F428507

General Info

Members Datasets Scaffolds Average Seq Length
379 344 150 224

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2524023209|2524462401
Length 252
Sequence EDLTKPVIAHAAKLDWVPSPAAGVDRRMLYRVGGEVARATSIVRYAPASAFPRHVHSGGEEILVLQGTFQDEHGDYPAGSYFRNPPGTSHVPAPEEGCMIFVRLWQFRQGDSMQIVRQPGEGQAAPLRAGARAARVLFEDIAERVSIETWQSGSAIAIENRRGLEFLVLSGSLILQGETLEPQCWGRLPAGRSFEVATGPEGAEIWIKDAPLQHADVLPMPSSAKWGSPRRRSATRTMSRNRKKLRQETSGF

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
9 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
14 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
17 2516143018 Ensifer sp. BR816 Isolate Nodule
18 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
22 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
23 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
24 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
25 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
26 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
27 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
28 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
29 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
30 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
31 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
32 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
33 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
34 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
35 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
36 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
37 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
38 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
39 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
40 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
41 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
42 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
43 2791355261 Rhizobium sp. J15 Isolate Nodule
44 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
45 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
46 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
47 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
48 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
49 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
50 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
51 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
52 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
53 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
54 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
55 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
56 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
57 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
58 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
59 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
60 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
61 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
62 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
63 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
64 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
65 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
66 2904424332 Duganella sp. 1411 Isolate Rhizosphere
67 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
68 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
69 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
70 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
71 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
72 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
73 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
74 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
75 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
76 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
77 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
78 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
79 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
80 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
81 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
82 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
83 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
84 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
85 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
86 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
87 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
88 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
89 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
90 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
91 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
92 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
93 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
94 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
95 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
96 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
97 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
98 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
99 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
100 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
101 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
102 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
103 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
104 2936381700 Rhizobium chutanense C16 Isolate Unclassified
105 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
106 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
107 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
108 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
