F428505

General Info

Members Datasets Scaffolds Average Seq Length
379 260 758 360

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154202|2516083967
Length 396
Sequence PSESHRDLARLTRQILTDRVTTDRLRDLEAKDTWLDRPLWRELATAGVLAAALPHRAGGDGLGLMEQCGVLIEMGRSVAPVPYLSSIVTAAAGLATFGDDQQVTRWVTPTREGTMVLTAALAEGEVGAERVAGRWVLTGTKTTVPAAPDADLVLVPAKFGRRTVVFLVCPDDPGVTVEPQQVAGGEGAGWLDLARVTLPDDRLLGTVADGGAIAAWLTTRATVGSCALQLGVTERALELTAEYVRNRVQFGRPIGTFQAVAQRLADTYIDVEAIRLTLWQAAWRLAEGLPCPTEVATAKFWAAEAGHRVAHTAVHLHGGVGIDLDHQLHRYFLAAKHHEFRLGGATAQLRAIGAALTSTELEDQDGSAGESPPRRLNPADAPAGPTNRLAGLTPGR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
229 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
230 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
231 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
232 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
233 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
234 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
235 2643221561 Nocardioides sp. Root151 Isolate Unclassified
236 2643221576 Nocardioides sp. Root614 Isolate Unclassified
237 2643221590 Nocardioides sp. Root682 Isolate Unclassified
238 2643221604 Nocardioides sp. Root190 Isolate Unclassified
239 2643221617 Nocardioides sp. Root79 Isolate Unclassified
240 2643221620 Nocardioides sp. Root240 Isolate Unclassified
241 2643221692 Nocardia sp. Root136 Isolate Unclassified
242 2643221696 Nocardioides sp. Root140 Isolate Unclassified
243 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
244 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
245 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
246 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
247 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
248 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
249 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
250 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
251 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
252 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
253 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
254 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
255 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
256 2922554459 Rhodococcus sp. 66b Isolate Unclassified
257 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
258 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
259 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
260 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.03
Metatranscriptomes 0.26
Isolates 8.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0.26
Rhizoplane 4.22
Rhizosphere 86.54
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100034277 3300005329 Bacteria 4635
2 Ga0068869_100270371 3300005334 Bacteria 1363
3 Ga0070666_10008683 3300005335 Bacteria 6319
4 Ga0070682_100070734 3300005337 Bacteria 2231
5 Ga0068868_100280400 3300005338 Bacteria 1410
6 Ga0070660_100007089 3300005339 Bacteria 7789
7 Ga0070660_100123021 3300005339 Bacteria 2071
8 Ga0070687_100161219 3300005343 Bacteria 1326
9 Ga0070661_100139107 3300005344 Bacteria 1829
10 Ga0070668_100002919 3300005347 Bacteria 12638
11 Ga0070671_100064045 3300005355 Bacteria 3062
12 Ga0070659_100045679 3300005366 Bacteria 3431
13 Ga0070667_100025273 3300005367 Bacteria 4937
14 Ga0070667_100204243 3300005367 Bacteria 1754
15 Ga0070709_10002253 3300005434 Bacteria 10450
16 Ga0070709_10145124 3300005434 Bacteria 1634
17 Ga0070714_100001106 3300005435 Bacteria 19315
18 Ga0070714_100002124 3300005435 Bacteria 14557
19 Ga0070714_100006826 3300005435 Bacteria 8847
20 Ga0070714_100013705 3300005435 Bacteria 6502
21 Ga0070713_100065198 3300005436 Bacteria 3059
22 Ga0070713_100161285 3300005436 Bacteria 2002
23 Ga0070713_100258592 3300005436 Bacteria 1590
24 Ga0070710_10005243 3300005437 Bacteria 6142
25 Ga0070708_100260994 3300005445 Bacteria 1628
26 Ga0070708_100336722 3300005445 Bacteria 1422
27 Ga0070663_100272681 3300005455 Bacteria 1346
28 Ga0070685_10214080 3300005466 Bacteria 1259
29 Ga0070706_100004479 3300005467 Bacteria 13470
30 Ga0070706_100026215 3300005467 Bacteria 5364
31 Ga0070706_100273658 3300005467 Bacteria 1576
