F428408

General Info

Members Datasets Scaffolds Average Seq Length
379 217 379 284

Family's Representative Sequence

Representative Sequence 3300035111|Ga0373923_0102041|Ga0373923_0102041_205_1065
Length 286
Sequence MPLSSVSRRTFLTYSAILPWALKAHAASSIPVGLELYSVRDELNKDPQGTVRAVAKMGYQGVEFYAPYFEWTESQTKGMKKLLDDMGIRCFSTHNDSAYFSKENLAKARDYNLILGSKYVVMASAQPKPGIDGWKEVTDALNSAAEQLAPAGLKLGYHNHQLEFTPSADLPMKARPIEFIAKNTKPTVMLQLDVGTCIEAGSDPTAWIRANPGRIRSLHCKDWSPDASKGYKVLFGEGVADWESIFAAAESVGGVEYYLVEQEGSRFSELETAQKCLAEFRAKHLA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.17
Rhizosphere 96.31
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10258102 3300005293 Unclassified 1146
2 Ga0065707_10016457 3300005295 Unclassified 1638
3 Ga0070658_10177223 3300005327 Unclassified 1793
4 Ga0070676_10018432 3300005328 Unclassified 3869
5 Ga0070683_100001100 3300005329 Bacteria 20362
6 Ga0070683_100245255 3300005329 Bacteria 1704
7 Ga0070690_100240434 3300005330 Bacteria 1276
8 Ga0068869_100050859 3300005334 Bacteria 3005
9 Ga0070666_10024852 3300005335 Unclassified 3904
10 Ga0070666_10256735 3300005335 Bacteria 1238
11 Ga0070682_100045098 3300005337 Bacteria 2731
12 Ga0068868_100001598 3300005338 Bacteria 15453
13 Ga0070660_100083188 3300005339 Unclassified 2514
14 Ga0070660_100116091 3300005339 Bacteria 2134
15 Ga0070687_100180469 3300005343 Bacteria 1264
16 Ga0070661_100236348 3300005344 Unclassified 1406
17 Ga0070661_100457380 3300005344 Bacteria 1016
18 Ga0070661_100500851 3300005344 Unclassified 972
19 Ga0070668_100014267 3300005347 Bacteria 5937
20 Ga0070669_100319713 3300005353 Unclassified 1253
21 Ga0070669_100398853 3300005353 Bacteria 1125
22 Ga0070675_100320415 3300005354 Bacteria 1369
23 Ga0070671_100570491 3300005355 Bacteria 977
24 Ga0070659_100030418 3300005366 Bacteria 4179
25 Ga0070659_100475815 3300005366 Unclassified 1062
26 Ga0070667_100127759 3300005367 Bacteria 2217
27 Ga0070709_10034560 3300005434 Bacteria 3066
28 Ga0070709_10046407 3300005434 Unclassified 2701
29 Ga0070714_100016874 3300005435 Bacteria 5906
30 Ga0070714_100021945 3300005435 Bacteria 5229
31 Ga0070713_100003252 3300005436 Bacteria 10717
32 Ga0070713_100195031 3300005436 Bacteria 1826
33 Ga0070713_100207543 3300005436 Bacteria 1772
34 Ga0070710_10027742 3300005437 Unclassified 3023
35 Ga0070701_10215101 3300005438 Bacteria 1143
36 Ga0070711_100000184 3300005439 Bacteria 33160
37 Ga0070711_100001678 3300005439 Bacteria 12267
38 Ga0070711_100031845 3300005439 Unclassified 3504
39 Ga0070705_100071202 3300005440 Bacteria 2102
40 Ga0070705_100095722 3300005440 Bacteria 1862
41 Ga0070694_100006224 3300005444 Unclassified 7245
42 Ga0070694_100108681 3300005444 Unclassified 1973
43 Ga0070694_100172362 3300005444 Bacteria 1595
44 Ga0070708_100000679 3300005445 Bacteria 25845
45 Ga0070708_100008937 3300005445 Bacteria 8069
46 Ga0070708_100042355 3300005445 Unclassified 3996
47 Ga0070708_100095102 3300005445 Bacteria 2719
48 Ga0070708_100461147 3300005445 Archaea 1199
49 Ga0070663_100181222 3300005455 Bacteria 1634
50 Ga0070663_100260481 3300005455 Bacteria 1375
51 Ga0070662_100001344 3300005457 Bacteria 15105
52 Ga0070681_10224687 3300005458 Bacteria 1792
53 Ga0068867_100647805 3300005459 Bacteria 926
54 Ga0070685_10221824 3300005466 Bacteria 1239
55 Ga0070706_100000454 3300005467 Bacteria 48917
56 Ga0070706_100009824 3300005467 Bacteria 8892
57 Ga0070706_100075036 3300005467 Unclassified 3130
58 Ga0070706_100113163 3300005467 Unclassified 2527
59 Ga0070706_100261500 3300005467 Bacteria 1615
60 Ga0070706_100316255 3300005467 Unclassified 1456
61 Ga0070707_100000497 3300005468 Bacteria 39055