109 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
110 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
111 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
112 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
113 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
114 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
115 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
116 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
117 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
118 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
119 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
120 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
121 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
122 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
123 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
124 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
125 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
126 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
127 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
128 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
129 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
130 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
131 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
132 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
133 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
134 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
135 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
136 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
137 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
138 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
139 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
140 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
141 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
142 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
143 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
144 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
145 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
146 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
147 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
148 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
149 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
150 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
151 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
152 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
153 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
154 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
155 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
156 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
157 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
158 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
159 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
160 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
161 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
162 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
163 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
164 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
165 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
166 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
167 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
168 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
169 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
170 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
171 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
172 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
173 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
174 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
175 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
176 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
177 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
178 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
179 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
180 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
181 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
182 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
183 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
184 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
185 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
186 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
187 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
188 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
189 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
190 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
191 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
192 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
193 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
194 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
195 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
196 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
197 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
198 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
199 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
200 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
201 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
202 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
203 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
204 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
205 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
206 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
207 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
208 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
209 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
210 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
211 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
212 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
213 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
214 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
215 2996893221 Rhizobium sp. R635 Isolate Nodule
216 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
217 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
218 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
219 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
220 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
221 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
222 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
223 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
224 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
225 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
226 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
227 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
228 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
229 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
230 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
231 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
232 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
233 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
234 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
235 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
236 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
237 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
238 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
239 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
240 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
241 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
242 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
243 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
244 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
245 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
246 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
247 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
248 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
249 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
250 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
251 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
252 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
253 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
254 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
255 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
256 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
257 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
258 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
259 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
260 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
261 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
262 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
263 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
264 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
265 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
266 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
267 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
268 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
269 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
270 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
271 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
273 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
274 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
275 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
276 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
277 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
278 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
279 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
281 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
300 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
301 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
302 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
303 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
304 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
305 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
306 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
307 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
308 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
309 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
310 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
311 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
336 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
339 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
340 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
341 8005382845 Rhizobium sp. R634 Isolate Nodule
342 8005395548 Rhizobium sp. R339 Isolate Nodule
343 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
344 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 39.31
Metatranscriptomes 0.26
Isolates 60.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.12
Nodule 56.73
Rhizoplane 3.17
Rhizosphere 26.12
Stem 0
Stem Tuber 0
Unclassified 6.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000310 3300002739 Bacteria 10975
2 JGI25152J39213_1008283 3300002773 Bacteria 2592