32 Ga0070707_100045139 3300005468 Bacteria 4218
33 Ga0070707_100074889 3300005468 Bacteria 3265
34 Ga0070707_100079550 3300005468 Bacteria 3164
35 Ga0070698_100071032 3300005471 Bacteria 3492
36 Ga0070698_100142981 3300005471 Unclassified 2343
37 Ga0070699_100046676 3300005518 Bacteria 3748
38 Ga0070699_100150309 3300005518 Bacteria 2059
39 Ga0070699_100163362 3300005518 Bacteria 1972
40 Ga0070665_100303185 3300005548 Bacteria 1600
41 Ga0070664_100069044 3300005564 Bacteria 3023
42 Ga0068857_100360753 3300005577 Bacteria 1347
43 Ga0068856_100253828 3300005614 Bacteria 1773
44 Ga0070702_100033593 3300005615 Bacteria 2822
45 Ga0068852_100057515 3300005616 Bacteria 3365
46 Ga0068852_100348461 3300005616 Bacteria 1445
47 Ga0068859_100127043 3300005617 Bacteria 2619
48 Ga0068870_10081380 3300005840 Bacteria 1791
49 Ga0068858_100237959 3300005842 Bacteria 1727
50 Ga0081455_10000174 3300005937 Bacteria 80174
51 Ga0081540_1000188 3300005983 Bacteria 64441
52 Ga0081540_1009993 3300005983 Bacteria 6460
53 Ga0081539_10032387 3300005985 Bacteria 3202
54 Ga0070717_10027080 3300006028 Bacteria 4579
55 Ga0070717_10152017 3300006028 Bacteria 2003
56 Ga0070717_10178675 3300006028 Bacteria 1849
57 Ga0075365_10013092 3300006038 Bacteria 4947
58 Ga0075363_100141690 3300006048 Bacteria 1354
59 Ga0070715_10029592 3300006163 Bacteria 2206
60 Ga0075428_100122851 3300006844 Bacteria 2826
61 Ga0075428_100446928 3300006844 Bacteria 1385
62 Ga0075430_100006562 3300006846 Bacteria 9814
63 Ga0075434_100012105 3300006871 Bacteria 8169
64 Ga0075429_100002029 3300006880 Bacteria 16852
65 Ga0097620_100127043 3300006931 Bacteria 2619
66 Ga0075435_100017468 3300007076 Bacteria 5433
67 Ga0075435_100236568 3300007076 Bacteria 1552
68 Ga0105240_10413133 3300009093 Bacteria 1517
69 Ga0111539_10013954 3300009094 Bacteria 10042
70 Ga0111539_10031401 3300009094 Bacteria 6452
71 Ga0111539_10041439 3300009094 Bacteria 5536
72 Ga0105245_10476513 3300009098 Bacteria 1261
73 Ga0105245_10570697 3300009098 Bacteria 1155
74 Ga0114129_10081990 3300009147 Bacteria 4483
75 Ga0114129_10245117 3300009147 Bacteria 2408
76 Ga0114129_10635783 3300009147 Bacteria 1379
77 Ga0105243_10015124 3300009148 Bacteria 5840
78 Ga0105237_10062205 3300009545 Bacteria 3732
79 Ga0105238_10041557 3300009551 Bacteria 4656
80 Ga0105239_10021665 3300010375 Bacteria 7084
81 Ga0105246_10028229 3300011119 Bacteria 3685
82 Ga0157371_10106107 3300013102 Bacteria 1994
83 Ga0157378_10312412 3300013297 Bacteria 1525
84 Ga0157375_10112688 3300013308 Bacteria 2821
85 Ga0182008_10049690 3300014497 Bacteria 2082
86 Ga0224712_10007556 3300022467 Bacteria 3171
87 Ga0207692_10070699 3300025898 Bacteria 1838
88 Ga0207688_10009513 3300025901 Bacteria 5289
89 Ga0207699_10008777 3300025906 Bacteria 5004
90 Ga0207699_10022222 3300025906 Bacteria 3434
91 Ga0207699_10029189 3300025906 Bacteria 3073
92 Ga0207684_10003429 3300025910 Bacteria 15477
93 Ga0207684_10037979 3300025910 Bacteria 4086
94 Ga0207684_10269435 3300025910 Bacteria 1469
95 Ga0207654_10027507 3300025911 Bacteria 3091
96 Ga0207693_10094385 3300025915 Bacteria 2344
97 Ga0207663_10015696 3300025916 Bacteria 4185
98 Ga0207660_10020838 3300025917 Bacteria 4406
99 Ga0207657_10001763 3300025919 Bacteria 23366
100 Ga0207646_10003481 3300025922 Bacteria 17766
101 Ga0207646_10038472 3300025922 Bacteria 4309
102 Ga0207646_10063665 3300025922 Bacteria 3292
103 Ga0207646_10108680 3300025922 Bacteria 2488
104 Ga0207646_10141000 3300025922 Bacteria 2171
105 Ga0207646_10168166 3300025922 Bacteria 1979
106 Ga0207700_10003327 3300025928 Bacteria 9324
107 Ga0207700_10147272 3300025928 Bacteria 1942
108 Ga0207664_10004688 3300025929 Bacteria 9275
109 Ga0207664_10007031 3300025929 Bacteria 7794
110 Ga0207664_10010150 3300025929 Bacteria 6643
111 Ga0207664_10014347 3300025929 Bacteria 5718
112 Ga0207664_10015505 3300025929 Bacteria 5534
113 Ga0207664_10119871 3300025929 Bacteria 2200
114 Ga0207664_10215185 3300025929 Bacteria 1664
115 Ga0207709_10002058 3300025935 Bacteria 13009
116 Ga0207670_10121359 3300025936 Bacteria 1900
117 Ga0207665_10064895 3300025939 Bacteria 2482
118 Ga0207661_10190180 3300025944 Bacteria 1799