62 Ga0070707_100035343 3300005468 Bacteria 4766
63 Ga0070707_100294649 3300005468 Bacteria 1576
64 Ga0070698_100001288 3300005471 Bacteria 27970
65 Ga0070698_100009995 3300005471 Bacteria 10142
66 Ga0070698_100049551 3300005471 Bacteria 4286
67 Ga0070698_100095288 3300005471 Unclassified 2954
68 Ga0070698_100500310 3300005471 Bacteria 1153
69 Ga0070699_100014814 3300005518 Bacteria 6705
70 Ga0070699_100016649 3300005518 Bacteria 6310
71 Ga0070699_100076127 3300005518 Unclassified 2921
72 Ga0070699_100106621 3300005518 Bacteria 2458
73 Ga0070699_100362549 3300005518 Unclassified 1307
74 Ga0070679_100041588 3300005530 Bacteria 4574
75 Ga0070684_100001196 3300005535 Bacteria 18641
76 Ga0070684_100058925 3300005535 Unclassified 3357
77 Ga0070684_100172358 3300005535 Bacteria 1965
78 Ga0070697_100000411 3300005536 Bacteria 32999
79 Ga0070697_100000671 3300005536 Bacteria 25737
80 Ga0070697_100000784 3300005536 Bacteria 23880
81 Ga0070697_100002338 3300005536 Bacteria 14586
82 Ga0070697_100005876 3300005536 Bacteria 9470
83 Ga0070697_100008836 3300005536 Bacteria 7861
84 Ga0070697_100092533 3300005536 Bacteria 2502
85 Ga0070697_100136030 3300005536 Bacteria 2064
86 Ga0070697_100234060 3300005536 Unclassified 1567
87 Ga0068853_100214483 3300005539 Bacteria 1756
88 Ga0070672_100173396 3300005543 Bacteria 1795
89 Ga0070695_100001473 3300005545 Bacteria 13055
90 Ga0070695_100014719 3300005545 Bacteria 4718
91 Ga0070695_100111676 3300005545 Bacteria 1856
92 Ga0070696_100001746 3300005546 Bacteria 14258
93 Ga0070693_100000070 3300005547 Bacteria 42181
94 Ga0070693_100089443 3300005547 Bacteria 1853
95 Ga0070693_100177377 3300005547 Bacteria 1369
96 Ga0070665_100247096 3300005548 Bacteria 1785
97 Ga0070704_100008207 3300005549 Unclassified 6248
98 Ga0070704_100191911 3300005549 Bacteria 1643
99 Ga0070704_100297080 3300005549 Bacteria 1344
100 Ga0068855_100139379 3300005563 Unclassified 2766
101 Ga0070664_100016650 3300005564 Bacteria 6029
102 Ga0068854_100028024 3300005578 Unclassified 3887
103 Ga0068856_100006168 3300005614 Bacteria 11761
104 Ga0070702_100226215 3300005615 Bacteria 1254
105 Ga0068852_100047059 3300005616 Bacteria 3678
106 Ga0068859_100041061 3300005617 Bacteria 4647
107 Ga0068859_100218518 3300005617 Bacteria 1993
108 Ga0068859_100305528 3300005617 Bacteria 1684
109 Ga0068864_100061929 3300005618 Unclassified 3241
110 Ga0068866_10135206 3300005718 Bacteria 1408
111 Ga0068861_100185437 3300005719 Bacteria 1735
112 Ga0068851_10185145 3300005834 Bacteria 1155
113 Ga0068863_100023382 3300005841 Bacteria 5904
114 Ga0068863_100056015 3300005841 Bacteria 3733
115 Ga0068863_100087432 3300005841 Unclassified 2953
116 Ga0068858_100015430 3300005842 Bacteria 7185
117 Ga0068858_100101662 3300005842 Bacteria 2681
118 Ga0068858_100185063 3300005842 Bacteria 1967
119 Ga0068860_100109083 3300005843 Bacteria 2645
120 Ga0068860_100158768 3300005843 Unclassified 2180
121 Ga0081540_1030546 3300005983 Bacteria 2981
122 Ga0081539_10010939 3300005985 Bacteria 7276
123 Ga0070717_10000442 3300006028 Bacteria 26293
124 Ga0070717_10003878 3300006028 Bacteria 10751
125 Ga0070717_10006061 3300006028 Bacteria 8865
126 Ga0070717_10169378 3300006028 Bacteria 1899
127 Ga0070717_10189854 3300006028 Unclassified 1795
128 Ga0070716_100001085 3300006173 Bacteria 11935
129 Ga0070716_100020370 3300006173 Unclassified 3481
130 Ga0070712_100001711 3300006175 Bacteria 13417
131 Ga0070712_100002289 3300006175 Bacteria 11794
132 Ga0070712_100002489 3300006175 Bacteria 11360
133 Ga0070712_100216443 3300006175 Bacteria 1514
134 Ga0097621_100014797 3300006237 Bacteria 5850
135 Ga0068871_100224460 3300006358 Bacteria 1629
