F428474

General Info

Members Datasets Scaffolds Average Seq Length
379 288 758 345

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0068900|Ga0496126_0068900_292_1449
Length 378
Sequence MEGCFVQDHSSLQLRCFVLGMTPAQEKPQRKESVPSLRTTMEIGIDSFAAILPDPKTGKPPSGADRMADLLDEIEAADRYGLDVFGIGEHHRAEFLDSSPAVILAAAAARTQSIRLTSAVTVLSAADPVRVFQEFATLDLISRGRAEIVAGRGSFAEAFPLFGFDALDYDALFVEKIELLLKLRETPNLIGRGKFRVFPRPLQEKLPIWLGVGGTPESFYRAGALGLPLAVAIIGGDFARFRPLIDLYRQTGLEAGYPADQLKVAVHAMGFLAETSEQARDAFYPGWAHLVSTIGRERGWSAPLRKQFDATCGPGGAYLIGDPRYVADKMREMSEALGGLSRITFQMSSASLETAAMKRSIELLGTEVAPIVRAASNS

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
30 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
31 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
37 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
38 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
59 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
60 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
64 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
65 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
66 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
67 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
68 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
69 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
70 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
71 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
72 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
73 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
76 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
77 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
78 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
90 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
91 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
94 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
97 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
107 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
112 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
113 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
125 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
137 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
138 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
139 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
140 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
141 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
142 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
143 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
144 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
145 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
146 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
147 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
148 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
151 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
152 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
155 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
156 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
157 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
158 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
159 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
160 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
161 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
162 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
163 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
164 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
165 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
166 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
167 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
168 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
169 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
170 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
171 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
172 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
173 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
174 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
175 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
176 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
177 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
178 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
179 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
180 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
181 2643221582 Rhizobium sp. Root651 Isolate Unclassified
182 2643221599 Rhizobium sp. Root708 Isolate Unclassified
