F428446

General Info

Members Datasets Scaffolds Average Seq Length
379 172 758 167

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0073773|Ga0495641_0073773_807_1403
Length 198
Sequence LVVSSPIGVGLSLRPTAGRELIARGLSLRLRAVSSDSVFDDVLAANGAYATTFTLAGLPARAARGLAVLTCMDSRIEPLRMLGLRPGDAKILRNAGARVTDDVLRTLVLASCLLGVERAMVIAHTRCRMAAADEQEVHAAVAEAGGPDTRSLSFLVTRDQEATLRADVQRVRSWPYLKGLSVGGFLYDVDTGRLGRIC

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
99 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
100 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
101 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
102 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
103 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.57
Metatranscriptomes 3.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.96
Rhizosphere 95.25
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0073773 3300046461 Bacteria 1531
2 Ga0070658_10001037 3300005327 Bacteria 23768
3 Ga0070658_10004562 3300005327 Bacteria 11258
4 Ga0070658_10056602 3300005327 Bacteria 3188
5 Ga0070658_10105644 3300005327 Bacteria 2329
6 Ga0070658_10148923 3300005327 Bacteria 1958
7 Ga0070658_10402105 3300005327 Unclassified 1176
8 Ga0070658_10468100 3300005327 Bacteria 1087
9 Ga0070658_10560612 3300005327 Bacteria 989
10 Ga0070690_100228803 3300005330 Bacteria 1306
11 Ga0070680_100021442 3300005336 Bacteria 5135
12 Ga0070680_100124485 3300005336 Bacteria 2153
13 Ga0070660_100027433 3300005339 Bacteria 4250
14 Ga0070660_100286471 3300005339 Bacteria 1348
15 Ga0070660_100604618 3300005339 Bacteria 917
16 Ga0070691_10154944 3300005341 Bacteria 1177
17 Ga0070692_10384716 3300005345 Bacteria 881
18 Ga0070675_100410972 3300005354 Bacteria 1209
19 Ga0070675_100845537 3300005354 Bacteria 837
20 Ga0070674_100035980 3300005356 Bacteria 3320
21 Ga0070674_100764920 3300005356 Bacteria 831
22 Ga0070659_100186171 3300005366 Bacteria 1705
23 Ga0070659_100328508 3300005366 Bacteria 1279
24 Ga0070709_10912134 3300005434 Unclassified 695
25 Ga0070714_100613553 3300005435 Bacteria 1045
26 Ga0070713_100085270 3300005436 Bacteria 2705
27 Ga0070711_100126492 3300005439 Bacteria 1898
28 Ga0070678_100119109 3300005456 Bacteria 2079
29 Ga0070681_10016742 3300005458 Bacteria 7318
30 Ga0070681_10051417 3300005458 Bacteria 4110
31 Ga0068867_100767439 3300005459 Bacteria 857
32 Ga0070706_100252001 3300005467 Bacteria 1648
33 Ga0070699_100146237 3300005518 Bacteria 2088
34 Ga0070679_100016686 3300005530 Bacteria 7092
35 Ga0070679_100100490 3300005530 Bacteria 2879
36 Ga0070679_100216687 3300005530 Bacteria 1877
37 Ga0070679_100638863 3300005530 Bacteria 1007
38 Ga0070679_100652726 3300005530 Bacteria 995
39 Ga0070679_100684728 3300005530 Bacteria 968
40 Ga0070679_100916238 3300005530 Bacteria 820
41 Ga0070684_100019530 3300005535 Bacteria 5607
42 Ga0070684_100117790 3300005535 Bacteria 2387
43 Ga0070684_100835075 3300005535 Bacteria 862
44 Ga0070684_100997122 3300005535 Bacteria 786
45 Ga0070684_101443449 3300005535 Bacteria 648
46 Ga0070686_100036540 3300005544 Bacteria 3042
47 Ga0070686_100418447 3300005544 Bacteria 1023
48 Ga0070665_101065796 3300005548 Bacteria 820
49 Ga0068855_100067344 3300005563 Bacteria 4172
50 Ga0068855_100204911 3300005563 Bacteria 2219
51 Ga0068855_100890752 3300005563 Bacteria 941
52 Ga0070664_100893145 3300005564 Bacteria 833
53 Ga0070702_100352302 3300005615 Bacteria 1037
54 Ga0068852_100029065 3300005616 Bacteria 4535
55 Ga0068852_100056286 3300005616 Bacteria 3398
56 Ga0068866_10215442 3300005718 Bacteria 1155
57 Ga0070717_10225461 3300006028 Bacteria 1648