136 Ga0075428_100002535 3300006844 Bacteria 19851
137 Ga0075431_100003497 3300006847 Bacteria 15231
138 Ga0075431_100556635 3300006847 Unclassified 1134
139 Ga0075433_10244465 3300006852 Bacteria 1593
140 Ga0075434_100013250 3300006871 Bacteria 7836
141 Ga0075429_100087842 3300006880 Bacteria 2710
142 Ga0068865_100246686 3300006881 Bacteria 1407
143 Ga0075436_100004693 3300006914 Bacteria 9374
144 Ga0075436_100106836 3300006914 Bacteria 1952
145 Ga0097620_100041063 3300006931 Bacteria 4647
146 Ga0097620_100218518 3300006931 Bacteria 1993
147 Ga0097620_100305532 3300006931 Bacteria 1684
148 Ga0075435_100040955 3300007076 Bacteria 3701
149 Ga0075435_100066051 3300007076 Unclassified 2942
150 Ga0099794_10006675 3300007265 Bacteria 4688
151 Ga0099794_10040747 3300007265 Bacteria 2210
152 Ga0099794_10050103 3300007265 Unclassified 2008
153 Ga0099794_10067791 3300007265 Bacteria 1744
154 Ga0105250_10113236 3300009092 Bacteria 1112
155 Ga0105240_10060872 3300009093 Bacteria 4706
156 Ga0105240_10111490 3300009093 Unclassified 3309
157 Ga0111539_10033595 3300009094 Bacteria 6228
158 Ga0114129_10176736 3300009147 Unclassified 2908
159 Ga0105243_10036452 3300009148 Bacteria 3818
160 Ga0105243_10191596 3300009148 Bacteria 1786
161 Ga0105241_10028102 3300009174 Unclassified 4189
162 Ga0105241_10092134 3300009174 Bacteria 2393
163 Ga0105242_10024658 3300009176 Bacteria 4752
164 Ga0105242_10220452 3300009176 Bacteria 1695
165 Ga0105248_10237816 3300009177 Bacteria 2050
166 Ga0105248_10333640 3300009177 Bacteria 1708
167 Ga0105248_10421637 3300009177 Bacteria 1503
168 Ga0105237_10448327 3300009545 Unclassified 1296
169 Ga0105238_10036276 3300009551 Bacteria 5010
170 Ga0105238_10182237 3300009551 Bacteria 2077
171 Ga0105238_10336955 3300009551 Bacteria 1496
172 Ga0105249_10004935 3300009553 Bacteria 11515
173 Ga0099796_10075291 3300010159 Unclassified 1227
174 Ga0105239_10414123 3300010375 Unclassified 1526
175 Ga0157373_10088201 3300013100 Bacteria 2186
176 Ga0157371_10010312 3300013102 Bacteria 7291
177 Ga0157370_10348053 3300013104 Bacteria 1366
178 Ga0157369_10068738 3300013105 Bacteria 3806
179 Ga0157369_10168137 3300013105 Bacteria 2311
180 Ga0157369_10337700 3300013105 Bacteria 1565
181 Ga0157374_10004000 3300013296 Bacteria 12387
182 Ga0157374_10019204 3300013296 Bacteria 6047
183 Ga0157374_10034799 3300013296 Bacteria 4604
184 Ga0157374_10388498 3300013296 Unclassified 1391
185 Ga0157378_10169641 3300013297 Bacteria 2046
186 Ga0163162_10353488 3300013306 Bacteria 1602
187 Ga0157372_10002713 3300013307 Bacteria 19156
188 Ga0157372_10005161 3300013307 Bacteria 13884
189 Ga0157372_10019884 3300013307 Bacteria 7237
190 Ga0157372_10141154 3300013307 Bacteria 2775
191 Ga0157372_10172042 3300013307 Bacteria 2506
192 Ga0157372_10826071 3300013307 Bacteria 1076
193 Ga0157375_10170744 3300013308 Unclassified 2322
194 Ga0163163_10073991 3300014325 Bacteria 3398
195 Ga0163163_10465755 3300014325 Bacteria 1324
196 Ga0157379_10324921 3300014968 Bacteria 1405
197 Ga0182006_1032480 3300015261 Bacteria 2098
198 Ga0182007_10018837 3300015262 Bacteria 2494
199 Ga0182005_1059631 3300015265 Bacteria 1042
200 Ga0224572_1006954 3300024225 Bacteria 2060
201 Ga0207656_10056209 3300025321 Bacteria 1715
202 Ga0207680_10098015 3300025903 Bacteria 1878
203 Ga0207647_10013010 3300025904 Bacteria 5781
204 Ga0207647_10068910 3300025904 Unclassified 2139
205 Ga0207699_10069738 3300025906 Unclassified 2145
206 Ga0207699_10104835 3300025906 Bacteria 1801
207 Ga0207699_10275090 3300025906 Unclassified 1168
208 Ga0207699_10291443 3300025906 Unclassified 1137
209 Ga0207684_10003864 3300025910 Bacteria 14392