183 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
184 2643221733 Bosea sp. Root381 Isolate Unclassified
185 2718217882 Rhizobium sp. N741 Isolate Nodule
186 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
187 2718218009 Rhizobium sp. N561 Isolate Nodule
188 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
189 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
190 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
191 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
192 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
193 2718218363 Rhizobium sp. N113 Isolate Nodule
194 2718218365 Rhizobium sp. N731 Isolate Nodule
195 2718218366 Rhizobium sp. N621 Isolate Nodule
196 2721755514 Rhizobium sp. N6212 Isolate Nodule
197 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
198 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
199 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
200 2721755810 Rhizobium sp. N871 Isolate Nodule
201 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
202 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
203 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
204 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
205 2728369365 Rhizobium sp. N1341 Isolate Nodule
206 2728369397 Rhizobium sp. N1314 Isolate Nodule
207 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
208 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
209 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
210 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
211 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
212 2791355256 Rhizobium sp. M10 Isolate Nodule
213 2791355262 Rhizobium sp. M1 Isolate Nodule
214 2791355264 Rhizobium sp. S9 Isolate Nodule
215 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
216 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
217 2838048938 Rhizobium pisi 27/80 Isolate Nodule
218 2838061910 Rhizobium phaseoli L15 Isolate Nodule
219 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
220 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
221 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
222 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
223 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
224 2841760612 Bosea sp. Tri-49 Isolate Nodule
225 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
226 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
227 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
228 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
229 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
230 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
231 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
232 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
233 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
234 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
235 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
236 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
237 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
238 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
239 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
240 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
241 2842694124 Methylopila sp. R-72369 Isolate Unclassified
242 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
243 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
244 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
245 2844104063 Bosea sp. Tri-39 Isolate Nodule
246 2851182111 Bosea sp. Tri-44 Isolate Nodule
247 2851246043 Bosea sp. Tri-54 Isolate Nodule
248 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
249 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
250 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
251 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
252 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
253 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
254 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
255 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
256 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
257 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
258 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
259 2933599457 Rhizobium phaseoli M3 Isolate Nodule
260 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
261 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
262 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
263 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
264 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
265 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