58 Ga0070712_100473499 3300006175 Bacteria 1046
59 Ga0075436_100192576 3300006914 Bacteria 1443
60 Ga0105240_10098603 3300009093 Bacteria 3558
61 Ga0105240_10437349 3300009093 Bacteria 1466
62 Ga0105240_10597714 3300009093 Bacteria 1215
63 Ga0105245_11930648 3300009098 Bacteria 644
64 Ga0105243_10949309 3300009148 Bacteria 859
65 Ga0105243_11152727 3300009148 Unclassified 786
66 Ga0105242_10395021 3300009176 Bacteria 1289
67 Ga0105249_11799201 3300009553 Unclassified 685
68 Ga0157371_10008655 3300013102 Bacteria 8084
69 Ga0157371_10215630 3300013102 Bacteria 1378
70 Ga0157370_10041136 3300013104 Bacteria 4462
71 Ga0157370_10205317 3300013104 Bacteria 1827
72 Ga0157370_11300858 3300013104 Bacteria 655
73 Ga0157369_10000717 3300013105 Bacteria 42638
74 Ga0157369_10011447 3300013105 Bacteria 10074
75 Ga0157369_10028519 3300013105 Bacteria 6179
76 Ga0157369_10112372 3300013105 Bacteria 2894
77 Ga0157369_10227830 3300013105 Bacteria 1949
78 Ga0157369_10286545 3300013105 Bacteria 1715
79 Ga0157372_10289430 3300013307 Unclassified 1905
80 Ga0157372_10407507 3300013307 Bacteria 1584
81 Ga0157372_10489206 3300013307 Bacteria 1434
82 Ga0157372_11836555 3300013307 Bacteria 697
83 Ga0157375_10021476 3300013308 Bacteria 5920
84 Ga0157375_10330261 3300013308 Bacteria 1690
85 Ga0157375_10624102 3300013308 Bacteria 1236
86 Ga0163163_10008128 3300014325 Bacteria 9300
87 Ga0157380_10053531 3300014326 Bacteria 3200
88 Ga0157380_10331486 3300014326 Bacteria 1415
89 Ga0157377_10071928 3300014745 Bacteria 2001
90 Ga0157377_10187963 3300014745 Bacteria 1303
91 Ga0157377_10368316 3300014745 Bacteria 969
92 Ga0197907_10409761 3300020069 Bacteria 2585
93 Ga0197907_11420862 3300020069 Bacteria 946
94 Ga0206356_11196784 3300020070 Bacteria 853
95 Ga0206354_10004944 3300020081 Bacteria 872
96 Ga0206354_11190172 3300020081 Bacteria 1200
97 Ga0206354_11312182 3300020081 Bacteria 842
98 Ga0206354_11582449 3300020081 Bacteria 1218
99 Ga0206353_10850478 3300020082 Bacteria 6381
100 Ga0206353_11884118 3300020082 Bacteria 2336
101 Ga0154015_1657146 3300020610 Unclassified 867
102 Ga0213876_10007115 3300021384 Bacteria 6099
103 Ga0224712_10009490 3300022467 Bacteria 2935
104 Ga0224712_10043658 3300022467 Bacteria 1705
105 Ga0224712_10127104 3300022467 Bacteria 1110
106 Ga0207699_10170792 3300025906 Bacteria 1455
107 Ga0207705_10000862 3300025909 Bacteria 24872
108 Ga0207705_10047606 3300025909 Bacteria 3083
109 Ga0207705_10250399 3300025909 Bacteria 1351
110 Ga0207705_10346810 3300025909 Bacteria 1143
111 Ga0207705_10591048 3300025909 Bacteria 863
112 Ga0207707_10046148 3300025912 Bacteria 3794
113 Ga0207707_10155583 3300025912 Bacteria 1999
114 Ga0207707_10780994 3300025912 Unclassified 797
115 Ga0207695_10061379 3300025913 Bacteria 3885
116 Ga0207660_10014146 3300025917 Bacteria 5239
117 Ga0207660_10143104 3300025917 Bacteria 1830
118 Ga0207660_10200015 3300025917 Bacteria 1560
119 Ga0207660_10208157 3300025917 Bacteria 1530
120 Ga0207657_10057645 3300025919 Bacteria 3347
121 Ga0207657_10164228 3300025919 Bacteria 1802
122 Ga0207657_10248627 3300025919 Bacteria 1418
123 Ga0207652_10020098 3300025921 Bacteria 5499
124 Ga0207652_10031089 3300025921 Bacteria 4480
125 Ga0207652_10156172 3300025921 Bacteria 2044
126 Ga0207652_10172969 3300025921 Bacteria 1938
127 Ga0207652_10454434 3300025921 Bacteria 1154
128 Ga0207652_10814237 3300025921 Bacteria 829
129 Ga0207681_10846573 3300025923 Bacteria 765
130 Ga0207659_10013494 3300025926 Bacteria 5235
131 Ga0207659_11182016 3300025926 Bacteria 658
132 Ga0207687_10162797 3300025927 Bacteria 1714
133 Ga0207687_10382539 3300025927 Bacteria 1153