119 Ga0207679_10049995 3300025945 Bacteria 3052
120 Ga0207712_10234893 3300025961 Bacteria 1474
121 Ga0207658_10066216 3300025986 Bacteria 2717
122 Ga0207677_10389723 3300026023 Bacteria 1178
123 Ga0207703_10039810 3300026035 Bacteria 3758
124 Ga0207678_10092044 3300026067 Bacteria 2592
125 Ga0207708_10228325 3300026075 Bacteria 1494
126 Ga0207702_10286076 3300026078 Bacteria 1560
127 Ga0207702_10299944 3300026078 Bacteria 1525
128 Ga0207648_10076532 3300026089 Bacteria 2917
129 Ga0207675_100102667 3300026118 Bacteria 2694
130 Ga0207683_10003222 3300026121 Bacteria 14237
131 Ga0207428_10077678 3300027907 Bacteria 2599
132 Ga0268265_10085472 3300028380 Bacteria 2504
133 Ga0268264_10147385 3300028381 Bacteria 2106
134 Ga0265337_1000136 3300028556 Bacteria 37039
135 Ga0265326_10014460 3300028558 Bacteria 2299
136 Ga0265334_10000864 3300028573 Bacteria 15173
137 Ga0265336_10005966 3300028666 Bacteria 4443
138 Ga0265336_10008962 3300028666 Bacteria 3481
139 Ga0307515_10002179 3300028794 Bacteria 43016
140 Ga0265338_10000144 3300028800 Bacteria 131848
141 Ga0265338_10002158 3300028800 Bacteria 30205
142 Ga0265338_10019346 3300028800 Bacteria 7228
143 Ga0265338_10023073 3300028800 Bacteria 6409
144 Ga0265324_10009029 3300029957 Bacteria 3914
145 Ga0307511_10042940 3300030521 Bacteria 3788
146 Ga0265330_10003577 3300031235 Bacteria 8096
147 Ga0265332_10000080 3300031238 Bacteria 83712
148 Ga0265328_10008463 3300031239 Bacteria 4240
149 Ga0265320_10019352 3300031240 Bacteria 3724
150 Ga0265320_10021146 3300031240 Bacteria 3506
151 Ga0265325_10022087 3300031241 Bacteria 3488
152 Ga0265339_10016602 3300031249 Bacteria 4384
153 Ga0265331_10000059 3300031250 Bacteria 172466
154 Ga0265316_10006511 3300031344 Bacteria 11140
155 Ga0265316_10019261 3300031344 Bacteria 5841
156 Ga0265314_10057943 3300031711 Bacteria 2656
157 Ga0265342_10010998 3300031712 Bacteria 6216
158 Ga0265342_10021941 3300031712 Bacteria 4068
159 Ga0307516_10001391 3300031730 Bacteria 33410
160 Ga0307409_100102301 3300031995 Bacteria 2380
161 Ga0307411_10001153 3300032005 Bacteria 10362
162 Ga0307415_100013806 3300032126 Bacteria 4727
163 Ga0307507_10042786 3300033179 Bacteria 4504
164 Ga0373938_0005223 3300034957 Bacteria 2201
165 Ga0373926_0000144 3300035083 Bacteria 15317
166 Ga0373926_0002343 3300035083 Bacteria 5996
167 Ga0373934_0003865 3300035086 Bacteria 5505
168 Ga0373934_0016941 3300035086 Bacteria 2775
169 Ga0373934_0037319 3300035086 Bacteria 1913
170 Ga0373944_0000375 3300035089 Bacteria 10116
171 Ga0373923_0001510 3300035111 Bacteria 6701
172 Ga0373936_0003787 3300035113 Bacteria 5693
173 Ga0373945_0020326 3300035116 Bacteria 2271
174 Ga0373953_0072624 3300035117 Bacteria 1421
175 Ga0373954_0017298 3300035118 Bacteria 3236
176 Ga0373956_0007203 3300035119 Bacteria 4481
177 Ga0373957_0014532 3300035120 Bacteria 2693
178 Ga0373960_0034298 3300035121 Bacteria 1435
179 Ga0373943_0001490 3300035170 Bacteria 10605
180 Ga0373946_0018693 3300035171 Bacteria 2663
181 Ga0373955_0070638 3300035172 Bacteria 1951
182 Ga0373962_0021729 3300035242 Bacteria 1695
183 Ga0373924_0001722 3300035410 Bacteria 7225
184 Ga0373924_0026948 3300035410 Bacteria 2283
185 Ga0373935_0067301 3300035692 Bacteria 2302
186 Ga0373927_0005721 3300035695 Bacteria 8535
187 Ga0373933_0017821 3300035724 Bacteria 3987
188 Ga0373933_0030479 3300035724 Bacteria 3123
189 Ga0373933_0040042 3300035724 Bacteria 2758
190 Ga0373947_0000030 3300035725 Bacteria 78635
191 Ga0373937_0013652 3300036401 Bacteria 7157
192 Ga0373937_0024592 3300036401 Bacteria 5434
193 Ga0373937_0072277 3300036401 Bacteria 3181
194 Ga0373937_0090351 3300036401 Bacteria 2836
195 Ga0373925_0000072 3300037068 Bacteria 106707
196 Ga0373925_0004361 3300037068 Bacteria 10703
197 Ga0373925_0049973 3300037068 Bacteria 3118
198 Ga0373925_0063915 3300037068 Bacteria 2769
199 Ga0373925_0072192 3300037068 Bacteria 2611
200 Ga0373925_0083658 3300037068 Bacteria 2431
201 Ga0395905_0125559 3300037471 Bacteria 2413
202 Ga0436364_1494816 3300037853 Bacteria 3500
203 Ga0436363_0937607 3300039450 Bacteria 5974
204 Ga0450907_012667 3300042146 Bacteria 1404
205 Ga0466969_0021718 3300044656 Bacteria 3318