266 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
267 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
268 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
269 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
270 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
271 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
272 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
273 8005382845 Rhizobium sp. R634 Isolate Nodule
274 8005395548 Rhizobium sp. R339 Isolate Nodule
275 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
276 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
277 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
278 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
279 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
280 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
281 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
282 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
283 8024501048 Rhizobium sp. H4 Isolate Nodule
284 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
285 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
286 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
287 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
288 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.44
Metatranscriptomes 0
Isolates 34.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.58
Nodule 24.01
Rhizoplane 0.79
Rhizosphere 36.15
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0068900 3300048929 Bacteria 3157
2 JGI25151J46595_10000376 3300003187 Bacteria 46624
3 JGI25153J46596_10000098 3300003215 Bacteria 100643
4 JGI25153J46596_10000136 3300003215 Bacteria 78754
5 rootH2_10144040 3300003320 Bacteria 3386
6 rootH1_10385870 3300003323 Unclassified 1384
7 Ga0055524_1000249 3300003775 Bacteria 56000
8 Ga0055524_1010189 3300003775 Bacteria 3759
9 Ga0055536_1008935 3300003781 Bacteria 4227
10 Ga0055528_1000018 3300003790 Bacteria 155302
11 Ga0058692_1005588 3300003856 Bacteria 3565
12 Ga0070658_10001757 3300005327 Bacteria 18233
13 Ga0068869_100020909 3300005334 Bacteria 4496
14 Ga0068868_100029190 3300005338 Bacteria 4223
15 Ga0070689_100328439 3300005340 Bacteria 1279
16 Ga0070668_100137205 3300005347 Bacteria 1968
17 Ga0070668_100395489 3300005347 Bacteria 1179
18 Ga0070708_100354972 3300005445 Bacteria 1382
19 Ga0070665_100039540 3300005548 Bacteria 4742
20 Ga0070665_100164947 3300005548 Bacteria 2218
21 Ga0068860_100035531 3300005843 Bacteria 4779
22 Ga0068862_100037076 3300005844 Bacteria 4132
23 Ga0075365_10030113 3300006038 Bacteria 3474
24 Ga0075365_10129693 3300006038 Bacteria 1744
25 Ga0075363_100009401 3300006048 Bacteria 4596
26 Ga0075367_10001900 3300006178 Bacteria 9259
27 Ga0075367_10012094 3300006178 Bacteria 4590
28 Ga0075367_10040585 3300006178 Bacteria 2718
29 Ga0075369_10031069 3300006186 Bacteria 2251
30 Ga0075370_10002310 3300006353 Bacteria 8795
31 Ga0075431_100121018 3300006847 Bacteria 2701
32 Ga0075436_100000003 3300006914 Bacteria 450287
33 Ga0075436_100000971 3300006914 Bacteria 19235
34 Ga0099795_10067832 3300007788 Bacteria 1339
35 Ga0105251_10001550 3300009011 Bacteria 19726
36 Ga0105240_10000227 3300009093 Bacteria 112637
37 Ga0123341_1018483 3300009765 Bacteria 6048
38 Ga0123342_1010560 3300009766 Bacteria 10515
39 Ga0099796_10000645 3300010159 Bacteria 6059
40 Ga0099796_10005086 3300010159 Bacteria 3251
41 Ga0105246_10166809 3300011119 Bacteria 1682
42 Ga0182008_10000137 3300014497 Bacteria 55850
43 Ga0163161_10068327 3300017792 Bacteria 2596
44 Ga0209147_100281 3300025229 Bacteria 43878
45 Ga0207425_1008814 3300025245 Bacteria 2550
46 Ga0209129_1000163 3300025258 Bacteria 100689
47 Ga0209673_1000055 3300025273 Bacteria 272768
48 Ga0209676_1000187 3300025292 Bacteria 141338
49 Ga0209025_1000346 3300025294 Bacteria 100696
50 Ga0209564_1000864 3300025295 Bacteria 40349
51 Ga0209564_1014840 3300025295 Bacteria 3210
52 Ga0209758_1000015 3300025297 Bacteria 851943
53 Ga0209758_1000283 3300025297 Bacteria 100697
54 Ga0209256_1006834 3300025299 Bacteria 5874
55 Ga0207713_1000591 3300025735 Bacteria 35937
56 Ga0207647_10001486 3300025904 Bacteria 18007
57 Ga0207705_10012160 3300025909 Bacteria 6220
58 Ga0207695_10000594 3300025913 Bacteria 72855
59 Ga0207689_10009778 3300025942 Bacteria 8262
60 Ga0207668_10135389 3300025972 Bacteria 1887
61 Ga0207677_10041913 3300026023 Bacteria 3030
62 Ga0207675_100118710 3300026118 Bacteria 2501
63 Ga0209371_1003703 3300027312 Bacteria 7188
64 Ga0209179_1001584 3300027512 Bacteria 2838
65 Ga0209813_10007401 3300027866 Bacteria 2734
66 Ga0268266_10157506 3300028379 Bacteria 2052