134 Ga0207700_10529565 3300025928 Bacteria 1044
135 Ga0207700_10692261 3300025928 Bacteria 910
136 Ga0207664_10109901 3300025929 Bacteria 2291
137 Ga0207664_10366981 3300025929 Bacteria 1276
138 Ga0207690_10004599 3300025932 Bacteria 8159
139 Ga0207690_10475696 3300025932 Bacteria 1008
140 Ga0207661_10046228 3300025944 Bacteria 3451
141 Ga0207661_10274664 3300025944 Bacteria 1505
142 Ga0207667_10285111 3300025949 Bacteria 1688
143 Ga0207667_11012876 3300025949 Bacteria 817
144 Ga0207667_11058222 3300025949 Bacteria 796
145 Ga0207683_10162171 3300026121 Bacteria 2022
146 Ga0207698_10055486 3300026142 Bacteria 3054
147 Ga0265322_10140481 3300028654 Bacteria 690
148 Ga0265338_10029736 3300028800 Bacteria 5407
149 Ga0265338_10032832 3300028800 Bacteria 5052
150 Ga0265325_10064018 3300031241 Bacteria 1859
151 Ga0265340_10011478 3300031247 Bacteria 4706
152 Ga0265339_10018069 3300031249 Bacteria 4164
153 Ga0265327_10026788 3300031251 Bacteria 3331
154 Ga0307408_100662505 3300031548 Bacteria 934
155 Ga0307408_101351365 3300031548 Bacteria 669
156 Ga0265313_10087235 3300031595 Bacteria 1407
157 Ga0265314_10161469 3300031711 Bacteria 1363
158 Ga0265342_10025761 3300031712 Bacteria 3692
159 Ga0307405_10428028 3300031731 Bacteria 1043
160 Ga0307413_10607051 3300031824 Bacteria 896
161 Ga0307406_10124855 3300031901 Bacteria 1796
162 Ga0307406_10293121 3300031901 Bacteria 1246
163 Ga0307407_10245841 3300031903 Bacteria 1223
164 Ga0307412_10589241 3300031911 Bacteria 940
165 Ga0307409_100016177 3300031995 Bacteria 4927
166 Ga0307409_100073531 3300031995 Bacteria 2727
167 Ga0307409_100204861 3300031995 Bacteria 1768
168 Ga0307409_101043173 3300031995 Bacteria 837
169 Ga0307416_100766790 3300032002 Bacteria 1058
170 Ga0307411_11116793 3300032005 Bacteria 711
171 Ga0307415_100009448 3300032126 Bacteria 5468
172 Ga0307415_100143106 3300032126 Bacteria 1829
173 Ga0316583_10133931 3300032133 Bacteria 863
174 Ga0373925_0349858 3300037068 Bacteria 1200
175 Ga0395899_0023359 3300037312 Bacteria 4684
176 Ga0395900_0079396 3300037418 Bacteria 3372
177 Ga0395900_0106166 3300037418 Bacteria 2885
178 Ga0395900_0111840 3300037418 Bacteria 2805
179 Ga0395898_0016683 3300037466 Bacteria 7507
180 Ga0395898_0281216 3300037466 Bacteria 1587
181 Ga0395898_0389334 3300037466 Bacteria 1329
182 Ga0395898_0776606 3300037466 Bacteria 899
183 Ga0395905_1412809 3300037471 Bacteria 600
184 Ga0395901_0200085 3300038443 Bacteria 2094
185 Ga0395901_0515167 3300038443 Bacteria 1216
186 Ga0436365_1887167 3300039437 Bacteria 40011
187 Ga0436360_0939371 3300039438 Bacteria 810
188 Ga0436362_0161168 3300039453 Bacteria 935
189 Ga0439438_081441 3300041405 Bacteria 794
190 Ga0439461_0067006 3300041410 Bacteria 825
191 Ga0439466_0038630 3300041411 Bacteria 1603
192 Ga0439451_002396 3300042009 Bacteria 3801
193 Ga0439454_006196 3300042011 Bacteria 1461
194 Ga0439446_0014521 3300042156 Bacteria 2175
195 Ga0439434_0021579 3300042435 Bacteria 1935
196 Ga0466966_0220311 3300044684 Bacteria 1146
197 Ga0466961_0205389 3300044693 Bacteria 1217
198 Ga0466961_0272369 3300044693 Bacteria 1037
199 Ga0466961_0442448 3300044693 Bacteria 787
200 Ga0466963_0102507 3300044694 Bacteria 1960
201 Ga0466963_0127203 3300044694 Bacteria 1757
202 Ga0466963_0131923 3300044694 Bacteria 1727
203 Ga0466963_0151466 3300044694 Bacteria 1611
204 Ga0466963_0334841 3300044694 Bacteria 1065
205 Ga0466957_0058248 3300044842 Bacteria 2366
206 Ga0466960_0432257 3300044901 Bacteria 763
207 Ga0466959_0147450 3300045049 Bacteria 1660
208 Ga0466958_0053468 3300045836 Bacteria 2448