210 Ga0207684_10009913 3300025910 Bacteria 8400
211 Ga0207684_10012365 3300025910 Bacteria 7428
212 Ga0207684_10059124 3300025910 Bacteria 3254
213 Ga0207684_10084121 3300025910 Bacteria 2709
214 Ga0207684_10086143 3300025910 Unclassified 2676
215 Ga0207654_10004925 3300025911 Bacteria 6761
216 Ga0207707_10218630 3300025912 Unclassified 1658
217 Ga0207695_10007887 3300025913 Bacteria 13438
218 Ga0207695_10008581 3300025913 Bacteria 12771
219 Ga0207671_10195380 3300025914 Bacteria 1579
220 Ga0207693_10000084 3300025915 Bacteria 84105
221 Ga0207693_10000386 3300025915 Bacteria 40440
222 Ga0207693_10029438 3300025915 Bacteria 4337
223 Ga0207693_10113611 3300025915 Bacteria 2124
224 Ga0207663_10005053 3300025916 Bacteria 6625
225 Ga0207663_10006167 3300025916 Bacteria 6108
226 Ga0207663_10025514 3300025916 Bacteria 3418
227 Ga0207657_10000770 3300025919 Bacteria 33991
228 Ga0207649_10057566 3300025920 Unclassified 2431
229 Ga0207652_10024653 3300025921 Bacteria 4992
230 Ga0207652_10030236 3300025921 Bacteria 4534
231 Ga0207652_10197583 3300025921 Bacteria 1810
232 Ga0207646_10003435 3300025922 Bacteria 17891
233 Ga0207646_10011035 3300025922 Bacteria 8773
234 Ga0207646_10015638 3300025922 Bacteria 7156
235 Ga0207646_10270316 3300025922 Bacteria 1536
236 Ga0207681_10300750 3300025923 Bacteria 1269
237 Ga0207650_10052967 3300025925 Unclassified 3007
238 Ga0207687_10002428 3300025927 Bacteria 12650
239 Ga0207700_10000207 3300025928 Bacteria 35195
240 Ga0207700_10146976 3300025928 Bacteria 1944
241 Ga0207700_10303624 3300025928 Unclassified 1379
242 Ga0207664_10032750 3300025929 Bacteria 3987
243 Ga0207664_10118116 3300025929 Bacteria 2215
244 Ga0207690_10147690 3300025932 Unclassified 1740
245 Ga0207706_10000687 3300025933 Bacteria 35398
246 Ga0207709_10039842 3300025935 Bacteria 2809
247 Ga0207670_10321532 3300025936 Bacteria 1217
248 Ga0207704_10405356 3300025938 Bacteria 1077
249 Ga0207665_10000136 3300025939 Bacteria 48958
250 Ga0207665_10050784 3300025939 Unclassified 2790
251 Ga0207665_10071045 3300025939 Unclassified 2376
252 Ga0207665_10090652 3300025939 Bacteria 2119
253 Ga0207665_10154867 3300025939 Bacteria 1644
254 Ga0207665_10250025 3300025939 Bacteria 1310
255 Ga0207691_10177517 3300025940 Bacteria 1862
256 Ga0207711_10007257 3300025941 Bacteria 9286
257 Ga0207711_10223390 3300025941 Bacteria 1723
258 Ga0207689_10000901 3300025942 Bacteria 28528
259 Ga0207661_10001001 3300025944 Bacteria 18654
260 Ga0207661_10681313 3300025944 Bacteria 945
261 Ga0207679_10321918 3300025945 Bacteria 1339
262 Ga0207667_10004797 3300025949 Bacteria 16535
263 Ga0207667_10599382 3300025949 Bacteria 1111
264 Ga0207712_10022215 3300025961 Bacteria 4175
265 Ga0207668_10042604 3300025972 Bacteria 3075
266 Ga0207640_10044971 3300025981 Bacteria 2833
267 Ga0207658_10185185 3300025986 Bacteria 1726
268 Ga0207703_10007660 3300026035 Bacteria 8555
269 Ga0207703_10057625 3300026035 Bacteria 3169
270 Ga0207639_10422591 3300026041 Bacteria 1205
271 Ga0207678_10001244 3300026067 Bacteria 23504
272 Ga0207702_10012479 3300026078 Bacteria 7070
273 Ga0207641_10004872 3300026088 Bacteria 11549
274 Ga0207641_10065483 3300026088 Bacteria 3109
275 Ga0207641_10073631 3300026088 Unclassified 2944
276 Ga0207648_10006876 3300026089 Bacteria 11280
277 Ga0207648_10016621 3300026089 Bacteria 6716
278 Ga0207676_10472614 3300026095 Bacteria 1186
279 Ga0207674_10008896 3300026116 Bacteria 11546
280 Ga0207674_10049804 3300026116 Bacteria 4282
281 Ga0207675_100560763 3300026118 Bacteria 1142
282 Ga0207698_10393534 3300026142 Bacteria 1322
283 Ga0209588_1002852 3300027671 Bacteria 4740
284 Ga0209588_1003168 3300027671 Bacteria 4537