67 Ga0268266_10183892 3300028379 Bacteria 1905
68 Ga0268264_10095572 3300028381 Bacteria 2572
69 Ga0307515_10005985 3300028794 Bacteria 24500
70 Ga0307515_10007930 3300028794 Bacteria 20852
71 Ga0307515_10055210 3300028794 Bacteria 5811
72 Ga0268256_1000028 3300030500 Bacteria 433179
73 Ga0316181_1043780 3300030744 Bacteria 4230
74 Ga0307513_10324207 3300031456 Bacteria 1297
75 Ga0307516_10005065 3300031730 Bacteria 15946
76 Ga0307409_100113803 3300031995 Bacteria 2275
77 Ga0307510_10002220 3300033180 Bacteria 21943
78 Ga0451833_0094018 3300041491 Bacteria 2870
79 Ga0451833_0162805 3300041491 Bacteria 11155
80 Ga0451833_0681917 3300041491 Bacteria 8721
81 Ga0451835_0047371 3300041492 Bacteria 12683
82 Ga0451835_0932053 3300041492 Bacteria 6137
83 Ga0451837_0883486 3300041494 Bacteria 9899
84 Ga0451839_0595550 3300041496 Bacteria 11134
85 Ga0451841_0099928 3300041498 Bacteria 12991
86 Ga0451845_0009218 3300041501 Bacteria 13178
87 Ga0451847_0352854 3300041503 Bacteria 7014
88 Ga0451847_0436277 3300041503 Bacteria 7778
89 Ga0451849_0280234 3300041505 Bacteria 12956
90 Ga0451849_0413424 3300041505 Bacteria 3053
91 Ga0451851_0057209 3300041507 Bacteria 13607
92 Ga0451843_0151622 3300041509 Bacteria 11757
93 Ga0451843_0382429 3300041509 Bacteria 2540
94 Ga0451853_0536446 3300041512 Bacteria 12408
95 Ga0451853_3681379 3300041512 Bacteria 2606
96 Ga0439445_0004019 3300042004 Bacteria 3321
97 Ga0495617_003415 3300046452 Bacteria 5985
98 Ga0495617_042367 3300046452 Bacteria 1522
99 Ga0495627_000775 3300046453 Bacteria 23635
100 Ga0495627_054115 3300046453 Bacteria 1200
101 Ga0495590_0009050 3300046457 Bacteria 3782
102 Ga0495629_0024828 3300046459 Bacteria 4265
103 Ga0495638_0000386 3300046460 Bacteria 54523
104 Ga0495638_0015745 3300046460 Bacteria 5068
105 Ga0495651_0138385 3300046462 Bacteria 1769
106 Ga0495650_0000041 3300046471 Bacteria 363945
107 Ga0495605_0012033 3300046474 Bacteria 4811
108 Ga0495639_0005893 3300046475 Bacteria 5272
109 Ga0495585_0006947 3300046492 Bacteria 6973
110 Ga0495585_0022762 3300046492 Bacteria 3597
111 Ga0495583_0002178 3300046506 Bacteria 17472
112 Ga0495583_0029116 3300046506 Bacteria 2706
113 Ga0495583_0044476 3300046506 Bacteria 2060
114 Ga0495583_0044520 3300046506 Bacteria 2058
115 Ga0495606_0001422 3300046507 Bacteria 32132
116 Ga0495610_0047004 3300046512 Bacteria 2125
117 Ga0495620_0001055 3300046515 Bacteria 16913
118 Ga0495620_0009168 3300046515 Bacteria 5278
119 Ga0495620_0030652 3300046515 Bacteria 2473
120 Ga0495631_0000475 3300046518 Bacteria 27013
121 Ga0495632_0000006 3300046519 Bacteria 345883
122 Ga0495632_0023873 3300046519 Bacteria 3259
123 Ga0495632_0111836 3300046519 Bacteria 1282
124 Ga0495643_0006452 3300046522 Bacteria 7730
125 Ga0495643_0007708 3300046522 Bacteria 6899
126 Ga0495643_0012970 3300046522 Bacteria 5007
127 Ga0495643_0016168 3300046522 Bacteria 4389
128 Ga0495648_0000713 3300046524 Bacteria 35458
129 Ga0495648_0074685 3300046524 Bacteria 1952
130 Ga0495648_0125104 3300046524 Bacteria 1375
131 Ga0495663_0000035 3300046525 Bacteria 72251
132 Ga0495652_0201107 3300046529 Bacteria 1512
133 Ga0495654_0037165 3300046530 Bacteria 2444
134 Ga0495609_0009407 3300046538 Bacteria 4730
135 Ga0495597_0036135 3300046542 Bacteria 2226
136 Ga0495668_0008206 3300046616 Bacteria 6557
137 Ga0495611_0000530 3300046648 Bacteria 22502
138 Ga0495611_0001423 3300046648 Bacteria 11946
139 Ga0495625_0000074 3300046660 Bacteria 164813
140 Ga0495625_0000322 3300046660 Bacteria 72914
141 Ga0495625_0001116 3300046660 Bacteria 34801
142 Ga0495625_0004295 3300046660 Bacteria 13552
143 Ga0495625_0007739 3300046660 Bacteria 9286
144 Ga0495625_0021927 3300046660 Bacteria 4906
145 Ga0495661_0013933 3300046665 Bacteria 5391
146 Ga0495588_0002976 3300046674 Bacteria 7317
147 Ga0495588_0021069 3300046674 Bacteria 3209
148 Ga0495613_0020219 3300046689 Bacteria 4962
149 Ga0495670_0001019 3300046691 Bacteria 13614
150 Ga0495670_0015244 3300046691 Bacteria 3779
151 Ga0495670_0028827 3300046691 Bacteria 2753
152 Ga0495671_0001312 3300046692 Bacteria 16904
153 Ga0495649_0008500 3300046694 Bacteria 6170
154 Ga0495649_0012393 3300046694 Bacteria 4960
155 Ga0495600_0008153 3300046809 Bacteria 6431
156 Ga0495660_0009151 3300046810 Bacteria 5784
157 Ga0495660_0050364 3300046810 Bacteria 2269
158 Ga0495672_0001648 3300047320 Bacteria 21695
159 Ga0495672_0005846 3300047320 Bacteria 9649
160 Ga0495672_0086028 3300047320 Bacteria 1740
161 Ga0495683_0007031 3300047323 Bacteria 6107
162 Ga0495683_0080158 3300047323 Bacteria 1594
163 Ga0495687_000202 3300047443 Bacteria 84886
164 Ga0495687_006988 3300047443 Bacteria 6776
165 Ga0495687_050698 3300047443 Bacteria 1767