209 Ga0466967_0013865 3300045976 Bacteria 6250
210 Ga0466967_0046467 3300045976 Bacteria 3780
211 Ga0466967_0058418 3300045976 Bacteria 3410
212 Ga0466967_0070755 3300045976 Bacteria 3121
213 Ga0466967_0801551 3300045976 Bacteria 935
214 Ga0466967_1008045 3300045976 Bacteria 829
215 Ga0466967_2146623 3300045976 Bacteria 555
216 Ga0495586_0047004 3300046535 Bacteria 2328
217 Ga0495586_0769830 3300046535 Bacteria 555
218 Ga0495667_0105150 3300046559 Bacteria 1825
219 Ga0495668_0615737 3300046616 Bacteria 600
220 Ga0495588_0507377 3300046674 Unclassified 632
221 Ga0495657_0518664 3300046675 Bacteria 694
222 Ga0495658_0511629 3300046683 Unclassified 768
223 Ga0495581_0084418 3300047315 Bacteria 1840
224 Ga0495674_0535636 3300047319 Bacteria 934
225 Ga0495676_0057155 3300047321 Bacteria 3080
226 Ga0495684_0654379 3300047471 Bacteria 702
227 Ga0496101_0426272 3300048904 Bacteria 1046
228 Ga0496102_0091293 3300048905 Bacteria 2819
229 Ga0496104_0083806 3300048907 Bacteria 3041
230 Ga0496105_0128424 3300048908 Bacteria 2090
231 Ga0496107_0103599 3300048910 Bacteria 2088
232 Ga0496108_0137000 3300048911 Bacteria 2107
233 Ga0496108_0415102 3300048911 Bacteria 1175
234 Ga0496109_0194578 3300048912 Bacteria 1906
235 Ga0496110_0052284 3300048913 Bacteria 3590
236 Ga0496111_0079683 3300048914 Bacteria 2389
237 Ga0496112_0043830 3300048915 Bacteria 4381
238 Ga0496112_0118541 3300048915 Bacteria 2617
239 Ga0496113_0040871 3300048916 Bacteria 3419
240 Ga0496114_0457060 3300048917 Bacteria 1130
241 Ga0496115_0660095 3300048918 Bacteria 826
242 Ga0496126_0040846 3300048929 Bacteria 4298
243 Ga0501031_0018332 3300049568 Bacteria 4556
244 Ga0501031_0027989 3300049568 Bacteria 3673
245 Ga0501031_0092985 3300049568 Bacteria 1968
246 Ga0501031_0192003 3300049568 Bacteria 1334
247 Ga0501032_0054714 3300049569 Bacteria 2686
248 Ga0501032_0068342 3300049569 Bacteria 2372
249 Ga0501033_0002944 3300049570 Bacteria 14232
250 Ga0501036_0008750 3300049572 Bacteria 8307
251 Ga0501036_0011884 3300049572 Bacteria 7218
252 Ga0501036_0046943 3300049572 Bacteria 3657
253 Ga0501037_0014396 3300049573 Bacteria 5823
254 Ga0501037_0037667 3300049573 Bacteria 3565
255 Ga0501038_0060467 3300049574 Bacteria 3242
256 Ga0501038_0174318 3300049574 Bacteria 1739
257 Ga0501039_0014334 3300049575 Bacteria 6069
258 Ga0501039_0017971 3300049575 Bacteria 5424
259 Ga0501039_0034233 3300049575 Bacteria 3920
260 Ga0501039_0063090 3300049575 Bacteria 2871
261 Ga0501040_0006375 3300049576 Bacteria 7657
262 Ga0501040_0026265 3300049576 Bacteria 3916
263 Ga0501040_0046094 3300049576 Bacteria 2975
264 Ga0501040_0063594 3300049576 Bacteria 2540
265 Ga0501040_0455841 3300049576 Bacteria 921
266 Ga0501041_0004774 3300049577 Bacteria 7867
267 Ga0501041_0012975 3300049577 Bacteria 4934
268 Ga0501041_0124003 3300049577 Bacteria 1607
269 Ga0501041_0175009 3300049577 Bacteria 1343
270 Ga0501041_0264469 3300049577 Bacteria 1082
271 Ga0501041_0614020 3300049577 Bacteria 694
272 Ga0501042_0012376 3300049578 Bacteria 5777
273 Ga0501042_0014089 3300049578 Bacteria 5452
274 Ga0501042_0020141 3300049578 Bacteria 4640
275 Ga0501042_0043697 3300049578 Bacteria 3191
276 Ga0501043_0005443 3300049579 Bacteria 10290
277 Ga0501043_0372228 3300049579 Bacteria 1083
278 Ga0501043_0373206 3300049579 Bacteria 1081
279 Ga0501046_0002087 3300049580 Bacteria 18946
280 Ga0501046_0022918 3300049580 Bacteria 5141
281 Ga0501046_0034349 3300049580 Bacteria 4093
282 Ga0501046_0246046 3300049580 Bacteria 1318
283 Ga0501046_0271133 3300049580 Bacteria 1245
284 Ga0501047_0129186 3300049581 Bacteria 2407
285 Ga0501047_0137974 3300049581 Bacteria 2318