285 Ga0209588_1039267 3300027671 Bacteria 1526
286 Ga0265354_1002258 3300028016 Bacteria 2436
287 Ga0265354_1002285 3300028016 Bacteria 2417
288 Ga0268266_10059538 3300028379 Unclassified 3291
289 Ga0268265_10133918 3300028380 Bacteria 2064
290 Ga0268264_10180591 3300028381 Bacteria 1916
291 Ga0268264_10192567 3300028381 Bacteria 1860
292 Ga0268264_10335056 3300028381 Bacteria 1435
293 Ga0265760_10000150 3300031090 Bacteria 17997
294 Ga0265760_10008935 3300031090 Unclassified 2862
295 Ga0265760_10015907 3300031090 Unclassified 2158
296 Ga0265325_10005033 3300031241 Bacteria 8225
297 Ga0265325_10132094 3300031241 Bacteria 1194
298 Ga0265339_10083817 3300031249 Bacteria 1681
299 Ga0265316_10000888 3300031344 Bacteria 32784
300 Ga0265316_10126132 3300031344 Bacteria 1930
301 Ga0265316_10154855 3300031344 Unclassified 1715
302 Ga0316212_1005887 3300033547 Unclassified 1779
303 Ga0373923_0071912 3300035111 Unclassified 1487
304 Ga0373923_0102041 3300035111 Bacteria 1266
305 Ga0373936_0004496 3300035113 Bacteria 5276
306 Ga0373954_0010981 3300035118 Bacteria 4006
307 Ga0373954_0028488 3300035118 Unclassified 2568
308 Ga0373943_0048102 3300035170 Bacteria 2088
309 Ga0373943_0182571 3300035170 Bacteria 1154
310 Ga0373955_0003600 3300035172 Bacteria 6817
311 Ga0373955_0102734 3300035172 Unclassified 1643
312 Ga0373961_0032079 3300035241 Unclassified 1471
313 Ga0373935_0051130 3300035692 Bacteria 2624
314 Ga0373935_0057438 3300035692 Unclassified 2482
315 Ga0373935_0157858 3300035692 Bacteria 1544
316 Ga0373933_0001405 3300035724 Bacteria 14141
317 Ga0373947_0067064 3300035725 Unclassified 2191
318 Ga0373937_0000250 3300036401 Bacteria 52583
319 Ga0373937_0012670 3300036401 Bacteria 7421
320 Ga0373937_0072842 3300036401 Bacteria 3169
321 Ga0373937_0305405 3300036401 Unclassified 1504
322 Ga0373937_0598456 3300036401 Bacteria 1047
323 Ga0373925_0039186 3300037068 Bacteria 3505
324 Ga0436365_0590769 3300039437 Bacteria 1315
325 Ga0453683_0045687 3300044673 Bacteria 2746
326 Ga0466963_0047166 3300044694 Bacteria 2843
327 Ga0451576_0347541 3300045051 Bacteria 1553
328 Ga0466967_0026613 3300045976 Bacteria 4793
329 Ga0466967_0157527 3300045976 Bacteria 2129
330 Ga0495629_0017843 3300046459 Bacteria 5087
331 Ga0495651_0009448 3300046462 Bacteria 7490
332 Ga0495653_0090055 3300046463 Bacteria 2246
333 Ga0495580_0001042 3300046472 Bacteria 24345
334 Ga0495580_0009414 3300046472 Bacteria 7684
335 Ga0495582_0000860 3300046473 Bacteria 16879
336 Ga0495639_0045685 3300046475 Unclassified 1982
337 Ga0495666_0023672 3300046526 Bacteria 3037
338 Ga0495665_0109953 3300046531 Bacteria 1446
339 Ga0495640_0119567 3300046533 Unclassified 1714
340 Ga0495587_0003432 3300046536 Bacteria 10571
341 Ga0495587_0011610 3300046536 Bacteria 5578
342 Ga0495645_0057282 3300046543 Unclassified 2829
343 Ga0495667_0016069 3300046559 Bacteria 5059
344 Ga0495657_0138271 3300046675 Bacteria 1520
345 Ga0495599_0174716 3300046678 Unclassified 1325
346 Ga0495623_0099894 3300046679 Bacteria 1769
347 Ga0495658_0254253 3300046683 Bacteria 1105
348 Ga0495604_0000529 3300047317 Bacteria 33758
349 Ga0495674_0070404 3300047319 Bacteria 3023
350 Ga0495675_0055874 3300047444 Bacteria 2504
351 Ga0495684_0002283 3300047471 Bacteria 15344
352 Ga0495602_0012902 3300048088 Bacteria 8563
353 Ga0496100_0076924 3300048903 Unclassified 2242
354 Ga0496104_0117730 3300048907 Unclassified 2550
355 Ga0496106_0028712 3300048909 Bacteria 4144
356 Ga0496107_0047567 3300048910 Bacteria 3089
357 Ga0496109_0194163 3300048912 Bacteria 1908
358 Ga0496109_0205686 3300048912 Bacteria 1851
359 Ga0496109_0779541 3300048912 Unclassified 894