166 Ga0495681_0000170 3300047470 Bacteria 54525
167 Ga0495681_0069538 3300047470 Bacteria 1599
168 Ga0495686_0000531 3300047472 Bacteria 54712
169 Ga0495686_0125878 3300047472 Bacteria 1523
170 Ga0495626_0023863 3300048091 Bacteria 3005
171 Ga0496106_0000088 3300048909 Bacteria 73338
172 Ga0496109_0001340 3300048912 Bacteria 20347
173 Ga0496111_0000779 3300048914 Bacteria 17026
174 Ga0496118_0042576 3300048921 Bacteria 3581
175 Ga0496118_0108909 3300048921 Bacteria 1845
176 Ga0496121_0000240 3300048924 Bacteria 117890
177 Ga0496121_0006748 3300048924 Bacteria 14085
178 Ga0496121_0137422 3300048924 Bacteria 1818
179 Ga0496121_0303027 3300048924 Bacteria 1083
180 Ga0496122_0059650 3300048925 Bacteria 2815
181 Ga0496122_0173413 3300048925 Bacteria 1296
182 Ga0496123_0007367 3300048926 Bacteria 10405
183 Ga0496123_0028550 3300048926 Bacteria 4126
184 Ga0496124_0060935 3300048927 Bacteria 3164
185 Ga0496124_0163185 3300048927 Bacteria 1735
186 Ga0496126_0014366 3300048929 Bacteria 8006
187 Ga0496126_0177251 3300048929 Bacteria 1812
188 Ga0495678_002087 3300049459 Bacteria 14209
189 Ga0495678_006477 3300049459 Bacteria 6227
190 Ga0495678_025350 3300049459 Bacteria 2548
191 Ga0495682_0001338 3300049460 Bacteria 13616
192 Ga0495682_0047058 3300049460 Bacteria 1574
193 Ga0501032_0000159 3300049569 Bacteria 54766
194 Ga0501033_0000007 3300049570 Bacteria 303981
195 Ga0501048_0000976 3300049582 Bacteria 21182
196 nmdc:mga03n38_110664_c1 3300050490 Bacteria 1337
197 nmdc:mga03n38_8664_c1 3300050490 Bacteria 3662
198 nmdc:mga0yw44_153902_c1 3300050492 Bacteria 1501
199 nmdc:mga0k408_224153_c1 3300050493 Bacteria 1122
200 nmdc:mga0k408_4973_c1 3300050493 Bacteria 7043
201 nmdc:mga06z11_28493_c1 3300050494 Bacteria 2680
202 nmdc:mga06z11_382_c1 3300050494 Bacteria 16691
203 nmdc:mga06z11_5480_c2 3300050494 Bacteria 4595
204 nmdc:mga07m45_1494_c1 3300050496 Bacteria 10735
205 nmdc:mga06r32_211501_c1 3300050510 Bacteria 1927
206 nmdc:mga08x19_2499_c1 3300050514 Bacteria 11179
207 Ga0500610_0016602 3300053079 Bacteria 3515
208 Ga0500578_0040250 3300053086 Bacteria 3003
209 Ga0500643_006054 3300053087 Bacteria 5112
210 Ga0500643_006458 3300053087 Bacteria 4896
211 Ga0500644_0008429 3300053088 Bacteria 2723
212 Ga0500651_0000012 3300053093 Bacteria 243306
213 Ga0500651_0026785 3300053093 Bacteria 3625
214 Ga0500566_0000930 3300053094 Bacteria 16751
215 Ga0500556_0000002 3300053104 Bacteria 773626
216 Ga0500556_0000056 3300053104 Bacteria 115367
217 Ga0500556_0001634 3300053104 Bacteria 8783
218 Ga0500557_027201 3300053105 Bacteria 1698
219 Ga0500593_000197 3300053117 Bacteria 24459
220 Ga0500594_0002937 3300053118 Bacteria 3722
221 Ga0500607_053485 3300053121 Bacteria 2140
222 Ga0500608_000522 3300053122 Bacteria 14350
223 Ga0500608_001157 3300053122 Bacteria 9382
224 Ga0500618_001058 3300053125 Bacteria 13668
225 Ga0500618_026674 3300053125 Bacteria 1378
226 Ga0500559_0000919 3300053136 Bacteria 18725
227 Ga0500559_0010630 3300053136 Bacteria 3947
228 Ga0500574_000054 3300053141 Bacteria 13645
229 Ga0500586_000936 3300053145 Bacteria 6003
230 Ga0500590_000537 3300053148 Bacteria 13227
231 Ga0500590_000970 3300053148 Bacteria 11078
232 Ga0500590_045871 3300053148 Bacteria 2236
233 Ga0500616_0000069 3300053153 Bacteria 234334
234 Ga0500622_0001799 3300053156 Bacteria 16353
235 Ga0500624_000422 3300053157 Bacteria 12940
236 Ga0500633_0010722 3300053160 Bacteria 2466
237 Ga0500633_0029318 3300053160 Bacteria 1759
238 Ga0500634_0015781 3300053161 Bacteria 4017
239 Ga0500638_000026 3300053162 Bacteria 55912
240 Ga0500638_041287 3300053162 Bacteria 2241
241 Ga0500636_0000062 3300053177 Bacteria 52263
242 Ga0500636_0000089 3300053177 Bacteria 45506
243 Ga0500636_0000946 3300053177 Bacteria 15637
244 Ga0500636_0001127 3300053177 Bacteria 14310
245 Ga0500636_0017442 3300053177 Bacteria 4241
246 Ga0500567_038855 3300053723 Bacteria 2226
247 Ga0500645_010913 3300053730 Bacteria 2985
248 Ga0500661_002884 3300055283 Bacteria 3240
249 2511199937 2510917030 Bacteria 7460662
250 2513633555 2513237093 Bacteria 7545552
251 2513643023 2513237094 Bacteria 8789602
252 2513678898 2513237098 Bacteria 9902361
253 2513867277 2513237138 Bacteria 7368160
254 2513910184 2513237144 Bacteria 7530820
255 2515632091 2515154113 Bacteria 7807172
256 2515640574 2515154114 Bacteria 7848616
257 2517042035 2516653077 Bacteria 7555578
258 2517098689 2517093000 Bacteria 7412387
259 2559298449 2558860242 Bacteria 5568029
260 2585168865 2582581283 Bacteria 6030556
261 2585336644 2582581316 Bacteria 7774528
262 2585403981 2582581867 Bacteria 7184437
263 2585564307 2585427531 Bacteria 6992870