286 Ga0501047_0163909 3300049581 Bacteria 2094
287 Ga0501047_0232245 3300049581 Bacteria 1698
288 Ga0501047_0366837 3300049581 Bacteria 1275
289 Ga0501048_0016704 3300049582 Bacteria 5410
290 Ga0501048_0077238 3300049582 Bacteria 2350
291 Ga0501048_0866187 3300049582 Bacteria 649
292 Ga0501048_0976825 3300049582 Bacteria 609
293 Ga0501068_0004098 3300049584 Bacteria 7905
294 Ga0501068_0310435 3300049584 Bacteria 1010
295 Ga0501068_0343921 3300049584 Bacteria 958
296 Ga0501069_0014983 3300049585 Bacteria 4153
297 Ga0501070_0012004 3300049586 Bacteria 7311
298 Ga0501070_0015261 3300049586 Bacteria 6464
299 Ga0501070_0048659 3300049586 Bacteria 3521
300 Ga0501070_0104416 3300049586 Bacteria 2343
301 Ga0501070_0291981 3300049586 Bacteria 1329
302 Ga0501070_0296569 3300049586 Bacteria 1317
303 Ga0501070_0462983 3300049586 Bacteria 1021
304 Ga0501070_0687954 3300049586 Bacteria 809
305 Ga0501070_0800751 3300049586 Bacteria 740
306 Ga0501070_1281781 3300049586 Bacteria 560
307 Ga0501071_0004555 3300049587 Bacteria 8797
308 Ga0501071_0006889 3300049587 Bacteria 7410
309 Ga0501071_0016103 3300049587 Bacteria 5139
310 Ga0501071_0069503 3300049587 Bacteria 2564
311 Ga0501071_0224026 3300049587 Bacteria 1416
312 Ga0501071_1008331 3300049587 Bacteria 643
313 Ga0501072_0002614 3300049588 Bacteria 13491
314 Ga0501072_0091344 3300049588 Bacteria 2417
315 Ga0501072_0142880 3300049588 Bacteria 1908
316 Ga0501072_0153212 3300049588 Bacteria 1838
317 Ga0501072_0286978 3300049588 Bacteria 1308
318 Ga0501073_0018627 3300049589 Bacteria 5018
319 Ga0501073_0358011 3300049589 Bacteria 1008
320 Ga0501073_0470905 3300049589 Bacteria 869
321 Ga0501074_0045163 3300049590 Bacteria 3187
322 Ga0501074_0075983 3300049590 Bacteria 2411
323 Ga0501074_0169097 3300049590 Bacteria 1561
324 Ga0501074_0231778 3300049590 Bacteria 1314
325 Ga0501075_0004057 3300049591 Bacteria 9885
326 Ga0501075_0007141 3300049591 Bacteria 7729
327 Ga0501075_0024945 3300049591 Bacteria 4390
328 Ga0501075_0049349 3300049591 Bacteria 3163
329 Ga0501075_1172643 3300049591 Bacteria 583
330 Ga0501076_0002063 3300049592 Bacteria 13763
331 Ga0501076_0117088 3300049592 Bacteria 2157
332 Ga0501076_0247415 3300049592 Bacteria 1459
333 Ga0501076_0296075 3300049592 Bacteria 1326
334 Ga0501076_0353661 3300049592 Bacteria 1206
335 Ga0501076_0814299 3300049592 Bacteria 770
336 Ga0501077_0021076 3300049593 Bacteria 4123
337 Ga0501077_0023596 3300049593 Bacteria 3900
338 Ga0501079_0009976 3300049741 Bacteria 7209
339 Ga0501079_0014772 3300049741 Bacteria 5954
340 Ga0501079_0245661 3300049741 Bacteria 1398
341 Ga0501079_0544311 3300049741 Bacteria 913
342 Ga0501080_0010075 3300049742 Bacteria 8640
343 Ga0501080_0018670 3300049742 Bacteria 6418
344 Ga0501080_0040115 3300049742 Bacteria 4368
345 Ga0501080_0126367 3300049742 Bacteria 2368
346 Ga0501080_0174582 3300049742 Bacteria 1981
347 Ga0501080_0219306 3300049742 Bacteria 1741
348 Ga0501080_0499963 3300049742 Bacteria 1087
349 Ga0501080_0514825 3300049742 Bacteria 1068
350 Ga0501081_0002353 3300049743 Bacteria 11906
351 Ga0501081_0206830 3300049743 Bacteria 1424
352 Ga0501081_0259763 3300049743 Bacteria 1269
353 Ga0501083_0030052 3300049744 Bacteria 3733
354 Ga0501083_0215907 3300049744 Bacteria 1250
355 Ga0501035_0008471 3300049822 Bacteria 9578
356 Ga0501035_0150092 3300049822 Bacteria 2023
357 Ga0501044_0232281 3300049823 Bacteria 1791
358 Ga0501044_0555229 3300049823 Bacteria 1045
359 Ga0501045_0003527 3300049824 Bacteria 10722
360 Ga0501045_0006666 3300049824 Bacteria 8004
361 Ga0501045_0027005 3300049824 Bacteria 4133