3 JGI25150J39212_1003430 3300002774 Bacteria 3705
4 JGI25159J45721_1000119 3300002987 Bacteria 37352
5 JGI25151J46595_10048905 3300003187 Bacteria 1456
6 JGI25153J46596_10001737 3300003215 Bacteria 12935
7 JGI25153J46596_10034085 3300003215 Bacteria 1669
8 rootH1_10312232 3300003323 Bacteria 3369
9 JGI25161J50226_1000261 3300003374 Bacteria 31364
10 Ga0055540_1001785 3300003792 Bacteria 12234
11 Ga0055543_1000065 3300004625 Bacteria 97333
12 Ga0065165_1004997 3300005262 Bacteria 7772
13 Ga0070666_10336567 3300005335 Bacteria 1078
14 Ga0070680_100094799 3300005336 Bacteria 2474
15 Ga0070661_100395422 3300005344 Bacteria 1092
16 Ga0070661_100472408 3300005344 Bacteria 1000
17 Ga0070669_100896211 3300005353 Bacteria 757
18 Ga0070709_10003089 3300005434 Bacteria 8951
19 Ga0070714_100017251 3300005435 Bacteria 5847
20 Ga0070714_100018107 3300005435 Bacteria 5715
21 Ga0070713_100015047 3300005436 Bacteria 5764
22 Ga0070713_100158726 3300005436 Bacteria 2017
23 Ga0070710_10007407 3300005437 Bacteria 5313
24 Ga0070710_10137877 3300005437 Bacteria 1493
25 Ga0070711_100000494 3300005439 Bacteria 20534
26 Ga0070711_100023402 3300005439 Bacteria 4017
27 Ga0070711_100442828 3300005439 Bacteria 1062
28 Ga0070663_100113985 3300005455 Bacteria 2035
29 Ga0070684_100228077 3300005535 Bacteria 1700
30 Ga0068855_100245823 3300005563 Bacteria 1997
31 Ga0068855_100929844 3300005563 Bacteria 917
32 Ga0068856_101259907 3300005614 Bacteria 755
33 Ga0068864_100058651 3300005618 Bacteria 3328
34 Ga0068858_100208065 3300005842 Unclassified 1851
35 Ga0081455_10128390 3300005937 Bacteria 1986
36 Ga0070717_10090284 3300006028 Bacteria 2585
37 Ga0070717_10265668 3300006028 Bacteria 1519
38 Ga0070715_10079853 3300006163 Bacteria 1482
39 Ga0070712_100006727 3300006175 Bacteria 7146
40 Ga0075431_100279728 3300006847 Bacteria 1689
41 Ga0075429_100562944 3300006880 Bacteria 999
42 Ga0099824_1010817 3300006942 Bacteria 10573
43 Ga0099822_1025481 3300006943 Bacteria 5130
44 Ga0075435_100341350 3300007076 Bacteria 1283
45 Ga0105240_10013849 3300009093 Bacteria 11044
46 Ga0105240_10230880 3300009093 Bacteria 2150
47 Ga0111539_10069053 3300009094 Bacteria 4172
48 Ga0114129_10088446 3300009147 Bacteria 4294
49 Ga0105248_10486508 3300009177 Unclassified 1391
50 Ga0105237_10010164 3300009545 Bacteria 10027
51 Ga0105237_10080439 3300009545 Bacteria 3249
52 Ga0105238_10465910 3300009551 Bacteria 1262
53 Ga0105239_10148013 3300010375 Bacteria 2620
54 Ga0105246_10186531 3300011119 Unclassified 1602
55 Ga0157370_10056567 3300013104 Bacteria 3733
56 Ga0157369_10257611 3300013105 Bacteria 1820
57 Ga0157369_10629894 3300013105 Bacteria 1106
58 Ga0163162_10019104 3300013306 Bacteria 6721
59 Ga0157375_10031900 3300013308 Bacteria 4990
60 Ga0163163_10001546 3300014325 Bacteria 19386
61 Ga0157379_10032114 3300014968 Bacteria 4679
62 Ga0214543_1000015 3300021327 Bacteria 305679
63 Ga0213873_10011697 3300021358 Bacteria 1885
64 Ga0213876_10001582 3300021384 Bacteria 13986
65 Ga0224712_10110548 3300022467 Bacteria 1178
66 Ga0209436_100014 3300025208 Bacteria 127004
67 Ga0207425_1000620 3300025245 Bacteria 20287
68 Ga0207425_1017805 3300025245 Bacteria 1552
69 Ga0209677_103290 3300025253 Bacteria 5348
70 Ga0209129_1003182 3300025258 Bacteria 7346
71 Ga0209455_1005177 3300025272 Bacteria 4089
72 Ga0209673_1027975 3300025273 Bacteria 1824
73 Ga0209130_1000004 3300025284 Bacteria 633436
74 Ga0209025_1003213 3300025294 Bacteria 15832
75 Ga0209564_1033478 3300025295 Unclassified 1527
76 Ga0209758_1000829 3300025297 Bacteria 43270
77 Ga0209758_1009807 3300025297 Bacteria 5863
78 Ga0209758_1053448 3300025297 Bacteria 1388
79 Ga0209256_1005714 3300025299 Bacteria 6976
80 Ga0207426_1000003 3300025302 Bacteria 1063212
81 Ga0209257_1026613 3300025304 Bacteria 1944
82 Ga0207692_10002344 3300025898 Bacteria 7266
83 Ga0207680_10339198 3300025903 Bacteria 1054
84 Ga0207699_10046624 3300025906 Bacteria 2536
85 Ga0207699_10155835 3300025906 Bacteria 1516
86 Ga0207695_10071811 3300025913 Bacteria 3535
87 Ga0207695_10327879 3300025913 Bacteria 1420
88 Ga0207671_10123932 3300025914 Bacteria 1977
89 Ga0207671_10153337 3300025914 Bacteria 1781
90 Ga0207671_10309829 3300025914 Bacteria 1248
91 Ga0207693_10008865 3300025915 Bacteria 8216
92 Ga0207663_10017176 3300025916 Bacteria 4026
93 Ga0207663_10092491 3300025916 Bacteria 2011
94 Ga0207660_10066608 3300025917 Bacteria 2606
95 Ga0207649_10570443 3300025920 Bacteria 868
96 Ga0207652_10057349 3300025921 Bacteria 3354
97 Ga0207700_10042628 3300025928 Bacteria 3329
98 Ga0207700_10078003 3300025928 Bacteria 2575
99 Ga0207664_10008270 3300025929 Bacteria 7247
100 Ga0207664_10020489 3300025929 Bacteria 4903
101 Ga0207665_10006382 3300025939 Bacteria 7822
102 Ga0207661_10019368 3300025944 Bacteria 5072
103 Ga0207639_10881230 3300026041 Bacteria 836
104 Ga0207678_10207803 3300026067 Bacteria 1675
105 Ga0207676_10036723 3300026095 Bacteria 3730
106 Ga0209389_1000162 3300027296 Bacteria 55061
107 Ga0209589_1000001 3300027357 Bacteria 794224
108 Ga0209489_100001 3300027361 Bacteria 794224
109 Ga0209489_110982 3300027361 Bacteria 9661
110 Ga0209700_100001 3300027363 Bacteria 794224
111 Ga0209700_100509 3300027363 Bacteria 73459
112 Ga0207428_10082875 3300027907 Bacteria 2502
113 Ga0315911_1000002 3300033442 Bacteria 926833
114 Ga0395900_0011071 3300037418 Bacteria 9216
115 Ga0395898_0031519 3300037466 Bacteria 5296
116 Ga0436364_1447381 3300037853 Bacteria 854
117 Ga0395901_0829104 3300038443 Bacteria 912
118 Ga0436365_0264506 3300039437 Bacteria 13540
119 Ga0436362_0847329 3300039453 Bacteria 2631
120 Ga0466966_0042551 3300044684 Bacteria 2915