360 Ga0496112_0037273 3300048915 Bacteria 4746
361 Ga0496113_0352103 3300048916 Bacteria 1181
362 Ga0496114_0040152 3300048917 Bacteria 3873
363 Ga0496115_0031118 3300048918 Bacteria 4202
364 Ga0496115_0104417 3300048918 Bacteria 2325
365 nmdc:mga05p37_519484_c1 3300050507 Unclassified 1362
366 nmdc:mga05p37_948258_c1 3300050507 Unclassified 921
367 nmdc:mga09592_76845_c1 3300050508 Bacteria 2840
368 nmdc:mga06r32_151210_c1 3300050510 Bacteria 2300
369 nmdc:mga08y16_6090_c1 3300050511 Bacteria 12650
370 nmdc:mga0n895_103039_c1 3300050512 Unclassified 2865
371 nmdc:mga0n895_293116_c1 3300050512 Bacteria 1649
372 nmdc:mga0rr50_284748_c1 3300050513 Unclassified 1380
373 nmdc:mga0rr50_71277_c1 3300050513 Bacteria 2651
374 nmdc:mga08x19_190679_c1 3300050514 Unclassified 1402
375 nmdc:mga08x19_251731_c1 3300050514 Unclassified 1220
376 nmdc:mga08x19_44433_c1 3300050514 Unclassified 2837
377 nmdc:mga0a205_130497_c1 3300050515 Unclassified 2413
378 nmdc:mga0a205_218984_c1 3300050515 Bacteria 1790
379 Ga0495601_0025478 3300053077 Bacteria 3648

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031090 Ga0265760_10000150 Ga0265760_1000015013 268
2 3300014325 Ga0163163_10465755 Ga0163163_104657552 269
3 3300048903 Ga0496100_0076924 Ga0496100_0076924_1026_1967 269
4 3300048910 Ga0496107_0047567 Ga0496107_0047567_67_1008 269
5 3300048912 Ga0496109_0205686 Ga0496109_0205686_424_1365 269
6 3300048917 Ga0496114_0040152 Ga0496114_0040152_310_1251 269
7 3300048918 Ga0496115_0104417 Ga0496115_0104417_1336_2277 269
8 3300005445 Ga0070708_100461147 Ga0070708_1004611471 277
9 3300005471 Ga0070698_100095288 Ga0070698_1000952882 277
10 3300005536 Ga0070697_100000784 Ga0070697_10000078411 277
11 3300006028 Ga0070717_10189854 Ga0070717_101898542 277
12 3300009147 Ga0114129_10176736 Ga0114129_101767361 277
13 3300047444 Ga0495675_0055874 Ga0495675_0055874_1549_2415 277
14 3300005335 Ga0070666_10256735 Ga0070666_102567351 278
15 3300005344 Ga0070661_100500851 Ga0070661_1005008511 278
16 3300005354 Ga0070675_100320415 Ga0070675_1003204151 278
17 3300005366 Ga0070659_100475815 Ga0070659_1004758151 278
18 3300005435 Ga0070714_100016874 Ga0070714_1000168745 278
19 3300005445 Ga0070708_100095102 Ga0070708_1000951022 278
20 3300005535 Ga0070684_100058925 Ga0070684_1000589252 278
21 3300005543 Ga0070672_100173396 Ga0070672_1001733961 278
22 3300005617 Ga0068859_100041061 Ga0068859_1000410612 278
23 3300005618 Ga0068864_100061929 Ga0068864_1000619292 278
24 3300005718 Ga0068866_10135206 Ga0068866_101352062 278
25 3300005841 Ga0068863_100023382 Ga0068863_1000233823 278
26 3300005841 Ga0068863_100056015 Ga0068863_1000560152 278
27 3300005842 Ga0068858_100015430 Ga0068858_1000154307 278
28 3300005843 Ga0068860_100109083 Ga0068860_1001090833 278
29 3300005985 Ga0081539_10010939 Ga0081539_100109392 278
30 3300006028 Ga0070717_10000442 Ga0070717_1000044228 278
31 3300006028 Ga0070717_10003878 Ga0070717_100038787 278
32 3300006881 Ga0068865_100246686 Ga0068865_1002466862 278
33 3300006931 Ga0097620_100041063 Ga0097620_1000410632 278
34 3300009093 Ga0105240_10060872 Ga0105240_100608725 278
35 3300009545 Ga0105237_10448327 Ga0105237_104483271 278
36 3300009551 Ga0105238_10036276 Ga0105238_100362766 278
37 3300009551 Ga0105238_10336955 Ga0105238_103369552 278
38 3300010375 Ga0105239_10414123 Ga0105239_104141232 278
39 3300013100 Ga0157373_10088201 Ga0157373_100882011 278
40 3300013296 Ga0157374_10034799 Ga0157374_100347993 278
41 3300013307 Ga0157372_10002713 Ga0157372_100027137 278
42 3300013307 Ga0157372_10172042 Ga0157372_101720421 278
43 3300013307 Ga0157372_10826071 Ga0157372_108260711 278