362 Ga0501045_0035865 3300049824 Bacteria 3601
363 Ga0501045_0355623 3300049824 Bacteria 1090
364 Ga0501084_0005096 3300054114 Bacteria 10753
365 Ga0501084_0011204 3300054114 Bacteria 7428
366 Ga0501084_0057493 3300054114 Bacteria 3254
367 Ga0501084_0502022 3300054114 Bacteria 1025
368 Ga0590075_049961 3300059424 Bacteria 1073
369 Ga0590077_014739 3300059426 Bacteria 1629
370 Ga0501082_0029891 3300060353 Bacteria 4693
371 Ga0501082_0037804 3300060353 Bacteria 4163
372 Ga0501082_0049785 3300060353 Bacteria 3613
373 Ga0501082_0070889 3300060353 Bacteria 3000
374 Ga0530510_0025251 3300061734 Bacteria 4247
375 Ga0530510_0042357 3300061734 Bacteria 3289
376 Ga0530510_0078571 3300061734 Bacteria 2399
377 Ga0530510_0089940 3300061734 Bacteria 2239
378 Ga0530510_0129536 3300061734 Unclassified 1855
379 Ga0530510_0307315 3300061734 Bacteria 1187
380 Ga0495641_0073773
381 Ga0070658_10001037
382 Ga0070658_10004562
383 Ga0070658_10056602
384 Ga0070658_10105644
385 Ga0070658_10148923
386 Ga0070658_10402105
387 Ga0070658_10468100
388 Ga0070658_10560612
389 Ga0070690_100228803
390 Ga0070680_100021442
391 Ga0070680_100124485
392 Ga0070660_100027433
393 Ga0070660_100286471
394 Ga0070660_100604618
395 Ga0070691_10154944
396 Ga0070692_10384716
397 Ga0070675_100410972
398 Ga0070675_100845537
399 Ga0070674_100035980
400 Ga0070674_100764920
401 Ga0070659_100186171
402 Ga0070659_100328508
403 Ga0070709_10912134
404 Ga0070714_100613553
405 Ga0070713_100085270
406 Ga0070711_100126492
407 Ga0070678_100119109
408 Ga0070681_10016742
409 Ga0070681_10051417
410 Ga0068867_100767439
411 Ga0070706_100252001
412 Ga0070699_100146237
413 Ga0070679_100016686
414 Ga0070679_100100490
415 Ga0070679_100216687
416 Ga0070679_100638863
417 Ga0070679_100652726
418 Ga0070679_100684728
419 Ga0070679_100916238
420 Ga0070684_100019530
421 Ga0070684_100117790
422 Ga0070684_100835075
423 Ga0070684_100997122
424 Ga0070684_101443449
425 Ga0070686_100036540
426 Ga0070686_100418447
427 Ga0070665_101065796
428 Ga0068855_100067344
429 Ga0068855_100204911
430 Ga0068855_100890752
431 Ga0070664_100893145
432 Ga0070702_100352302
433 Ga0068852_100029065
434 Ga0068852_100056286
435 Ga0068866_10215442
436 Ga0070717_10225461
437 Ga0070712_100473499
438 Ga0075436_100192576
439 Ga0105240_10098603
440 Ga0105240_10437349
441 Ga0105240_10597714
442 Ga0105245_11930648
443 Ga0105243_10949309
444 Ga0105243_11152727
445 Ga0105242_10395021
446 Ga0105249_11799201
447 Ga0157371_10008655
448 Ga0157371_10215630
449 Ga0157370_10041136
450 Ga0157370_10205317
451 Ga0157370_11300858
452 Ga0157369_10000717
453 Ga0157369_10011447
454 Ga0157369_10028519
455 Ga0157369_10112372
456 Ga0157369_10227830
457 Ga0157369_10286545
458 Ga0157372_10289430
459 Ga0157372_10407507
460 Ga0157372_10489206
461 Ga0157372_11836555
462 Ga0157375_10021476
463 Ga0157375_10330261
464 Ga0157375_10624102
465 Ga0163163_10008128
466 Ga0157380_10053531
467 Ga0157380_10331486
468 Ga0157377_10071928
469 Ga0157377_10187963
470 Ga0157377_10368316
471 Ga0197907_10409761
472 Ga0197907_11420862
473 Ga0206356_11196784
474 Ga0206354_10004944
475 Ga0206354_11190172
476 Ga0206354_11312182
477 Ga0206354_11582449
478 Ga0206353_10850478
479 Ga0206353_11884118
480 Ga0154015_1657146
481 Ga0213876_10007115
482 Ga0224712_10009490
483 Ga0224712_10043658
484 Ga0224712_10127104
485 Ga0207699_10170792
486 Ga0207705_10000862
487 Ga0207705_10047606
488 Ga0207705_10250399
489 Ga0207705_10346810
490 Ga0207705_10591048
491 Ga0207707_10046148
492 Ga0207707_10155583
493 Ga0207707_10780994
494 Ga0207695_10061379
495 Ga0207660_10014146
496 Ga0207660_10143104