121 Ga0495600_0273873 3300046809 Bacteria 1070
122 Ga0495602_0365990 3300048088 Bacteria 1036
123 Ga0496100_0039704 3300048903 Bacteria 2990
124 Ga0496100_0175192 3300048903 Bacteria 1548
125 Ga0496102_0119701 3300048905 Bacteria 2458
126 Ga0496104_0005219 3300048907 Bacteria 11361
127 Ga0496106_0074629 3300048909 Bacteria 2597
128 Ga0496110_0045599 3300048913 Bacteria 3833
129 Ga0496111_0020728 3300048914 Bacteria 4581
130 Ga0496112_0011919 3300048915 Bacteria 7963
131 Ga0496113_0098251 3300048916 Bacteria 2266
132 Ga0496114_0063854 3300048917 Bacteria 3083
133 Ga0496115_0252843 3300048918 Bacteria 1451
134 Ga0496118_0011989 3300048921 Bacteria 8377
135 Ga0496119_0121023 3300048922 Bacteria 1439
136 Ga0496121_0058862 3300048924 Bacteria 3172
137 Ga0496121_0091611 3300048924 Bacteria 2373
138 Ga0501031_0473791 3300049568 Bacteria 808
139 Ga0501034_0131552 3300049571 Bacteria 2485
140 Ga0501042_0124601 3300049578 Bacteria 1855
141 Ga0501043_0481374 3300049579 Bacteria 929
142 Ga0501046_0395433 3300049580 Bacteria 999
143 Ga0501070_0016343 3300049586 Bacteria 6233
144 Ga0501070_0080728 3300049586 Bacteria 2691
145 Ga0501073_0278635 3300049589 Bacteria 1154
146 Ga0501074_0203712 3300049590 Bacteria 1410
147 Ga0501076_0445337 3300049592 Bacteria 1066
148 Ga0501079_0063885 3300049741 Bacteria 2840
149 Ga0501045_0191016 3300049824 Bacteria 1526
150 nmdc:mga08y16_144700_c1 3300050511 Bacteria 2471

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025898 Ga0207692_10002344 Ga0207692_100023443 204
2 iso_pu_bacteria 2937098957 2937103250 209
3 iso_pu_bacteria 2904424332 2904425368 210
4 iso_pu_bacteria 2879083081 2879087350 211
5 3300002774 JGI25150J39212_1003430 JGI25150J39212_10034304 214
6 3300003187 JGI25151J46595_10048905 JGI25151J46595_100489052 214
7 3300003215 JGI25153J46596_10034085 JGI25153J46596_100340852 214
8 3300025245 Ga0207425_1000620 Ga0207425_100062011 214
9 3300025294 Ga0209025_1003213 Ga0209025_10032138 214
10 3300025297 Ga0209758_1009807 Ga0209758_10098075 214
11 3300048917 Ga0496114_0063854 Ga0496114_0063854_1438_2106 214
12 iso_pu_bacteria 2881147464 2881153384 215
13 iso_pu_bacteria 2906643746 2906643765 215
14 iso_pu_bacteria 2510065057 2510304831 218
15 iso_pu_bacteria 2916048683 2916049427 218
16 iso_pu_bacteria 2508501128 2509149525 221
17 iso_pu_bacteria 2511231052 2511499213 221
18 iso_pu_bacteria 2512047086 2512530493 221
19 iso_pu_bacteria 2513237086 2513585159 221
20 iso_pu_bacteria 2513237091 2513618630 221
21 iso_pu_bacteria 2513237140 2513883302 221
22 iso_pu_bacteria 2513237143 2513902756 221
23 iso_pu_bacteria 2515154107 2515610149 221
24 iso_pu_bacteria 2516653046 2516898027 221
25 iso_pu_bacteria 2517093001 2517107674 221
26 iso_pu_bacteria 2524023205 2524440416 221
27 iso_pu_bacteria 2524023207 2524452237 221
28 iso_pu_bacteria 2551306084 2551679132 221
29 iso_pu_bacteria 2551306084 2551681000 221
30 iso_pu_bacteria 2551306085 2551686036 221
31 iso_pu_bacteria 2551306086 2551694780 221
32 iso_pu_bacteria 2551306087 2551701973 221
33 iso_pu_bacteria 2551306089 2551713215 221
34 iso_pu_bacteria 2551306090 2551717042 221
35 iso_pu_bacteria 2551306091 2551725759 221
36 iso_pu_bacteria 2551306092 2551733447 221
37 iso_pu_bacteria 2551306093 2551740509 221
38 iso_pu_bacteria 2582581316 2585335992 221
39 iso_pu_bacteria 2721755755 2723847790 221
40 iso_pu_bacteria 2744054633 2745075314 221
41 iso_pu_bacteria 2847930680 2847933823 221
42 iso_pu_bacteria 2855825444 2855829916 221
43 iso_pu_bacteria 2855839649 2855844846 221
44 iso_pu_bacteria 2858800743 2858804796 221
45 iso_pu_bacteria 2876761206 2876767123 221
46 iso_pu_bacteria 2915993759 2915999130 221
47 iso_pu_bacteria 2916000859 2916001069 221
48 iso_pu_bacteria 2916007675 2916010037 221
49 iso_pu_bacteria 2916014648 2916017818 221
50 iso_pu_bacteria 2916021584 2916025587 221
51 iso_pu_bacteria 2916028427 2916032359 221
52 iso_pu_bacteria 2916035215 2916035491 221
53 iso_pu_bacteria 2916041962 2916043158 221
54 iso_pu_bacteria 2916055098 2916056485 221
55 iso_pu_bacteria 2916076590 2916076653 221
56 iso_pu_bacteria 2921201388 2921206492 221
57 iso_pu_bacteria 2921208531 2921208601 221
58 iso_pu_bacteria 2921237296 2921238377 221
59 iso_pu_bacteria 2921244191 2921248198 221
60 iso_pu_bacteria 2921257292 2921259712 221
61 iso_pu_bacteria 2921263974 2921265514 221
62 iso_pu_bacteria 2921282425 2921285688 221
63 iso_pu_bacteria 2921289301 2921292509 221
64 iso_pu_bacteria 2921296804 2921302694 221
65 iso_pu_bacteria 2924144063 2924145173 221
66 iso_pu_bacteria 2924150972 2924153487 221
67 iso_pu_bacteria 2924158325 2924162715 221
68 iso_pu_bacteria 2924165586 2924168968 221
69 iso_pu_bacteria 2924172951 2924174030 221
70 iso_pu_bacteria 2924179722 2924184858 221
71 iso_pu_bacteria 2924186466 2924189318 221
72 iso_pu_bacteria 2924193448 2924198712 221
73 iso_pu_bacteria 2924200457 2924201962 221
74 iso_pu_bacteria 2924207177 2924208602 221
75 iso_pu_bacteria 2924221636 2924224900 221
76 iso_pu_bacteria 2924228884 2924233755 221
77 iso_pu_bacteria 2936996657 2936999521 221
78 iso_pu_bacteria 2937002841 2937008831 221
79 iso_pu_bacteria 2937009748 2937012358 221
80 iso_pu_bacteria 2937016420 2937021249 221
81 iso_pu_bacteria 2937023124 2937026299 221
82 iso_pu_bacteria 2937042894 2937046132 221
83 iso_pu_bacteria 2937049772 2937049809 221
84 iso_pu_bacteria 2937056579 2937056755 221
85 iso_pu_bacteria 2937063883 2937068127 221
86 iso_pu_bacteria 2937071275 2937075528 221
87 iso_pu_bacteria 2937091812 2937091839 221
88 iso_pu_bacteria 2937106411 2937106850 221
89 iso_pu_bacteria 2937113482 2937113817 221
90 iso_pu_bacteria 2937119839 2937121291 221
91 iso_pu_bacteria 2937126314 2937126402 221