206 Ga0466972_0024163 3300044658 Bacteria 3016
207 Ga0466965_0007816 3300044683 Bacteria 4927
208 Ga0466965_0039844 3300044683 Bacteria 2310
209 Ga0466966_0036772 3300044684 Bacteria 3160
210 Ga0466966_0145470 3300044684 Bacteria 1447
211 Ga0466966_0159949 3300044684 Bacteria 1371
212 Ga0466961_0007298 3300044693 Bacteria 7033
213 Ga0466961_0008351 3300044693 Bacteria 6594
214 Ga0466961_0049436 3300044693 Bacteria 2688
215 Ga0466961_0052099 3300044693 Bacteria 2612
216 Ga0466961_0055429 3300044693 Bacteria 2527
217 Ga0466963_0000837 3300044694 Bacteria 15434
218 Ga0466963_0037011 3300044694 Bacteria 3185
219 Ga0466971_0083372 3300044719 Bacteria 1459
220 Ga0466970_0001838 3300044765 Bacteria 10261
221 Ga0466970_0008490 3300044765 Bacteria 5171
222 Ga0466970_0037793 3300044765 Bacteria 2560
223 Ga0466957_0006506 3300044842 Bacteria 6598
224 Ga0466957_0027443 3300044842 Bacteria 3384
225 Ga0466960_0010432 3300044901 Bacteria 3859
226 Ga0466959_0005533 3300045049 Bacteria 8668
227 Ga0466967_0000649 3300045976 Bacteria 17446
228 Ga0466967_0002404 3300045976 Bacteria 11618
229 Ga0466967_0003216 3300045976 Bacteria 10554
230 Ga0466967_0198723 3300045976 Bacteria 1898
231 Ga0466967_0228909 3300045976 Bacteria 1769
232 Ga0495592_0004565 3300046454 Bacteria 10142
233 Ga0495592_0036204 3300046454 Bacteria 3717
234 Ga0495629_0004782 3300046459 Bacteria 10150
235 Ga0495629_0057533 3300046459 Bacteria 2719
236 Ga0495641_0019330 3300046461 Bacteria 3488
237 Ga0495651_0002432 3300046462 Bacteria 14373
238 Ga0495651_0046495 3300046462 Bacteria 3358
239 Ga0495651_0211238 3300046462 Bacteria 1350
240 Ga0495653_0019036 3300046463 Bacteria 5571
241 Ga0495653_0033766 3300046463 Bacteria 4050
242 Ga0495580_0031231 3300046472 Bacteria 3850
243 Ga0495582_0011967 3300046473 Bacteria 4779
244 Ga0495582_0076394 3300046473 Bacteria 1856
245 Ga0495639_0005741 3300046475 Bacteria 5339
246 Ga0495662_0001707 3300046476 Bacteria 10977
247 Ga0495594_0024836 3300046499 Bacteria 3221
248 Ga0495608_0000698 3300046511 Bacteria 23285
249 Ga0495618_0016777 3300046514 Bacteria 4484
250 Ga0495628_0080510 3300046516 Bacteria 2531
251 Ga0495628_0084813 3300046516 Bacteria 2458
252 Ga0495630_0002230 3300046517 Bacteria 13498
253 Ga0495630_0190391 3300046517 Bacteria 1565
254 Ga0495666_0025635 3300046526 Bacteria 2911
255 Ga0495652_0005318 3300046529 Bacteria 12141
256 Ga0495665_0015930 3300046531 Bacteria 4049
257 Ga0495665_0020247 3300046531 Bacteria 3576
258 Ga0495640_0005846 3300046533 Bacteria 9767
259 Ga0495587_0006107 3300046536 Bacteria 7861
260 Ga0495587_0018383 3300046536 Bacteria 4336
261 Ga0495645_0031520 3300046543 Bacteria 3863
262 Ga0495667_0002525 3300046559 Bacteria 12215
263 Ga0495667_0012742 3300046559 Bacteria 5698
264 Ga0495667_0026608 3300046559 Bacteria 3898
265 Ga0495634_0018242 3300046642 Bacteria 4997
266 Ga0495634_0048980 3300046642 Bacteria 2842
267 Ga0495635_0032948 3300046663 Bacteria 3594
268 Ga0495635_0056364 3300046663 Bacteria 2705
269 Ga0495588_0024660 3300046674 Bacteria 2989
270 Ga0495657_0007514 3300046675 Bacteria 8422
271 Ga0495657_0024703 3300046675 Bacteria 4274
272 Ga0495657_0038515 3300046675 Bacteria 3289
273 Ga0495599_0012885 3300046678 Bacteria 5160
274 Ga0495623_0034369 3300046679 Bacteria 3251
275 Ga0495646_0022856 3300046680 Bacteria 3939
276 Ga0495646_0064368 3300046680 Bacteria 2174
277 Ga0495647_0027414 3300046681 Bacteria 2093
278 Ga0495658_0068832 3300046683 Bacteria 2050
279 Ga0495613_0008278 3300046689 Bacteria 7718
280 Ga0495624_0025337 3300046690 Bacteria 3895
281 Ga0495600_0021363 3300046809 Bacteria 4144
282 Ga0495581_0000522 3300047315 Bacteria 19675
283 Ga0495581_0022817 3300047315 Bacteria 3625
284 Ga0495604_0007170 3300047317 Bacteria 8832
285 Ga0495604_0059160 3300047317 Bacteria 2938
286 Ga0495604_0199524 3300047317 Bacteria 1389
287 Ga0495674_0085511 3300047319 Bacteria 2701
288 Ga0495674_0339266 3300047319 Bacteria 1221
289 Ga0495680_0016454 3300047322 Bacteria 6351
290 Ga0495680_0036710 3300047322 Bacteria 3931
291 Ga0495680_0076595 3300047322 Bacteria 2535
292 Ga0495675_0003030 3300047444 Bacteria 10096
