria 1250
381 Ga0070698_100060456
382 Ga0065712_10071660
383 Ga0065712_10075884
384 Ga0065715_10019473
385 Ga0065707_10134857
386 Ga0070676_10017460
387 Ga0070683_100000094
388 Ga0070683_100024706
389 Ga0070690_100033060
390 Ga0070670_100013591
391 Ga0070670_100018452
392 Ga0070677_10026045
393 Ga0070666_10014193
394 Ga0070666_10091381
395 Ga0068868_100017620
396 Ga0070689_100246457
397 Ga0070691_10030595
398 Ga0070661_100022927
399 Ga0070668_100124957
400 Ga0070669_100001826
401 Ga0070669_100031377
402 Ga0070675_100003283
403 Ga0070675_100068220
404 Ga0070671_100039024
405 Ga0070674_100018130
406 Ga0070673_100009823
407 Ga0070673_100012525
408 Ga0070673_100149364
409 Ga0070688_100021368
410 Ga0070709_10189437
411 Ga0070714_100052069
412 Ga0070701_10056265
413 Ga0070705_100016927
414 Ga0070700_100015383
415 Ga0070694_100008663
416 Ga0070694_100186824
417 Ga0070663_100008778
418 Ga0070663_100068871
419 Ga0070662_100077505
420 Ga0070662_100102749
421 Ga0068867_100036196
422 Ga0070685_10110811
423 Ga0070706_100038062
424 Ga0070707_100204633
425 Ga0070707_100226595
426 Ga0070698_100045451
427 Ga0070698_100151024
428 Ga0070679_100103364
429 Ga0070679_100326601
430 Ga0070684_100006365
431 Ga0068853_100327405
432 Ga0070672_100036831
433 Ga0070686_100000486
434 Ga0070686_100022667
435 Ga0070686_100180746
436 Ga0070695_100004225
437 Ga0070695_100011528
438 Ga0070696_100038380
439 Ga0070696_100140456
440 Ga0070665_100001142
441 Ga0070665_100010573
442 Ga0070665_100140845
443 Ga0070704_100055636
444 Ga0068855_100030065
445 Ga0070664_100000479
446 Ga0068854_100025415
447 Ga0068859_100077049
448 Ga0068859_100163549
449 Ga0068864_100022888
450 Ga0068864_100033968
451 Ga0068864_100043580
452 Ga0068861_100065087
453 Ga0068861_100191080
454 Ga0068863_100002641
455 Ga0068858_100003549
456 Ga0068858_100019034
457 Ga0068860_100064076
458 Ga0068860_100252401
459 Ga0068860_100307270
460 Ga0068862_100208911
461 Ga0068862_100224843
462 Ga0081455_10014307
463 Ga0075365_10011728
464 Ga0075368_10007369
465 Ga0075364_10009447
466 Ga0075432_10009737
467 Ga0075362_10002121
468 Ga0075366_10016608
469 Ga0075366_10055107
470 Ga0097621_100034096
471 Ga0075370_10072177
472 Ga0075428_100003278
473 Ga0075428_100006407
474 Ga0075428_100008684
475 Ga0075428_100011207
476 Ga0075428_100040779
477 Ga0075428_100138017
478 Ga0075428_100174086
479 Ga0075428_100179549
480 Ga0075430_100006929
481 Ga0075430_100017575
482 Ga0075430_100030132
483 Ga0075430_100102420
484 Ga0075431_100010222
485 Ga0075431_100016629
486 Ga0075431_100023957
487 Ga0075431_100285982
488 Ga0075433_10012684
489 Ga0075433_10170686
490 Ga0075434_100004448
491 Ga0075434_100011873
492 Ga0075434_100027951
493 Ga0075434_100107854
494 Ga0075429_100017917
495 Ga0075429_100024781
496 Ga0075429_100120001
497 Ga0075429_100129658
498 Ga0075436_100004960
499 Ga0075436_100027940
500 Ga0097620_100077051
501 Ga0097620_100163555
502 Ga0075435_100000342
503 Ga0075435_100002624
504 Ga0075435_100007253
505 Ga0075435_100009945
506 Ga0075435_100024657
507 Ga0075435_100153786
508 Ga0105240_10067634
509 Ga0111539_10000782
510 Ga0111539_10006147
511 Ga0111539_10009526
512 Ga0111539_10017454
513 Ga0111539_10031704
514 Ga0111539_10039107
515 Ga0111539_10078023
516 Ga0111539_10107199
517 Ga0105245_10027005
518 Ga0105245_10207174
519 Ga0105247_10033647
520 Ga0114129_10000509
521 Ga0114129_10001561
522 Ga0114129_10001667
523 Ga0114129_10009415
524 Ga0114129_10014680
525 Ga0114129_10020525
526 Ga0114129_10020539
527 Ga0114129_10029596
528 Ga0114129_10040307
529 Ga0114129_10041875
530 Ga0114129_10059145
531 Ga0114129_10062817
532 Ga0114129_10081065
533 Ga0114129_10082441
534 Ga0114129_10086004
535 Ga0114129_10118349
536 Ga0114129_10279610
537 Ga0105243_10021101
538 Ga0105243_10106095
539 Ga0105241_10257383
540 Ga0105242_10008251
541 Ga0105242_10024880
542 Ga0105248_10004266
543 Ga0105248_10025354
544 Ga0105248_10025846
545 Ga0105248_10026047
546 Ga0105248_10029719
547 Ga0105248_10045913
548 Ga0105248_10203538
549 Ga0157374_10010815
550 Ga0163162_10038396
551 Ga0163162_10147097
552 Ga0157372_10106318
553 Ga0157375_10157583
554 Ga0157375_10184768
555 Ga0163163_10022775
556 Ga0163163_10196738
557 Ga0157380_10021600
558 Ga0157380_10036565
559 Ga0157377_10016372
560 Ga0157379_10009065
561 Ga0157379_10028505
562 Ga0157376_10009009
563 Ga0157376_10062570
564 Ga0157376_10160548
565 Ga0207710_10061171
566 Ga0207645_10006056
567 Ga0207645_10022267
568 Ga0207645_10063812
569 Ga0207662_10018880
570 Ga0207646_10191156
571 Ga0207681_10002093