92 iso_pu_bacteria 2957382221 2957384007 221
93 iso_pu_bacteria 2957388812 2957390973 221
94 iso_pu_bacteria 2957395598 2957396722 221
95 iso_pu_bacteria 2957402308 2957405348 221
96 iso_pu_bacteria 2957408893 2957412707 221
97 iso_pu_bacteria 2957415311 2957415848 221
98 iso_pu_bacteria 2957422303 2957423141 221
99 iso_pu_bacteria 2957430029 2957434032 221
100 iso_pu_bacteria 2957443900 2957448168 221
101 iso_pu_bacteria 2957450854 2957453395 221
102 iso_pu_bacteria 2957457609 2957462348 221
103 iso_pu_bacteria 2957464669 2957468501 221
104 iso_pu_bacteria 2957471148 2957476073 221
105 iso_pu_bacteria 2957478035 2957478081 221
106 iso_pu_bacteria 2957484790 2957490779 221
107 iso_pu_bacteria 2957491536 2957493509 221
108 iso_pu_bacteria 2957498199 2957498235 221
109 iso_pu_bacteria 2957505466 2957508364 221
110 iso_pu_bacteria 2960584000 2960587662 221
111 iso_pu_bacteria 2960597568 2960598992 221
112 iso_pu_bacteria 2960603979 2960606101 221
113 iso_pu_bacteria 2960610863 2960611495 221
114 iso_pu_bacteria 2960617483 2960620638 221
115 iso_pu_bacteria 2960624210 2960629472 221
116 iso_pu_bacteria 2960637947 2960643020 221
117 iso_pu_bacteria 2960645483 2960651725 221
118 iso_pu_bacteria 2960652885 2960658264 221
119 iso_pu_bacteria 2960660292 2960665948 221
120 iso_pu_bacteria 2960667422 2960673642 221
121 iso_pu_bacteria 2960674078 2960679995 221
122 iso_pu_bacteria 2960687367 2960691234 221
123 iso_pu_bacteria 2964607997 2964608020 221
124 iso_pu_bacteria 2964615318 2964617649 221
125 iso_pu_bacteria 2964621998 2964625808 221
126 iso_pu_bacteria 2964628898 2964635669 221
127 iso_pu_bacteria 2964636051 2964638745 221
128 iso_pu_bacteria 2964643177 2964644692 221
129 iso_pu_bacteria 2964649959 2964654686 221
130 iso_pu_bacteria 2964656573 2964658898 221
131 iso_pu_bacteria 2964663802 2964664575 221
132 iso_pu_bacteria 2964670856 2964674655 221
133 iso_pu_bacteria 2964678106 2964678697 221
134 iso_pu_bacteria 2964685014 2964688600 221
135 iso_pu_bacteria 2964691889 2964694481 221
136 iso_pu_bacteria 2964698721 2964701072 221
137 iso_pu_bacteria 2964705432 2964705521 221
138 iso_pu_bacteria 2964712639 2964718281 221
139 iso_pu_bacteria 2964719344 2964721343 221
140 iso_pu_bacteria 2967671571 2967678115 221
141 iso_pu_bacteria 2967678726 2967681040 221
142 iso_pu_bacteria 2967693043 2967693908 221
143 iso_pu_bacteria 2967699805 2967702248 221
144 iso_pu_bacteria 2967706974 2967709104 221
145 iso_pu_bacteria 2967714385 2967719705 221
146 iso_pu_bacteria 2967721400 2967727102 221
147 iso_pu_bacteria 2967735183 2967738031 221
148 iso_pu_bacteria 2967742019 2967747293 221
149 iso_pu_bacteria 2967748971 2967751235 221
150 iso_pu_bacteria 2967755722 2967756800 221
151 iso_pu_bacteria 2967762386 2967765604 221
152 iso_pu_bacteria 2967769361 2967773733 221
153 iso_pu_bacteria 2967775926 2967780998 221
154 iso_pu_bacteria 2970019648 2970025428 221
155 iso_pu_bacteria 2970033650 2970036576 221
156 iso_pu_bacteria 2970040964 2970043681 221
157 iso_pu_bacteria 2970047711 2970047948 221
158 iso_pu_bacteria 2970054988 2970056333 221
159 iso_pu_bacteria 2970061556 2970061592 221
160 iso_pu_bacteria 2970068827 2970072200 221
161 iso_pu_bacteria 2970076120 2970079935 221
162 iso_pu_bacteria 2970082768 2970085530 221
163 iso_pu_bacteria 2970088815 2970088851 221
164 iso_pu_bacteria 2970095765 2970098181 221
165 iso_pu_bacteria 2970102677 2970106260 221
166 iso_pu_bacteria 2970109326 2970113247 221
167 iso_pu_bacteria 2970116247 2970117223 221
168 iso_pu_bacteria 2970129317 2970130683 221
169 iso_pu_bacteria 2970136068 2970139109 221
170 iso_pu_bacteria 2970149975 2970156529 221
171 iso_pu_bacteria 2970164137 2970164228 221
172 iso_pu_bacteria 2970170962 2970172578 221
173 iso_pu_bacteria 2970177841 2970182638 221
174 iso_pu_bacteria 2970184632 2970185178 221
175 iso_pu_bacteria 2970191845 2970193186 221
176 iso_pu_bacteria 2977516862 2977517554 221
177 iso_pu_bacteria 2977523885 2977529640 221
178 iso_pu_bacteria 2977537788 2977541904 221
179 iso_pu_bacteria 2977551784 2977555166 221
180 iso_pu_bacteria 2977558990 2977562429 221
181 iso_pu_bacteria 2977565890 2977567824 221
182 iso_pu_bacteria 2977572785 2977578596 221
183 iso_pu_bacteria 2977579622 2977581340 221
184 iso_pu_bacteria 648276728 648736298 221
185 iso_pu_bacteria 8003992118 8003997380 221
186 iso_pu_bacteria 2508501122 2509109622 222
187 iso_pu_bacteria 2509276019 2509378053 222
188 iso_pu_bacteria 2512047086 2512531473 222
189 iso_pu_bacteria 2513237088 2513597411 222
190 iso_pu_bacteria 2513237096 2513656921 222
191 iso_pu_bacteria 2513237137 2513855985 222
192 iso_pu_bacteria 2513237145 2513918661 222
193 iso_pu_bacteria 2516143018 2516205899 222
194 iso_pu_bacteria 2516143018 2516210430 222
195 iso_pu_bacteria 2558860100 2558867446 222
196 iso_pu_bacteria 2558860983 2561469379 222
197 iso_pu_bacteria 2657244999 2657685350 222
198 iso_pu_bacteria 2693429783 2694631127 222
199 iso_pu_bacteria 2693429784 2694638805 222
200 iso_pu_bacteria 2791355082 2792584495 222
201 iso_pu_bacteria 2802429268 2804752006 222
202 iso_pu_bacteria 2838074704 2838079832 222
203 iso_pu_bacteria 2838074704 2838080770 222
204 iso_pu_bacteria 2842509118 2842513214 222
205 iso_pu_bacteria 2850079185 2850082687 222
206 iso_pu_bacteria 2896384573 2896387699 222
207 iso_pu_bacteria 2906635258 2906643517 222
208 iso_pu_bacteria 2906660503 2906662275 222
209 iso_pu_bacteria 2913295892 2913298981 222
210 iso_pu_bacteria 2913295892 2913300648 222
211 iso_pu_bacteria 2913295892 2913301338 222
212 iso_pu_bacteria 2965062239 2965065799 222
213 iso_pu_bacteria 2968117919 2968124008 222
214 iso_pu_bacteria 8049293176 8049297124 222