264 2585824826 2585427590 Bacteria 6824633
265 2585903211 2585427609 Bacteria 6667127
266 2587978639 2585428125 Bacteria 6662905
267 2643918455 2643221582 Bacteria 5804683
268 2644005614 2643221599 Bacteria 6292121
269 2644192209 2643221634 Bacteria 6705461
270 2644729540 2643221733 Bacteria 5690728
271 2719180669 2718217882 Bacteria 6556348
272 2719663788 2718217997 Bacteria 6740740
273 2719731418 2718218009 Bacteria 6478651
274 2720490207 2718218199 Bacteria 6740745
275 2720611588 2718218232 Bacteria 6720332
276 2720618437 2718218233 Bacteria 6662049
277 2720629845 2718218235 Bacteria 6630699
278 2720773540 2718218269 Bacteria 6906114
279 2721146763 2718218363 Bacteria 6524337
280 2721158287 2718218365 Bacteria 6274507
281 2721163642 2718218366 Bacteria 6425255
282 2722839812 2721755514 Bacteria 6424414
283 2723025211 2721755556 Bacteria 6745503
284 2723558796 2721755684 Bacteria 6859907
285 2723565366 2721755685 Bacteria 6704835
286 2724044174 2721755810 Bacteria 6479005
287 2724088147 2721755819 Bacteria 6906405
288 2724102631 2721755822 Bacteria 6726041
289 2724108527 2721755823 Bacteria 6752556
290 2730106147 2728369352 Bacteria 6745171
291 2730163906 2728369365 Bacteria 6555560
292 2730297919 2728369397 Bacteria 6274511
293 2738743440 2738541281 Bacteria 5112672
294 2739352347 2738543032 Bacteria 5115625
295 2740033429 2739367866 Bacteria 4215900
296 2758642680 2758568016 Bacteria 5645291
297 2766064689 2765235942 Bacteria 7445910
298 2793295334 2791355256 Bacteria 6798008
299 2793334353 2791355262 Bacteria 6774204
300 2793350420 2791355264 Bacteria 6429314
301 2821130339 2821123053 Bacteria 7836056
302 2821130352 2821123053 Bacteria 7836056
303 2838020158 2838016132 Bacteria 6577831
304 2838051625 2838048938 Bacteria 6044578
305 2838064100 2838061910 Bacteria 6794874
306 2838070985 2838068647 Bacteria 6208656
307 2838670248 2838668709 Bacteria 6671819
308 2838702619 2838701080 Bacteria 6669771
309 2839998374 2839993093 Bacteria 5512535
310 2840768608 2840764183 Bacteria 6358399
311 2841764076 2841760612 Bacteria 6454112
312 2842113716 2842110456 Bacteria 7656360
313 2842148123 2842146304 Bacteria 5957337
314 2842198578 2842192696 Bacteria 6147454
315 2842253189 2842250916 Bacteria 6579627
316 2842268887 2842264693 Bacteria 6472963
317 2842312747 2842311132 Bacteria 6616990
318 2842320597 2842317721 Bacteria 6793725
319 2842424600 2842422224 Bacteria 6239196
320 2842432913 2842428310 Bacteria 6767288
321 2842439218 2842434925 Bacteria 6502746
322 2842445847 2842441272 Bacteria 6769273
323 2842451973 2842447887 Bacteria 6754142
324 2842467033 2842462802 Bacteria 6588055
325 2842473939 2842469257 Bacteria 6752936
326 2842495667 2842489311 Bacteria 6620893
327 2842496939 2842495871 Bacteria 6820686
328 2842694788 2842694124 Bacteria 4063419
329 2842695305 2842694124 Bacteria 4063419
330 2842702846 2842698319 Bacteria 5190321
331 2842703238 2842698319 Bacteria 5190321
332 2842927356 2842922631 Bacteria 5824079
333 2842927924 2842922631 Bacteria 5824079
334 2844012098 2844009547 Bacteria 6728125
335 2844108469 2844104063 Bacteria 6440972
336 2851185472 2851182111 Bacteria 6047226
337 2851250511 2851246043 Bacteria 6439203
338 2852653721 2852653556 Bacteria 4050083
339 2857522792 2857516855 Bacteria 7787325
340 2874171032 2874168670 Bacteria 8062617
341 2885391296 2885383462 Bacteria 9473874
342 2893068231 2893066018 Bacteria 6158120
343 2902409280 2902405164 Bacteria 6784948
344 2903770686 2903768456 Bacteria 9749579
345 2903775131 2903768456 Bacteria 9749579
346 2919682342 2919679072 Bacteria 4629602
347 2921208709 2921208531 Bacteria 6745326
348 2933023102 2933016740 Bacteria 6355406
349 2933589646 2933586486 Bacteria 7667493
350 2933601784 2933599457 Bacteria 5858799
351 2935677353 2935675223 Bacteria 9928132
352 2935699131 2935694250 Bacteria 9291695
353 2935776711 2935769743 Bacteria 7878163
354 2935792599 2935785616 Bacteria 7962367
355 2935800605 2935793552 Bacteria 8012592
356 2935816357 2935810662 Bacteria 9401221
357 2936042690 2936037263 Bacteria 9446081
358 2937124606 2937119839 Bacteria 6597547
359 2957419043 2957415311 Bacteria 6991633
360 2960614657 2960610863 Bacteria 6691244
361 2960639404 2960637947 Bacteria 7296468
362 2964720420 2964719344 Bacteria 7286602
363 8005289135 8005282627 Bacteria 6675747
364 8005389381 8005382845 Bacteria 6732062
365 8005396757 8005395548 Bacteria 6806915
366 8005432805 8005430974 Bacteria 6689030
367 8005498535 8005497431 Bacteria 6477605
368 8005564815 8005563573 Bacteria 7153261
369 8005619727 8005619151 Bacteria 7030230
370 8005628299 8005626139 Bacteria 6534237