293 Ga0495684_0036339 3300047471 Bacteria 3777
294 Ga0495593_0030890 3300047673 Bacteria 2928
295 Ga0495602_0027900 3300048088 Bacteria 5415
296 Ga0495602_0060824 3300048088 Bacteria 3288
297 Ga0495602_0097402 3300048088 Bacteria 2423
298 Ga0495614_0054430 3300048089 Bacteria 1716
299 Ga0496101_0097728 3300048904 Bacteria 2193
300 Ga0496104_0061499 3300048907 Bacteria 3560
301 Ga0496104_0162423 3300048907 Bacteria 2142
302 Ga0496106_0032213 3300048909 Bacteria 3908
303 Ga0496106_0357302 3300048909 Bacteria 1173
304 Ga0496108_0000041 3300048911 Bacteria 147365
305 Ga0496108_0025576 3300048911 Bacteria 4866
306 Ga0496108_0039667 3300048911 Bacteria 3924
307 Ga0496109_0057219 3300048912 Bacteria 3559
308 Ga0496109_0081336 3300048912 Bacteria 2985
309 Ga0496110_0035627 3300048913 Bacteria 4318
310 Ga0496110_0437254 3300048913 Bacteria 1192
311 Ga0496111_0036584 3300048914 Bacteria 3510
312 Ga0496113_0022265 3300048916 Bacteria 4480
313 Ga0496113_0066856 3300048916 Bacteria 2723
314 Ga0496114_0126503 3300048917 Bacteria 2203
315 Ga0496125_0006413 3300048928 Bacteria 12716
316 Ga0501031_0074254 3300049568 Bacteria 2214
317 Ga0501032_0023023 3300049569 Bacteria 4312
318 Ga0501034_0007352 3300049571 Bacteria 11728
319 Ga0501037_0026624 3300049573 Bacteria 4273
320 Ga0501038_0030366 3300049574 Bacteria 4783
321 Ga0501042_0013093 3300049578 Bacteria 5641
322 Ga0501042_0013310 3300049578 Bacteria 5596
323 Ga0501043_0018538 3300049579 Bacteria 5460
324 Ga0501046_0002768 3300049580 Bacteria 16327
325 Ga0501048_0030979 3300049582 Bacteria 3871
326 Ga0501074_0064458 3300049590 Bacteria 2638
327 Ga0501080_0080571 3300049742 Bacteria 3026
328 Ga0501080_0199323 3300049742 Bacteria 1838
329 nmdc:mga0yw44_24092_c1 3300050492 Bacteria 3439
330 nmdc:mga05p37_102721_c1 3300050507 Bacteria 3520
331 nmdc:mga05p37_308840_c1 3300050507 Bacteria 1875
332 nmdc:mga0qj67_22925_c1 3300050509 Bacteria 4797
333 nmdc:mga06r32_397040_c1 3300050510 Unclassified 1361
334 nmdc:mga06r32_48726_c1 3300050510 Bacteria 4051
335 nmdc:mga08y16_108917_c1 3300050511 Bacteria 2884
336 nmdc:mga08y16_194857_c1 3300050511 Bacteria 2101
337 nmdc:mga08y16_31721_c1 3300050511 Bacteria 5556
338 nmdc:mga0n895_523941_c1 3300050512 Bacteria 1193
339 Ga0495601_0028695 3300053077 Bacteria 3447
340 Ga0495612_0004024 3300053078 Bacteria 6090
341 Ga0495619_0035406 3300053085 Bacteria 3247
342 Ga0500646_0001435 3300053090 Bacteria 6319
343 Ga0500588_0020052 3300053146 Bacteria 1787
344 Ga0501082_0157129 3300060353 Bacteria 1976
345 Ga0466962_0004669 3300061719 Bacteria 6579
346 Ga0466962_0030564 3300061719 Bacteria 2580
347 2516083967 2515154202 Bacteria 5471270
348 2515494360 2515154088 Bacteria 5526283
349 2515719630 2515154129 Bacteria 5584369
350 2515757447 2515154137 Bacteria 5711575
351 2516088926 2515154203 Bacteria 5458536
352 2558905651 2558860112 Bacteria 9931328
353 2566996090 2565956761 Bacteria 6601618
354 2643825984 2643221561 Bacteria 4984412
355 2643891771 2643221576 Bacteria 5214352
356 2643960819 2643221590 Bacteria 5214697
357 2644035662 2643221604 Bacteria 5014917
358 2644101617 2643221617 Bacteria 5139111
359 2644115679 2643221620 Bacteria 5134593
360 2644515657 2643221692 Bacteria 7282860
361 2644531975 2643221696 Bacteria 5431823
362 2738888793 2738541308 Bacteria 7020677
363 2739204689 2738543005 Bacteria 5278128
364 2739237754 2738543011 Bacteria 5731169
365 2739364345 2738543034 Bacteria 6084756
366 2744954117 2744054611 Bacteria 5611514
367 2753038569 2751185725 Bacteria 5740550
368 2753326966 2751185792 Bacteria 5739090
369 2812332657 2811994874 Bacteria 5367947
370 2842140314 2842134933 Bacteria 5847019
371 2866557173 2866552031 Bacteria 5824618
372 2870787802 2870782633 Bacteria 9624083
373 2889303732 2889300758 Bacteria 5690814
374 2904540725 2904535858 Bacteria 6308016
375 2922554814 2922554459 Bacteria 6683962
376 2928145533 2928142448 Bacteria 5288925
377 2939747517 2939743619 Bacteria 5762299
378 8047715946 8047710418 Bacteria 11023148
379 8056210602 8056207758 Bacteria 8639239
380 Ga0070683_100034277
381 Ga0068869_100270371
382 Ga0070666_10008683
383 Ga0070682_100070734
384 Ga0068868_100280400
385 Ga0070660_100007089