572 Ga0207681_10006653
573 Ga0207681_10058668
574 Ga0207650_10011879
575 Ga0207650_10077357
576 Ga0207659_10002281
577 Ga0207659_10156528
578 Ga0207644_10077224
579 Ga0207690_10183828
580 Ga0207706_10047583
581 Ga0207706_10077323
582 Ga0207686_10011990
583 Ga0207691_10005509
584 Ga0207691_10035445
585 Ga0207691_10125114
586 Ga0207711_10052635
587 Ga0207689_10070281
588 Ga0207689_10078607
589 Ga0207661_10004428
590 Ga0207661_10129537
591 Ga0207679_10029717
592 Ga0207679_10068517
593 Ga0207640_10005617
594 Ga0207658_10099263
595 Ga0207703_10011797
596 Ga0207639_10319664
597 Ga0207708_10006630
598 Ga0207708_10023752
599 Ga0207708_10034704
600 Ga0207641_10006730
601 Ga0207641_10090587
602 Ga0207641_10205679
603 Ga0207648_10006114
604 Ga0207648_10193383
605 Ga0207676_10007127
606 Ga0207676_10041996
607 Ga0207675_100006610
608 Ga0207675_100064681
609 Ga0207675_100089832
610 Ga0207675_100092574
611 Ga0207675_100142432
612 Ga0207428_10000515
613 Ga0207428_10003949
614 Ga0207428_10006925
615 Ga0207428_10020107
616 Ga0207428_10049604
617 Ga0207428_10150237
618 Ga0268266_10006352
619 Ga0268266_10026746
620 Ga0268265_10001769
621 Ga0268265_10016572
622 Ga0268265_10110723
623 Ga0268264_10128129
624 Ga0268264_10213363
625 Ga0265328_10027580
626 Ga0307408_100010625
627 Ga0265314_10039279
628 Ga0307409_100073314
629 Ga0307409_100079588
630 Ga0307416_100009990
631 Ga0307416_100020984
632 Ga0307416_100256003
633 Ga0307411_10096501
634 Ga0373930_0001454
635 Ga0373959_0000462
636 Ga0373928_0001762
637 Ga0373949_0001799
638 Ga0373951_0004126
639 Ga0373932_0000492
640 Ga0373939_0000624
641 Ga0373960_0038160
642 Ga0373946_0074232
643 Ga0373942_0003638
644 Ga0373961_0001309
645 Ga0373962_0001089
646 Ga0373962_0028516
647 Ga0373931_0011799
648 Ga0373935_0140758
649 Ga0373933_0054434
650 Ga0373947_0023299
651 Ga0373937_0043758
652 Ga0373937_0051416
653 Ga0373937_0493146
654 Ga0439450_001421
655 Ga0439446_0012038
656 Ga0439464_0001960
657 Ga0451576_0018252
658 Ga0466967_0308442
659 Ga0495603_0072055
660 Ga0495653_0039335
661 Ga0495639_0052810
662 Ga0495594_0026185
663 Ga0495645_0001970
664 Ga0495645_0039944
665 Ga0495634_0072955
666 Ga0495647_0013278
667 Ga0495658_0040899
668 Ga0495613_0173004
669 Ga0495674_0286410
670 Ga0496102_0036630
671 Ga0496104_0003182
672 Ga0496104_0036452
673 Ga0496105_0018660
674 Ga0496106_0192477
675 Ga0496108_0022693
676 Ga0496108_0026415
677 Ga0496109_0000869
678 Ga0496109_0155789
679 Ga0496111_0003983
680 Ga0496112_0017967
681 Ga0496112_0153463
682 Ga0496113_0341895
683 Ga0496114_0210816
684 Ga0496115_0075100
685 Ga0501033_0118719
686 Ga0501034_0008933
687 Ga0501034_0361353
688 Ga0501036_0040183
689 Ga0501038_0249325
690 Ga0501039_0075043
691 Ga0501041_0038073
692 Ga0501047_0039914
693 Ga0501048_0116438
694 Ga0501071_0019754
695 Ga0501072_0044194
696 Ga0501072_0058348
697 Ga0501073_0117233
698 Ga0501075_0018277
699 Ga0501075_0199393
700 Ga0501076_0034614
701 Ga0501077_0037244
702 Ga0501079_0073205
703 Ga0501079_0108951
704 Ga0501045_0032581
705 nmdc:mga00v17_17495_c1
706 nmdc:mga00v17_48566_c1
707 nmdc:mga00v17_6993_c1
708 nmdc:mga0k408_11712_c1
709 nmdc:mga0k408_22772_c1
710 nmdc:mga07m45_141298_c1
711 nmdc:mga05p37_10752_c1
712 nmdc:mga05p37_11844_c1
713 nmdc:mga05p37_14461_c1
714 nmdc:mga05p37_15056_c1
715 nmdc:mga05p37_16639_c1
716 nmdc:mga05p37_174_c1
717 nmdc:mga05p37_1991_c1
718 nmdc:mga05p37_29304_c1
719 nmdc:mga05p37_29438_c1
720 nmdc:mga05p37_46021_c1
721 nmdc:mga05p37_8028_c1
722 nmdc:mga05p37_80306_c1
723 nmdc:mga05p37_98559_c1
724 nmdc:mga09592_112157_c1
725 nmdc:mga09592_134315_c1
726 nmdc:mga09592_135969_c1
727 nmdc:mga09592_142349_c1
728 nmdc:mga09592_20761_c1
729 nmdc:mga0qj67_114751_c1
730 nmdc:mga0qj67_12486_c1
731 nmdc:mga0qj67_217641_c1
732 nmdc:mga06r32_131020_c1
733 nmdc:mga06r32_43891_c1
734 nmdc:mga06r32_8040_c1
735 nmdc:mga08y16_116244_c1
736 nmdc:mga08y16_1538_c1
737 nmdc:mga08y16_15742_c1
738 nmdc:mga08y16_1664_c1
739 nmdc:mga08y16_19434_c1
740 nmdc:mga08y16_70562_c1
741 nmdc:mga0n895_19919_c1
742 nmdc:mga0n895_227_c1
743 nmdc:mga0n895_27407_c1
744 nmdc:mga0n895_462584_c1
745 nmdc:mga0n895_76353_c1
746 nmdc:mga0rr50_132_c1
747 nmdc:mga0rr50_17276_c1
748 nmdc:mga0rr50_175_c1
749 nmdc:mga0rr50_30695_c1
750 nmdc:mga08x19_1177_c1
751 nmdc:mga08x19_98629_c1
752 nmdc:mga0a205_21028_c1
753 nmdc:mga0a205_2602_c1
754 nmdc:mga0a205_289063_c1
755 Ga0495601_0106597
756 Ga0501084_0044263
757 Ga0501082_0181361
758 Ga0501082_0345218
759 Ga0530510_0015374
760 Ga0530510_0278215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