371 8005669946 8005668836 Bacteria 6953162
372 8019568869 8019565922 Bacteria 9639779
373 8024487137 8024486573 Bacteria 6540512
374 8024504245 8024501048 Bacteria 6427847
375 8045869189 8045864390 Bacteria 5043873
376 8054303647 8054302542 Bacteria 5698134
377 8055536964 8055531788 Bacteria 5249694
378 8055912065 8055909800 Bacteria 7278581
379 8056377455 8056375014 Bacteria 7006639
380 Ga0496126_0068900
381 JGI25151J46595_10000376
382 JGI25153J46596_10000098
383 JGI25153J46596_10000136
384 rootH2_10144040
385 rootH1_10385870
386 Ga0055524_1000249
387 Ga0055524_1010189
388 Ga0055536_1008935
389 Ga0055528_1000018
390 Ga0058692_1005588
391 Ga0070658_10001757
392 Ga0068869_100020909
393 Ga0068868_100029190
394 Ga0070689_100328439
395 Ga0070668_100137205
396 Ga0070668_100395489
397 Ga0070708_100354972
398 Ga0070665_100039540
399 Ga0070665_100164947
400 Ga0068860_100035531
401 Ga0068862_100037076
402 Ga0075365_10030113
403 Ga0075365_10129693
404 Ga0075363_100009401
405 Ga0075367_10001900
406 Ga0075367_10012094
407 Ga0075367_10040585
408 Ga0075369_10031069
409 Ga0075370_10002310
410 Ga0075431_100121018
411 Ga0075436_100000003
412 Ga0075436_100000971
413 Ga0099795_10067832
414 Ga0105251_10001550
415 Ga0105240_10000227
416 Ga0123341_1018483
417 Ga0123342_1010560
418 Ga0099796_10000645
419 Ga0099796_10005086
420 Ga0105246_10166809
421 Ga0182008_10000137
422 Ga0163161_10068327
423 Ga0209147_100281
424 Ga0207425_1008814
425 Ga0209129_1000163
426 Ga0209673_1000055
427 Ga0209676_1000187
428 Ga0209025_1000346
429 Ga0209564_1000864
430 Ga0209564_1014840
431 Ga0209758_1000015
432 Ga0209758_1000283
433 Ga0209256_1006834
434 Ga0207713_1000591
435 Ga0207647_10001486
436 Ga0207705_10012160
437 Ga0207695_10000594
438 Ga0207689_10009778
439 Ga0207668_10135389
440 Ga0207677_10041913
441 Ga0207675_100118710
442 Ga0209371_1003703
443 Ga0209179_1001584
444 Ga0209813_10007401
445 Ga0268266_10157506
446 Ga0268266_10183892
447 Ga0268264_10095572
448 Ga0307515_10005985
449 Ga0307515_10007930
450 Ga0307515_10055210
451 Ga0268256_1000028
452 Ga0316181_1043780
453 Ga0307513_10324207
454 Ga0307516_10005065
455 Ga0307409_100113803
456 Ga0307510_10002220
457 Ga0451833_0094018
458 Ga0451833_0162805
459 Ga0451833_0681917
460 Ga0451835_0047371
461 Ga0451835_0932053
462 Ga0451837_0883486
463 Ga0451839_0595550
464 Ga0451841_0099928
465 Ga0451845_0009218
466 Ga0451847_0352854
467 Ga0451847_0436277
468 Ga0451849_0280234
469 Ga0451849_0413424
470 Ga0451851_0057209
471 Ga0451843_0151622
472 Ga0451843_0382429
473 Ga0451853_0536446
474 Ga0451853_3681379
475 Ga0439445_0004019
476 Ga0495617_003415
477 Ga0495617_042367
478 Ga0495627_000775
479 Ga0495627_054115
480 Ga0495590_0009050
481 Ga0495629_0024828
482 Ga0495638_0000386
483 Ga0495638_0015745
484 Ga0495651_0138385
485 Ga0495650_0000041
486 Ga0495605_0012033
487 Ga0495639_0005893
488 Ga0495585_0006947
489 Ga0495585_0022762
490 Ga0495583_0002178
491 Ga0495583_0029116
492 Ga0495583_0044476
493 Ga0495583_0044520
494 Ga0495606_0001422
495 Ga0495610_0047004
496 Ga0495620_0001055
497 Ga0495620_0009168
498 Ga0495620_0030652
499 Ga0495631_0000475
500 Ga0495632_0000006
501 Ga0495632_0023873
502 Ga0495632_0111836
503 Ga0495643_0006452
504 Ga0495643_0007708
505 Ga0495643_0012970
506 Ga0495643_0016168
507 Ga0495648_0000713
508 Ga0495648_0074685
509 Ga0495648_0125104
510 Ga0495663_0000035
511 Ga0495652_0201107
512 Ga0495654_0037165
513 Ga0495609_0009407
514 Ga0495597_0036135
515 Ga0495668_0008206
516 Ga0495611_0000530
517 Ga0495611_0001423
518 Ga0495625_0000074
519 Ga0495625_0000322
520 Ga0495625_0001116
521 Ga0495625_0004295
522 Ga0495625_0007739
523 Ga0495625_0021927
524 Ga0495661_0013933
525 Ga0495588_0002976
526 Ga0495588_0021069
527 Ga0495613_0020219
528 Ga0495670_0001019
529 Ga0495670_0015244
530 Ga0495670_0028827
531 Ga0495671_0001312
532 Ga0495649_0008500
533 Ga0495649_0012393
534 Ga0495600_0008153
535 Ga0495660_0009151
536 Ga0495660_0050364
537 Ga0495672_0001648
538 Ga0495672_0005846
539 Ga0495672_0086028
540 Ga0495683_0007031
541 Ga0495683_0080158
542 Ga0495687_000202
543 Ga0495687_006988
544 Ga0495687_050698
545 Ga0495681_0000170
546 Ga0495681_0069538
547 Ga0495686_0000531
548 Ga0495686_0125878
549 Ga0495626_0023863
550 Ga0496106_0000088
551 Ga0496109_0001340
552 Ga0496111_0000779
553 Ga0496118_0042576
554 Ga0496118_0108909
555 Ga0496121_0000240
556 Ga0496121_0006748
557 Ga0496121_0137422
558 Ga0496121_0303027
559 Ga0496122_0059650
560 Ga0496122_0173413
561 Ga0496123_0007367
562 Ga0496123_0028550
563 Ga0496124_0060935
564 Ga0496124_0163185
565 Ga0496126_0014366
566 Ga0496126_0177251
567 Ga0495678_002087
568 Ga0495678_006477
569 Ga0495678_025350
570 Ga0495682_0001338