386 Ga0070660_100123021
387 Ga0070687_100161219
388 Ga0070661_100139107
389 Ga0070668_100002919
390 Ga0070671_100064045
391 Ga0070659_100045679
392 Ga0070667_100025273
393 Ga0070667_100204243
394 Ga0070709_10002253
395 Ga0070709_10145124
396 Ga0070714_100001106
397 Ga0070714_100002124
398 Ga0070714_100006826
399 Ga0070714_100013705
400 Ga0070713_100065198
401 Ga0070713_100161285
402 Ga0070713_100258592
403 Ga0070710_10005243
404 Ga0070708_100260994
405 Ga0070708_100336722
406 Ga0070663_100272681
407 Ga0070685_10214080
408 Ga0070706_100004479
409 Ga0070706_100026215
410 Ga0070706_100273658
411 Ga0070707_100045139
412 Ga0070707_100074889
413 Ga0070707_100079550
414 Ga0070698_100071032
415 Ga0070698_100142981
416 Ga0070699_100046676
417 Ga0070699_100150309
418 Ga0070699_100163362
419 Ga0070665_100303185
420 Ga0070664_100069044
421 Ga0068857_100360753
422 Ga0068856_100253828
423 Ga0070702_100033593
424 Ga0068852_100057515
425 Ga0068852_100348461
426 Ga0068859_100127043
427 Ga0068870_10081380
428 Ga0068858_100237959
429 Ga0081455_10000174
430 Ga0081540_1000188
431 Ga0081540_1009993
432 Ga0081539_10032387
433 Ga0070717_10027080
434 Ga0070717_10152017
435 Ga0070717_10178675
436 Ga0075365_10013092
437 Ga0075363_100141690
438 Ga0070715_10029592
439 Ga0075428_100122851
440 Ga0075428_100446928
441 Ga0075430_100006562
442 Ga0075434_100012105
443 Ga0075429_100002029
444 Ga0097620_100127043
445 Ga0075435_100017468
446 Ga0075435_100236568
447 Ga0105240_10413133
448 Ga0111539_10013954
449 Ga0111539_10031401
450 Ga0111539_10041439
451 Ga0105245_10476513
452 Ga0105245_10570697
453 Ga0114129_10081990
454 Ga0114129_10245117
455 Ga0114129_10635783
456 Ga0105243_10015124
457 Ga0105237_10062205
458 Ga0105238_10041557
459 Ga0105239_10021665
460 Ga0105246_10028229
461 Ga0157371_10106107
462 Ga0157378_10312412
463 Ga0157375_10112688
464 Ga0182008_10049690
465 Ga0224712_10007556
466 Ga0207692_10070699
467 Ga0207688_10009513
468 Ga0207699_10008777
469 Ga0207699_10022222
470 Ga0207699_10029189
471 Ga0207684_10003429
472 Ga0207684_10037979
473 Ga0207684_10269435
474 Ga0207654_10027507
475 Ga0207693_10094385
476 Ga0207663_10015696
477 Ga0207660_10020838
478 Ga0207657_10001763
479 Ga0207646_10003481
480 Ga0207646_10038472
481 Ga0207646_10063665
482 Ga0207646_10108680
483 Ga0207646_10141000
484 Ga0207646_10168166
485 Ga0207700_10003327
486 Ga0207700_10147272
487 Ga0207664_10004688
488 Ga0207664_10007031
489 Ga0207664_10010150
490 Ga0207664_10014347
491 Ga0207664_10015505
492 Ga0207664_10119871
493 Ga0207664_10215185
494 Ga0207709_10002058
495 Ga0207670_10121359
496 Ga0207665_10064895
497 Ga0207661_10190180
498 Ga0207679_10049995
499 Ga0207712_10234893
500 Ga0207658_10066216
501 Ga0207677_10389723
502 Ga0207703_10039810
503 Ga0207678_10092044
504 Ga0207708_10228325
505 Ga0207702_10286076
506 Ga0207702_10299944
507 Ga0207648_10076532
508 Ga0207675_100102667
509 Ga0207683_10003222
510 Ga0207428_10077678
511 Ga0268265_10085472
512 Ga0268264_10147385
513 Ga0265337_1000136
514 Ga0265326_10014460
515 Ga0265334_10000864
516 Ga0265336_10005966
517 Ga0265336_10008962
518 Ga0307515_10002179
519 Ga0265338_10000144
520 Ga0265338_10002158
521 Ga0265338_10019346
522 Ga0265338_10023073
523 Ga0265324_10009029
524 Ga0307511_10042940
525 Ga0265330_10003577
526 Ga0265332_10000080
527 Ga0265328_10008463
528 Ga0265320_10019352
529 Ga0265320_10021146
530 Ga0265325_10022087
531 Ga0265339_10016602
532 Ga0265331_10000059
533 Ga0265316_10006511
534 Ga0265316_10019261
535 Ga0265314_10057943
536 Ga0265342_10010998
537 Ga0265342_10021941
538 Ga0307516_10001391
539 Ga0307409_100102301
540 Ga0307411_10001153
541 Ga0307415_100013806
542 Ga0307507_10042786
543 Ga0373938_0005223
544 Ga0373926_0000144
545 Ga0373926_0002343
546 Ga0373934_0003865
547 Ga0373934_0016941
548 Ga0373934_0037319
549 Ga0373944_0000375
550 Ga0373923_0001510
551 Ga0373936_0003787
552 Ga0373945_0020326
553 Ga0373953_0072624
554 Ga0373954_0017298
555 Ga0373956_0007203
556 Ga0373957_0014532
557 Ga0373960_0034298
558 Ga0373943_0001490
559 Ga0373946_0018693
560 Ga0373955_0070638
561 Ga0373962_0021729
562 Ga0373924_0001722
563 Ga0373924_0026948
564 Ga0373935_0067301