44 3300014325 Ga0163163_10073991 Ga0163163_100739912 278
45 3300015261 Ga0182006_1032480 Ga0182006_10324802 278
46 3300015262 Ga0182007_10018837 Ga0182007_100188372 278
47 3300015265 Ga0182005_1059631 Ga0182005_10596311 278
48 3300025904 Ga0207647_10013010 Ga0207647_100130102 278
49 3300025925 Ga0207650_10052967 Ga0207650_100529671 278
50 3300025940 Ga0207691_10177517 Ga0207691_101775173 278
51 3300025942 Ga0207689_10000901 Ga0207689_1000090123 278
52 3300025949 Ga0207667_10599382 Ga0207667_105993822 278
53 3300026035 Ga0207703_10007660 Ga0207703_100076606 278
54 3300026088 Ga0207641_10065483 Ga0207641_100654835 278
55 3300026089 Ga0207648_10016621 Ga0207648_100166217 278
56 3300026116 Ga0207674_10049804 Ga0207674_100498041 278
57 3300028381 Ga0268264_10180591 Ga0268264_101805912 278
58 3300035692 Ga0373935_0051130 Ga0373935_0051130_1505_2344 278
59 3300039437 Ga0436365_0590769 Ga0436365_0590769_226_1065 278
60 3300046472 Ga0495580_0009414 Ga0495580_0009414_5071_5910 278
61 3300046475 Ga0495639_0045685 Ga0495639_0045685_602_1444 278
62 3300046531 Ga0495665_0109953 Ga0495665_0109953_357_1199 278
63 3300005329 Ga0070683_100001100 Ga0070683_10000110018 279
64 3300005535 Ga0070684_100001196 Ga0070684_10000119618 279
65 3300009177 Ga0105248_10333640 Ga0105248_103336401 279
66 3300013105 Ga0157369_10068738 Ga0157369_100687383 279
67 3300014968 Ga0157379_10324921 Ga0157379_103249212 279
68 3300025944 Ga0207661_10001001 Ga0207661_100010013 279
69 3300031241 Ga0265325_10132094 Ga0265325_101320941 279
70 3300035113 Ga0373936_0004496 Ga0373936_0004496_674_1516 279
71 3300035172 Ga0373955_0102734 Ga0373955_0102734_305_1147 279
72 3300035692 Ga0373935_0057438 Ga0373935_0057438_68_910 279
73 3300035725 Ga0373947_0067064 Ga0373947_0067064_60_902 279
74 3300036401 Ga0373937_0072842 Ga0373937_0072842_1566_2420 279
75 3300037068 Ga0373925_0039186 Ga0373925_0039186_1919_2761 279
76 3300045051 Ga0451576_0347541 Ga0451576_0347541_573_1415 279
77 3300046533 Ga0495640_0119567 Ga0495640_0119567_544_1386 279
78 3300046678 Ga0495599_0174716 Ga0495599_0174716_14_856 279
79 3300048907 Ga0496104_0117730 Ga0496104_0117730_1335_2177 279
80 3300048918 Ga0496115_0031118 Ga0496115_0031118_11_853 279
81 3300053077 Ga0495601_0025478 Ga0495601_0025478_317_1159 279
82 3300005841 Ga0068863_100087432 Ga0068863_1000874323 280
83 3300006847 Ga0075431_100003497 Ga0075431_1000034977 280
84 3300013296 Ga0157374_10019204 Ga0157374_100192044 280
85 3300013308 Ga0157375_10170744 Ga0157375_101707442 280
86 3300026088 Ga0207641_10073631 Ga0207641_100736312 280
87 3300050510 nmdc:mga06r32_151210_c1 nmdc:mga06r32_151210_c1_936_1781 280
88 3300005327 Ga0070658_10177223 Ga0070658_101772231 281
89 3300005328 Ga0070676_10018432 Ga0070676_100184322 281
90 3300005329 Ga0070683_100245255 Ga0070683_1002452551 281
91 3300005330 Ga0070690_100240434 Ga0070690_1002404342 281
92 3300005334 Ga0068869_100050859 Ga0068869_1000508591 281
93 3300005335 Ga0070666_10024852 Ga0070666_100248523 281
94 3300005337 Ga0070682_100045098 Ga0070682_1000450983 281
95 3300005338 Ga0068868_100001598 Ga0068868_1000015984 281
96 3300005339 Ga0070660_100083188 Ga0070660_1000831882 281
97 3300005343 Ga0070687_100180469 Ga0070687_1001804692 281
98 3300005344 Ga0070661_100457380 Ga0070661_1004573801 281
99 3300005347 Ga0070668_100014267 Ga0070668_1000142671 281
100 3300005353 Ga0070669_100398853 Ga0070669_1003988532 281
101 3300005366 Ga0070659_100030418 Ga0070659_1000304184 281
102 3300005367 Ga0070667_100127759 Ga0070667_1001277592 281
103 3300005434 Ga0070709_10034560 Ga0070709_100345602 281
104 3300005434 Ga0070709_10046407 Ga0070709_100464072 281