497 Ga0207660_10200015
498 Ga0207660_10208157
499 Ga0207657_10057645
500 Ga0207657_10164228
501 Ga0207657_10248627
502 Ga0207652_10020098
503 Ga0207652_10031089
504 Ga0207652_10156172
505 Ga0207652_10172969
506 Ga0207652_10454434
507 Ga0207652_10814237
508 Ga0207681_10846573
509 Ga0207659_10013494
510 Ga0207659_11182016
511 Ga0207687_10162797
512 Ga0207687_10382539
513 Ga0207700_10529565
514 Ga0207700_10692261
515 Ga0207664_10109901
516 Ga0207664_10366981
517 Ga0207690_10004599
518 Ga0207690_10475696
519 Ga0207661_10046228
520 Ga0207661_10274664
521 Ga0207667_10285111
522 Ga0207667_11012876
523 Ga0207667_11058222
524 Ga0207683_10162171
525 Ga0207698_10055486
526 Ga0265322_10140481
527 Ga0265338_10029736
528 Ga0265338_10032832
529 Ga0265325_10064018
530 Ga0265340_10011478
531 Ga0265339_10018069
532 Ga0265327_10026788
533 Ga0307408_100662505
534 Ga0307408_101351365
535 Ga0265313_10087235
536 Ga0265314_10161469
537 Ga0265342_10025761
538 Ga0307405_10428028
539 Ga0307413_10607051
540 Ga0307406_10124855
541 Ga0307406_10293121
542 Ga0307407_10245841
543 Ga0307412_10589241
544 Ga0307409_100016177
545 Ga0307409_100073531
546 Ga0307409_100204861
547 Ga0307409_101043173
548 Ga0307416_100766790
549 Ga0307411_11116793
550 Ga0307415_100009448
551 Ga0307415_100143106
552 Ga0316583_10133931
553 Ga0373925_0349858
554 Ga0395899_0023359
555 Ga0395900_0079396
556 Ga0395900_0106166
557 Ga0395900_0111840
558 Ga0395898_0016683
559 Ga0395898_0281216
560 Ga0395898_0389334
561 Ga0395898_0776606
562 Ga0395905_1412809
563 Ga0395901_0200085
564 Ga0395901_0515167
565 Ga0436365_1887167
566 Ga0436360_0939371
567 Ga0436362_0161168
568 Ga0439438_081441
569 Ga0439461_0067006
570 Ga0439466_0038630
571 Ga0439451_002396
572 Ga0439454_006196
573 Ga0439446_0014521
574 Ga0439434_0021579
575 Ga0466966_0220311
576 Ga0466961_0205389
577 Ga0466961_0272369
578 Ga0466961_0442448
579 Ga0466963_0102507
580 Ga0466963_0127203
581 Ga0466963_0131923
582 Ga0466963_0151466
583 Ga0466963_0334841
584 Ga0466957_0058248
585 Ga0466960_0432257
586 Ga0466959_0147450
587 Ga0466958_0053468
588 Ga0466967_0013865
589 Ga0466967_0046467
590 Ga0466967_0058418
591 Ga0466967_0070755
592 Ga0466967_0801551
593 Ga0466967_1008045
594 Ga0466967_2146623
595 Ga0495586_0047004
596 Ga0495586_0769830
597 Ga0495667_0105150
598 Ga0495668_0615737
599 Ga0495588_0507377
600 Ga0495657_0518664
601 Ga0495658_0511629
602 Ga0495581_0084418
603 Ga0495674_0535636
604 Ga0495676_0057155
605 Ga0495684_0654379
606 Ga0496101_0426272
607 Ga0496102_0091293
608 Ga0496104_0083806
609 Ga0496105_0128424
610 Ga0496107_0103599
611 Ga0496108_0137000
612 Ga0496108_0415102
613 Ga0496109_0194578
614 Ga0496110_0052284
615 Ga0496111_0079683
616 Ga0496112_0043830
617 Ga0496112_0118541
618 Ga0496113_0040871
619 Ga0496114_0457060
620 Ga0496115_0660095
621 Ga0496126_0040846
622 Ga0501031_0018332
623 Ga0501031_0027989
624 Ga0501031_0092985
625 Ga0501031_0192003
626 Ga0501032_0054714
627 Ga0501032_0068342
628 Ga0501033_0002944
629 Ga0501036_0008750
630 Ga0501036_0011884
631 Ga0501036_0046943
632 Ga0501037_0014396
633 Ga0501037_0037667
634 Ga0501038_0060467
635 Ga0501038_0174318
636 Ga0501039_0014334
637 Ga0501039_0017971
638 Ga0501039_0034233
639 Ga0501039_0063090
640 Ga0501040_0006375
641 Ga0501040_0026265
642 Ga0501040_0046094
643 Ga0501040_0063594
644 Ga0501040_0455841
645 Ga0501041_0004774
646 Ga0501041_0012975
647 Ga0501041_0124003
648 Ga0501041_0175009
649 Ga0501041_0264469
650 Ga0501041_0614020
651 Ga0501042_0012376
652 Ga0501042_0014089
653 Ga0501042_0020141
654 Ga0501042_0043697
655 Ga0501043_0005443
656 Ga0501043_0372228