565 Ga0373927_0005721
566 Ga0373933_0017821
567 Ga0373933_0030479
568 Ga0373933_0040042
569 Ga0373947_0000030
570 Ga0373937_0013652
571 Ga0373937_0024592
572 Ga0373937_0072277
573 Ga0373937_0090351
574 Ga0373925_0000072
575 Ga0373925_0004361
576 Ga0373925_0049973
577 Ga0373925_0063915
578 Ga0373925_0072192
579 Ga0373925_0083658
580 Ga0395905_0125559
581 Ga0436364_1494816
582 Ga0436363_0937607
583 Ga0450907_012667
584 Ga0466969_0021718
585 Ga0466972_0024163
586 Ga0466965_0007816
587 Ga0466965_0039844
588 Ga0466966_0036772
589 Ga0466966_0145470
590 Ga0466966_0159949
591 Ga0466961_0007298
592 Ga0466961_0008351
593 Ga0466961_0049436
594 Ga0466961_0052099
595 Ga0466961_0055429
596 Ga0466963_0000837
597 Ga0466963_0037011
598 Ga0466971_0083372
599 Ga0466970_0001838
600 Ga0466970_0008490
601 Ga0466970_0037793
602 Ga0466957_0006506
603 Ga0466957_0027443
604 Ga0466960_0010432
605 Ga0466959_0005533
606 Ga0466967_0000649
607 Ga0466967_0002404
608 Ga0466967_0003216
609 Ga0466967_0198723
610 Ga0466967_0228909
611 Ga0495592_0004565
612 Ga0495592_0036204
613 Ga0495629_0004782
614 Ga0495629_0057533
615 Ga0495641_0019330
616 Ga0495651_0002432
617 Ga0495651_0046495
618 Ga0495651_0211238
619 Ga0495653_0019036
620 Ga0495653_0033766
621 Ga0495580_0031231
622 Ga0495582_0011967
623 Ga0495582_0076394
624 Ga0495639_0005741
625 Ga0495662_0001707
626 Ga0495594_0024836
627 Ga0495608_0000698
628 Ga0495618_0016777
629 Ga0495628_0080510
630 Ga0495628_0084813
631 Ga0495630_0002230
632 Ga0495630_0190391
633 Ga0495666_0025635
634 Ga0495652_0005318
635 Ga0495665_0015930
636 Ga0495665_0020247
637 Ga0495640_0005846
638 Ga0495587_0006107
639 Ga0495587_0018383
640 Ga0495645_0031520
641 Ga0495667_0002525
642 Ga0495667_0012742
643 Ga0495667_0026608
644 Ga0495634_0018242
645 Ga0495634_0048980
646 Ga0495635_0032948
647 Ga0495635_0056364
648 Ga0495588_0024660
649 Ga0495657_0007514
650 Ga0495657_0024703
651 Ga0495657_0038515
652 Ga0495599_0012885
653 Ga0495623_0034369
654 Ga0495646_0022856
655 Ga0495646_0064368
656 Ga0495647_0027414
657 Ga0495658_0068832
658 Ga0495613_0008278
659 Ga0495624_0025337
660 Ga0495600_0021363
661 Ga0495581_0000522
662 Ga0495581_0022817
663 Ga0495604_0007170
664 Ga0495604_0059160
665 Ga0495604_0199524
666 Ga0495674_0085511
667 Ga0495674_0339266
668 Ga0495680_0016454
669 Ga0495680_0036710
670 Ga0495680_0076595
671 Ga0495675_0003030
672 Ga0495684_0036339
673 Ga0495593_0030890
674 Ga0495602_0027900
675 Ga0495602_0060824
676 Ga0495602_0097402
677 Ga0495614_0054430
678 Ga0496101_0097728
679 Ga0496104_0061499
680 Ga0496104_0162423
681 Ga0496106_0032213
682 Ga0496106_0357302
683 Ga0496108_0000041
684 Ga0496108_0025576
685 Ga0496108_0039667
686 Ga0496109_0057219
687 Ga0496109_0081336
688 Ga0496110_0035627
689 Ga0496110_0437254
690 Ga0496111_0036584
691 Ga0496113_0022265
692 Ga0496113_0066856
693 Ga0496114_0126503
694 Ga0496125_0006413
695 Ga0501031_0074254
696 Ga0501032_0023023
697 Ga0501034_0007352
698 Ga0501037_0026624
699 Ga0501038_0030366
700 Ga0501042_0013093
701 Ga0501042_0013310
702 Ga0501043_0018538
703 Ga0501046_0002768
704 Ga0501048_0030979
705 Ga0501074_0064458
706 Ga0501080_0080571
707 Ga0501080_0199323
708 nmdc:mga0yw44_24092_c1
709 nmdc:mga05p37_102721_c1
710 nmdc:mga05p37_308840_c1
711 nmdc:mga0qj67_22925_c1
712 nmdc:mga06r32_397040_c1
713 nmdc:mga06r32_48726_c1
714 nmdc:mga08y16_108917_c1
715 nmdc:mga08y16_194857_c1
716 nmdc:mga08y16_31721_c1
717 nmdc:mga0n895_523941_c1
718 Ga0495601_0028695
719 Ga0495612_0004024
720 Ga0495619_0035406
721 Ga0500646_0001435
722 Ga0500588_0020052
723 Ga0501082_0157129
724 Ga0466962_0004669
725 Ga0466962_0030564
726 2516083967
727 2515494360
728 2515719630
729 2515757447
730 2516088926
731 2558905651
732 2566996090
733 2643825984
734 2643891771
735 2643960819
736 2644035662
737 2644101617
738 2644115679
739 2644515657
740 2644531975
741 2738888793
742 2739204689
743 2739237754
744 2739364345
745 2744954117
746 2753038569
747 2753326966
748 2812332657
749 2842140314
750 2866557173
751 2870787802
752 2889303732
753 2904540725
754 2922554814
755 2928145533
756 2939747517
757 8047715946
758 8056210602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