571 Ga0495682_0047058
572 Ga0501032_0000159
573 Ga0501033_0000007
574 Ga0501048_0000976
575 nmdc:mga03n38_110664_c1
576 nmdc:mga03n38_8664_c1
577 nmdc:mga0yw44_153902_c1
578 nmdc:mga0k408_224153_c1
579 nmdc:mga0k408_4973_c1
580 nmdc:mga06z11_28493_c1
581 nmdc:mga06z11_382_c1
582 nmdc:mga06z11_5480_c2
583 nmdc:mga07m45_1494_c1
584 nmdc:mga06r32_211501_c1
585 nmdc:mga08x19_2499_c1
586 Ga0500610_0016602
587 Ga0500578_0040250
588 Ga0500643_006054
589 Ga0500643_006458
590 Ga0500644_0008429
591 Ga0500651_0000012
592 Ga0500651_0026785
593 Ga0500566_0000930
594 Ga0500556_0000002
595 Ga0500556_0000056
596 Ga0500556_0001634
597 Ga0500557_027201
598 Ga0500593_000197
599 Ga0500594_0002937
600 Ga0500607_053485
601 Ga0500608_000522
602 Ga0500608_001157
603 Ga0500618_001058
604 Ga0500618_026674
605 Ga0500559_0000919
606 Ga0500559_0010630
607 Ga0500574_000054
608 Ga0500586_000936
609 Ga0500590_000537
610 Ga0500590_000970
611 Ga0500590_045871
612 Ga0500616_0000069
613 Ga0500622_0001799
614 Ga0500624_000422
615 Ga0500633_0010722
616 Ga0500633_0029318
617 Ga0500634_0015781
618 Ga0500638_000026
619 Ga0500638_041287
620 Ga0500636_0000062
621 Ga0500636_0000089
622 Ga0500636_0000946
623 Ga0500636_0001127
624 Ga0500636_0017442
625 Ga0500567_038855
626 Ga0500645_010913
627 Ga0500661_002884
628 2511199937
629 2513633555
630 2513643023
631 2513678898
632 2513867277
633 2513910184
634 2515632091
635 2515640574
636 2517042035
637 2517098689
638 2559298449
639 2585168865
640 2585336644
641 2585403981
642 2585564307
643 2585824826
644 2585903211
645 2587978639
646 2643918455
647 2644005614
648 2644192209
649 2644729540
650 2719180669
651 2719663788
652 2719731418
653 2720490207
654 2720611588
655 2720618437
656 2720629845
657 2720773540
658 2721146763
659 2721158287
660 2721163642
661 2722839812
662 2723025211
663 2723558796
664 2723565366
665 2724044174
666 2724088147
667 2724102631
668 2724108527
669 2730106147
670 2730163906
671 2730297919
672 2738743440
673 2739352347
674 2740033429
675 2758642680
676 2766064689
677 2793295334
678 2793334353
679 2793350420
680 2821130339
681 2821130352
682 2838020158
683 2838051625
684 2838064100
685 2838070985
686 2838670248
687 2838702619
688 2839998374
689 2840768608
690 2841764076
691 2842113716
692 2842148123
693 2842198578
694 2842253189
695 2842268887
696 2842312747
697 2842320597
698 2842424600
699 2842432913
700 2842439218
701 2842445847
702 2842451973
703 2842467033
704 2842473939
705 2842495667
706 2842496939
707 2842694788
708 2842695305
709 2842702846
710 2842703238
711 2842927356
712 2842927924
713 2844012098
714 2844108469
715 2851185472
716 2851250511
717 2852653721
718 2857522792
719 2874171032
720 2885391296
721 2893068231
722 2902409280
723 2903770686
724 2903775131
725 2919682342
726 2921208709
727 2933023102
728 2933589646
729 2933601784
730 2935677353
731 2935699131
732 2935776711
733 2935792599
734 2935800605
735 2935816357
736 2936042690
737 2937124606
738 2957419043
739 2960614657
740 2960639404
741 2964720420
742 8005289135
743 8005389381
744 8005396757
745 8005432805
746 8005498535
747 8005564815
748 8005619727
749 8005628299
750 8005669946
751 8019568869
752 8024487137
753 8024504245
754 8045869189
755 8054303647
756 8055536964
757 8055912065
758 8056377455

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

41

340

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9615 1 343
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9533 1 343
1luc-assembly1.cif.gz_A bacterial luciferase 0.889 1 339
1luc-assembly1.cif.gz_A bacterial luciferase 0.8762 1 339
6ket-assembly1.cif.gz_B flavin-utilizing monooxygenase (ox) domain of hybrid polyketide/non-ribosomal peptide synthetase 0.8677 1 338
ID Description Score Start End Superfamily
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9603 1 343 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9556 1 345 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9548 1 343 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9317 1 345 3.20.20.30
af_I6X7W8_4_352_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8339 1 340 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A421AYI2-F1-model_v4 Luciferase-like monooxygenase 0.9881 1 94 GO:0004497
GO:0005829
GO:0016705
AF-A0A0F2E5X6-F1-model_v4 deleted 0.9866 32 235
AF-A0A2W4U291-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9857 1 297 GO:0004497
GO:0005829
GO:0016705
AF-A0A535JPW7-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9835 1 280 GO:0004497
GO:0005829
GO:0016705
AF-A0A2W4U291-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9792 1 297 GO:0004497
GO:0005829
GO:0016705

Map