657 Ga0501043_0373206
658 Ga0501046_0002087
659 Ga0501046_0022918
660 Ga0501046_0034349
661 Ga0501046_0246046
662 Ga0501046_0271133
663 Ga0501047_0129186
664 Ga0501047_0137974
665 Ga0501047_0163909
666 Ga0501047_0232245
667 Ga0501047_0366837
668 Ga0501048_0016704
669 Ga0501048_0077238
670 Ga0501048_0866187
671 Ga0501048_0976825
672 Ga0501068_0004098
673 Ga0501068_0310435
674 Ga0501068_0343921
675 Ga0501069_0014983
676 Ga0501070_0012004
677 Ga0501070_0015261
678 Ga0501070_0048659
679 Ga0501070_0104416
680 Ga0501070_0291981
681 Ga0501070_0296569
682 Ga0501070_0462983
683 Ga0501070_0687954
684 Ga0501070_0800751
685 Ga0501070_1281781
686 Ga0501071_0004555
687 Ga0501071_0006889
688 Ga0501071_0016103
689 Ga0501071_0069503
690 Ga0501071_0224026
691 Ga0501071_1008331
692 Ga0501072_0002614
693 Ga0501072_0091344
694 Ga0501072_0142880
695 Ga0501072_0153212
696 Ga0501072_0286978
697 Ga0501073_0018627
698 Ga0501073_0358011
699 Ga0501073_0470905
700 Ga0501074_0045163
701 Ga0501074_0075983
702 Ga0501074_0169097
703 Ga0501074_0231778
704 Ga0501075_0004057
705 Ga0501075_0007141
706 Ga0501075_0024945
707 Ga0501075_0049349
708 Ga0501075_1172643
709 Ga0501076_0002063
710 Ga0501076_0117088
711 Ga0501076_0247415
712 Ga0501076_0296075
713 Ga0501076_0353661
714 Ga0501076_0814299
715 Ga0501077_0021076
716 Ga0501077_0023596
717 Ga0501079_0009976
718 Ga0501079_0014772
719 Ga0501079_0245661
720 Ga0501079_0544311
721 Ga0501080_0010075
722 Ga0501080_0018670
723 Ga0501080_0040115
724 Ga0501080_0126367
725 Ga0501080_0174582
726 Ga0501080_0219306
727 Ga0501080_0499963
728 Ga0501080_0514825
729 Ga0501081_0002353
730 Ga0501081_0206830
731 Ga0501081_0259763
732 Ga0501083_0030052
733 Ga0501083_0215907
734 Ga0501035_0008471
735 Ga0501035_0150092
736 Ga0501044_0232281
737 Ga0501044_0555229
738 Ga0501045_0003527
739 Ga0501045_0006666
740 Ga0501045_0027005
741 Ga0501045_0035865
742 Ga0501045_0355623
743 Ga0501084_0005096
744 Ga0501084_0011204
745 Ga0501084_0057493
746 Ga0501084_0502022
747 Ga0590075_049961
748 Ga0590077_014739
749 Ga0501082_0029891
750 Ga0501082_0037804
751 Ga0501082_0049785
752 Ga0501082_0070889
753 Ga0530510_0025251
754 Ga0530510_0042357
755 Ga0530510_0078571
756 Ga0530510_0089940
757 Ga0530510_0129536
758 Ga0530510_0307315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

66

146

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.8854 9 165
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.8626 4 165
1g5c-assembly2.cif.gz_D crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum 0.8502 34 167
4yf5-assembly1.cif.gz_A crystal structure of rv1284 in the presence of polycarpine at acidic ph 0.8407 7 167
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.8357 9 165
ID Description Score Start End Superfamily
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8586 7 167 3.40.1050.10
1g5cD00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8502 34 167 3.40.1050.10
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8443 7 167 3.40.1050.10
1ylkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8416 7 167 3.40.1050.10
1ylkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8223 7 167 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A838FYY8-F1-model_v4 Carbonic anhydrase 0.9878 57 167 GO:0004089
GO:0008270
AF-A0A0R2QLL4-F1-model_v4 Carbonic anhydrase 0.9757 37 165 GO:0004089
GO:0008270
AF-A0A838FYY8-F1-model_v4 Carbonic anhydrase 0.9705 57 167 GO:0004089
GO:0008270
AF-A0A6N9YRW9-F1-model_v4 Carbonic anhydrase 0.9657 25 167 GO:0004089
GO:0008270
AF-A0A6N9YRW9-F1-model_v4 Carbonic anhydrase 0.9528 25 167 GO:0004089
GO:0008270

Map