215 iso_pu_bacteria 8057132660 8057136058 222
216 iso_pu_bacteria 2876369609 2876375368 223
217 3300005335 Ga0070666_10336567 Ga0070666_103365671 224
218 3300005344 Ga0070661_100472408 Ga0070661_1004724082 224
219 3300005353 Ga0070669_100896211 Ga0070669_1008962111 224
220 3300005439 Ga0070711_100023402 Ga0070711_1000234022 224
221 3300005455 Ga0070663_100113985 Ga0070663_1001139852 224
222 3300005614 Ga0068856_101259907 Ga0068856_1012599071 224
223 3300005618 Ga0068864_100058651 Ga0068864_1000586515 224
224 3300005842 Ga0068858_100208065 Ga0068858_1002080652 224
225 3300007076 Ga0075435_100341350 Ga0075435_1003413502 224
226 3300009177 Ga0105248_10486508 Ga0105248_104865082 224
227 3300009545 Ga0105237_10080439 Ga0105237_100804392 224
228 3300010375 Ga0105239_10148013 Ga0105239_101480132 224
229 3300011119 Ga0105246_10186531 Ga0105246_101865312 224
230 3300013306 Ga0163162_10019104 Ga0163162_100191043 224
231 3300013308 Ga0157375_10031900 Ga0157375_100319003 224
232 3300014325 Ga0163163_10001546 Ga0163163_1000154613 224
233 3300014968 Ga0157379_10032114 Ga0157379_100321142 224
234 3300025903 Ga0207680_10339198 Ga0207680_103391982 224
235 3300025914 Ga0207671_10309829 Ga0207671_103098291 224
236 3300025916 Ga0207663_10092491 Ga0207663_100924912 224
237 3300026067 Ga0207678_10207803 Ga0207678_102078032 224
238 3300026095 Ga0207676_10036723 Ga0207676_100367232 224
239 3300044684 Ga0466966_0042551 Ga0466966_0042551_958_1632 224
240 3300046809 Ga0495600_0273873 Ga0495600_0273873_13_687 224
241 3300048088 Ga0495602_0365990 Ga0495602_0365990_153_827 224
242 3300048903 Ga0496100_0039704 Ga0496100_0039704_2004_2678 224
243 3300048905 Ga0496102_0119701 Ga0496102_0119701_227_901 224
244 3300048907 Ga0496104_0005219 Ga0496104_0005219_9518_10192 224
245 3300048909 Ga0496106_0074629 Ga0496106_0074629_981_1655 224
246 3300048913 Ga0496110_0045599 Ga0496110_0045599_2356_3030 224
247 3300048914 Ga0496111_0020728 Ga0496111_0020728_1816_2490 224
248 3300048915 Ga0496112_0011919 Ga0496112_0011919_4898_5572 224
249 3300048916 Ga0496113_0098251 Ga0496113_0098251_741_1415 224
250 3300048918 Ga0496115_0252843 Ga0496115_0252843_567_1241 224
251 iso_pu_bacteria 2834578030 2834580057 224
252 iso_pu_bacteria 2924754689 2924755514 224
253 3300005344 Ga0070661_100395422 Ga0070661_1003954222 225
254 3300005434 Ga0070709_10003089 Ga0070709_1000308911 225
255 3300005435 Ga0070714_100018107 Ga0070714_1000181074 225
256 3300005436 Ga0070713_100158726 Ga0070713_1001587262 225
257 3300005437 Ga0070710_10007407 Ga0070710_100074073 225
258 3300005439 Ga0070711_100000494 Ga0070711_10000049410 225
259 3300005439 Ga0070711_100442828 Ga0070711_1004428281 225
260 3300005563 Ga0068855_100245823 Ga0068855_1002458232 225
261 3300006028 Ga0070717_10090284 Ga0070717_100902843 225
262 3300006163 Ga0070715_10079853 Ga0070715_100798533 225
263 3300006175 Ga0070712_100006727 Ga0070712_1000067275 225
264 3300009093 Ga0105240_10013849 Ga0105240_100138498 225
265 3300009545 Ga0105237_10010164 Ga0105237_1001016411 225
266 3300009551 Ga0105238_10465910 Ga0105238_104659102 225
267 3300013104 Ga0157370_10056567 Ga0157370_100565672 225
268 3300013105 Ga0157369_10257611 Ga0157369_102576112 225
269 3300021358 Ga0213873_10011697 Ga0213873_100116973 225
270 3300021384 Ga0213876_10001582 Ga0213876_100015828 225
271 3300022467 Ga0224712_10110548 Ga0224712_101105482 225
272 3300025253 Ga0209677_103290 Ga0209677_1032903 225
273 3300025272 Ga0209455_1005177 Ga0209455_10051772 225
274 3300025906 Ga0207699_10046624 Ga0207699_100466242 225
275 3300025913 Ga0207695_10071811 Ga0207695_100718115 225
276 3300025914 Ga0207671_10123932 Ga0207671_101239322 225
277 3300025914 Ga0207671_10153337 Ga0207671_101533372 225
278 3300025915 Ga0207693_10008865 Ga0207693_100088658 225
279 3300025916 Ga0207663_10017176 Ga0207663_100171764 225
280 3300025920 Ga0207649_10570443 Ga0207649_105704431 225
281 3300025928 Ga0207700_10042628 Ga0207700_100426286 225
282 3300025929 Ga0207664_10008270 Ga0207664_100082707 225
283 3300025939 Ga0207665_10006382 Ga0207665_100063821 225
284 3300026041 Ga0207639_10881230 Ga0207639_108812301 225
285 3300027296 Ga0209389_1000162 Ga0209389_100016238 225
286 3300027361 Ga0209489_110982 Ga0209489_1109827 225
287 3300027363 Ga0209700_100509 Ga0209700_10050934 225
288 3300037418 Ga0395900_0011071 Ga0395900_0011071_8455_9132 225
289 3300037466 Ga0395898_0031519 Ga0395898_0031519_197_874 225
290 3300037853 Ga0436364_1447381 Ga0436364_1447381_15_716 225
291 3300038443 Ga0395901_0829104 Ga0395901_0829104_118_795 225
292 3300039437 Ga0436365_0264506 Ga0436365_0264506_10708_11385 225
293 3300039453 Ga0436362_0847329 Ga0436362_0847329_1101_1778 225
294 3300048903 Ga0496100_0175192 Ga0496100_0175192_387_1064 225
295 3300048921 Ga0496118_0011989 Ga0496118_0011989_1422_2099 225
296 3300048922 Ga0496119_0121023 Ga0496119_0121023_485_1162 225
297 3300048924 Ga0496121_0058862 Ga0496121_0058862_1622_2299 225
298 3300048924 Ga0496121_0091611 Ga0496121_0091611_937_1614 225
299 3300005336 Ga0070680_100094799 Ga0070680_1000947993 226
300 3300006847 Ga0075431_100279728 Ga0075431_1002797281 226
301 3300006880 Ga0075429_100562944 Ga0075429_1005629442 226
302 3300006942 Ga0099824_1010817 Ga0099824_10108172 226
303 3300006943 Ga0099822_1025481 Ga0099822_10254812 226
304 3300009093 Ga0105240_10230880 Ga0105240_102308801 226
305 3300009094 Ga0111539_10069053 Ga0111539_100690536 226
306 3300009147 Ga0114129_10088446 Ga0114129_100884462 226
307 3300013105 Ga0157369_10629894 Ga0157369_106298941 226
308 3300021327 Ga0214543_1000015 Ga0214543_1000015126 226
309 3300025297 Ga0209758_1053448 Ga0209758_10534481 226