223

341

0.96

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

208

357

0.91

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

2

114

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x28-assembly1.cif.gz_C crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis 0.9483 1 350
4x28-assembly1.cif.gz_C crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis 0.943 1 350
6wy9-assembly1.cif.gz_B tcur3481-tcur3483 steroid acad g363a variant 0.9369 7 350
7y0a-assembly1.cif.gz_B crystal structure of human short-chain acyl-coa dehydrogenase 0.9306 4 350
2vig-assembly1.cif.gz_A crystal structure of human short-chain acyl coa dehydrogenase 0.9269 5 350
ID Description Score Start End Superfamily
4x28D03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9617 212 350 1.20.140.10
af_A0A0K3AQR2_269_362_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.961 207 295 1.20.140.10
af_P95187_333_468_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9529 215 332 1.20.140.10
af_P96397_240_357_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9515 211 323 1.20.140.10
af_P71857_194_336_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9496 210 348 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A235G3C3-F1-model_v4 Alkylation response protein AidB-like acyl-CoA dehydrogenase 0.979 1 350 GO:0003995
GO:0050660
AF-A0A4P8PWL6-F1-model_v4 Acyl-CoA dehydrogenase 0.9785 1 350 GO:0003995
GO:0050660
AF-A0A1A3I9L1-F1-model_v4 Acyl-CoA dehydrogenase 0.9739 68 350 GO:0003995
AF-A0A235G3C3-F1-model_v4 Alkylation response protein AidB-like acyl-CoA dehydrogenase 0.9735 1 350 GO:0003995
GO:0050660
AF-A0A4P8PWL6-F1-model_v4 Acyl-CoA dehydrogenase 0.973 1 350 GO:0003995
GO:0050660

Map