292

446

0.99

PF01128

IspD

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

181

271

0.91

PF01128

IspD

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

3

178

0.88

PF12804

NTP_transf_3

MobA-like NTP transferase domain

5

248

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iwx-assembly1.cif.gz_B crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from bacillus subtitis 0.9821 236 391
3k2x-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei in complex with 5'-iodo-cytosine 0.9766 236 390
5l12-assembly1.cif.gz_C crystal structure of 2c-methyl-d-erythritol 2,4-clycodiphosphate synthase from burkholderia pseudomallei double mutant 0.9747 236 390
3iew-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp 0.9746 235 391
3f0d-assembly2.cif.gz_D high resolution crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphatase synthase from burkholderia pseudomallei 0.9746 236 391
ID Description Score Start End Superfamily
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.965 235 391 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9579 236 391 3.30.1330.50
1w55A02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9464 236 391 3.30.1330.50
3t80F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9454 236 391 3.30.1330.50
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9442 235 391 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A7C4JHP9-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12) 0.9995 237 323 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A1G0QD26-F1-model_v4 deleted 0.9966 237 361
AF-X1FR06-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12) 0.9966 237 323 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A356IYL9-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12) 0.996 237 368 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A0E1Y8I6-F1-model_v4 deleted 0.9959 237 312

Map