310 3300025913 Ga0207695_10327879 Ga0207695_103278792 226
311 3300025917 Ga0207660_10066608 Ga0207660_100666083 226
312 3300025921 Ga0207652_10057349 Ga0207652_100573493 226
313 3300027357 Ga0209589_1000001 Ga0209589_1000001373 226
314 3300027361 Ga0209489_100001 Ga0209489_100001373 226
315 3300027363 Ga0209700_100001 Ga0209700_100001373 226
316 3300027907 Ga0207428_10082875 Ga0207428_100828751 226
317 3300033442 Ga0315911_1000002 Ga0315911_1000002683 226
318 3300049586 Ga0501070_0080728 Ga0501070_0080728_531_1211 226
319 3300050511 nmdc:mga08y16_144700_c1 nmdc:mga08y16_144700_c1_240_920 226
320 iso_pu_bacteria 2513237101 2513696739 226
321 iso_pu_bacteria 2874604998 2874605609 226
322 3300049568 Ga0501031_0473791 Ga0501031_0473791_20_703 227
323 3300049578 Ga0501042_0124601 Ga0501042_0124601_1142_1825 227
324 3300049579 Ga0501043_0481374 Ga0501043_0481374_120_803 227
325 3300049580 Ga0501046_0395433 Ga0501046_0395433_243_926 227
326 3300049590 Ga0501074_0203712 Ga0501074_0203712_546_1229 227
327 3300049592 Ga0501076_0445337 Ga0501076_0445337_100_783 227
328 3300049741 Ga0501079_0063885 Ga0501079_0063885_1242_1925 227
329 3300049824 Ga0501045_0191016 Ga0501045_0191016_132_815 227
330 3300005435 Ga0070714_100017251 Ga0070714_1000172512 228
331 3300005436 Ga0070713_100015047 Ga0070713_1000150476 228
332 3300005437 Ga0070710_10137877 Ga0070710_101378772 228
333 3300005937 Ga0081455_10128390 Ga0081455_101283902 228
334 3300006028 Ga0070717_10265668 Ga0070717_102656682 228
335 3300025906 Ga0207699_10155835 Ga0207699_101558352 228
336 3300025928 Ga0207700_10078003 Ga0207700_100780032 228
337 3300025929 Ga0207664_10020489 Ga0207664_100204891 228
338 3300049586 Ga0501070_0016343 Ga0501070_0016343_4451_5137 228
339 3300049589 Ga0501073_0278635 Ga0501073_0278635_300_986 228
340 iso_pu_bacteria 2524023209 2524459868 229
341 iso_pu_bacteria 2524023209 2524462401 229
342 iso_pu_bacteria 2615840626 2616312086 229
343 iso_pu_bacteria 2775507266 2778174984 229
344 iso_pu_bacteria 2791355261 2793329587 229
345 iso_pu_bacteria 2838029111 2838034733 229
346 iso_pu_bacteria 2838042994 2838047540 229
347 iso_pu_bacteria 2842298080 2842301528 229
348 iso_pu_bacteria 2842357229 2842360627 229
349 iso_pu_bacteria 2842357229 2842363627 229
350 iso_pu_bacteria 2842475841 2842481544 229
351 iso_pu_bacteria 2842482326 2842487840 229
352 iso_pu_bacteria 2842502639 2842508380 229
353 iso_pu_bacteria 2936381700 2936384511 229
354 iso_pu_bacteria 2996893221 2996894377 229
355 iso_pu_bacteria 8005382845 8005385236 229
356 iso_pu_bacteria 8005395548 8005396153 229
357 3300005535 Ga0070684_100228077 Ga0070684_1002280772 230
358 3300005563 Ga0068855_100929844 Ga0068855_1009298441 230
359 3300025944 Ga0207661_10019368 Ga0207661_100193686 230
360 3300049571 Ga0501034_0131552 Ga0501034_0131552_1239_1934 231
361 3300002739 JGI25158J39367_1000310 JGI25158J39367_10003109 233
362 3300002773 JGI25152J39213_1008283 JGI25152J39213_10082832 233
363 3300002987 JGI25159J45721_1000119 JGI25159J45721_10001199 233
364 3300003215 JGI25153J46596_10001737 JGI25153J46596_100017377 233
365 3300003323 rootH1_10312232 rootH1_103122323 233
366 3300003374 JGI25161J50226_1000261 JGI25161J50226_10002615 233
367 3300003792 Ga0055540_1001785 Ga0055540_10017859 233
368 3300004625 Ga0055543_1000065 Ga0055543_100006563 233
369 3300005262 Ga0065165_1004997 Ga0065165_10049974 233
370 3300025208 Ga0209436_100014 Ga0209436_100014133 233
371 3300025245 Ga0207425_1017805 Ga0207425_10178052 233
372 3300025258 Ga0209129_1003182 Ga0209129_10031828 233
373 3300025273 Ga0209673_1027975 Ga0209673_10279752 233
374 3300025284 Ga0209130_1000004 Ga0209130_1000004507 233
375 3300025295 Ga0209564_1033478 Ga0209564_10334782 233
376 3300025297 Ga0209758_1000829 Ga0209758_100082921 233
377 3300025299 Ga0209256_1005714 Ga0209256_10057145 233
378 3300025302 Ga0207426_1000003 Ga0207426_1000003219 233
379 3300025304 Ga0209257_1026613 Ga0209257_10266132 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12973

Cupin_7

ChrR Cupin-like domain

4

108

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o14-assembly2.cif.gz_B crystal structure of an anti-ecfsigma factor, chrr (maqu_0586) from marinobacter aquaeolei vt8 at 1.70 a resolution 0.9516 1 223
3o14-assembly2.cif.gz_B crystal structure of an anti-ecfsigma factor, chrr (maqu_0586) from marinobacter aquaeolei vt8 at 1.70 a resolution 0.9433 1 223
4oi2-assembly1.cif.gz_A c. elegans clp1 and adp and mg2+ (turnover state) 0.8652 149 211
3cjx-assembly1.cif.gz_A crystal structure of a protein of unknown function with a cupin-like fold (reut_b4571) from ralstonia eutropha jmp134 at 2.60 a resolution 0.8622 134 214
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.8608 44 108
ID Description Score Start End Superfamily
3o14B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9539 1 223 2.60.120.10
3o14B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9496 1 223 2.60.120.10
af_Q9SR06_19_98_2.60.120.1030 Mainly Beta;Sandwich;Jelly Rolls;Clp1, DNA binding domain 0.865 149 213 2.60.120.1030
af_I1N5B5_339_414_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8539 145 214 2.60.120.10
4e4hC01 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8494 147 214 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A840GM83-F1-model_v4 Quercetin dioxygenase-like cupin family protein 0.9932 1 224 GO:0051213
AF-A0A4V2FL90-F1-model_v4 deleted 0.9929 1 224
AF-A0A1G6ZT36-F1-model_v4 Anti-sigma factor ChrR, cupin superfamily 0.9928 1 223
AF-A0A2H5F161-F1-model_v4 Cupin 0.9923 1 223
AF-A0A176ZI52-F1-model_v4 Cupin 0.9922 1 223

Feature Viewer

pLDDT pTM Quality
93.93 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map