105 3300005435 Ga0070714_100021945 Ga0070714_1000219457 281
106 3300005436 Ga0070713_100003252 Ga0070713_1000032524 281
107 3300005436 Ga0070713_100195031 Ga0070713_1001950312 281
108 3300005437 Ga0070710_10027742 Ga0070710_100277423 281
109 3300005438 Ga0070701_10215101 Ga0070701_102151011 281
110 3300005439 Ga0070711_100000184 Ga0070711_1000001844 281
111 3300005439 Ga0070711_100001678 Ga0070711_1000016782 281
112 3300005444 Ga0070694_100006224 Ga0070694_1000062242 281
113 3300005444 Ga0070694_100108681 Ga0070694_1001086812 281
114 3300005445 Ga0070708_100000679 Ga0070708_1000006793 281
115 3300005445 Ga0070708_100008937 Ga0070708_1000089376 281
116 3300005445 Ga0070708_100042355 Ga0070708_1000423553 281
117 3300005455 Ga0070663_100260481 Ga0070663_1002604812 281
118 3300005457 Ga0070662_100001344 Ga0070662_1000013444 281
119 3300005458 Ga0070681_10224687 Ga0070681_102246872 281
120 3300005459 Ga0068867_100647805 Ga0068867_1006478051 281
121 3300005466 Ga0070685_10221824 Ga0070685_102218241 281
122 3300005467 Ga0070706_100000454 Ga0070706_10000045410 281
123 3300005467 Ga0070706_100009824 Ga0070706_1000098247 281
124 3300005467 Ga0070706_100075036 Ga0070706_1000750362 281
125 3300005467 Ga0070706_100113163 Ga0070706_1001131634 281
126 3300005467 Ga0070706_100261500 Ga0070706_1002615002 281
127 3300005467 Ga0070706_100316255 Ga0070706_1003162551 281
128 3300005468 Ga0070707_100035343 Ga0070707_1000353432 281
129 3300005468 Ga0070707_100294649 Ga0070707_1002946492 281
130 3300005471 Ga0070698_100001288 Ga0070698_10000128810 281
131 3300005471 Ga0070698_100009995 Ga0070698_1000099956 281
132 3300005471 Ga0070698_100049551 Ga0070698_1000495512 281
133 3300005471 Ga0070698_100500310 Ga0070698_1005003101 281
134 3300005518 Ga0070699_100014814 Ga0070699_1000148143 281
135 3300005518 Ga0070699_100016649 Ga0070699_1000166496 281
136 3300005518 Ga0070699_100076127 Ga0070699_1000761271 281
137 3300005518 Ga0070699_100106621 Ga0070699_1001066212 281
138 3300005518 Ga0070699_100362549 Ga0070699_1003625492 281
139 3300005530 Ga0070679_100041588 Ga0070679_1000415884 281
140 3300005535 Ga0070684_100172358 Ga0070684_1001723582 281
141 3300005536 Ga0070697_100000411 Ga0070697_10000041120 281
142 3300005536 Ga0070697_100000671 Ga0070697_10000067120 281
143 3300005536 Ga0070697_100002338 Ga0070697_10000233814 281
144 3300005536 Ga0070697_100005876 Ga0070697_1000058766 281
145 3300005536 Ga0070697_100008836 Ga0070697_1000088363 281
146 3300005536 Ga0070697_100092533 Ga0070697_1000925332 281
147 3300005536 Ga0070697_100136030 Ga0070697_1001360302 281
148 3300005536 Ga0070697_100234060 Ga0070697_1002340601 281
149 3300005545 Ga0070695_100001473 Ga0070695_1000014735 281
150 3300005545 Ga0070695_100014719 Ga0070695_1000147194 281
151 3300005545 Ga0070695_100111676 Ga0070695_1001116761 281
152 3300005546 Ga0070696_100001746 Ga0070696_1000017466 281
153 3300005547 Ga0070693_100000070 Ga0070693_10000007029 281
154 3300005547 Ga0070693_100089443 Ga0070693_1000894432 281
155 3300005547 Ga0070693_100177377 Ga0070693_1001773771 281
156 3300005548 Ga0070665_100247096 Ga0070665_1002470962 281
157 3300005549 Ga0070704_100008207 Ga0070704_1000082072 281
158 3300005549 Ga0070704_100191911 Ga0070704_1001919112 281
159 3300005563 Ga0068855_100139379 Ga0068855_1001393792 281
160 3300005564 Ga0070664_100016650 Ga0070664_1000166502 281
161 3300005578 Ga0068854_100028024 Ga0068854_1000280242 281
162 3300005614 Ga0068856_100006168 Ga0068856_1000061684 281
163 3300005615 Ga0070702_100226215 Ga0070702_1002262151 281
164 3300005616 Ga0068852_100047059 Ga0068852_1000470593 281
165 3300005617 Ga0068859_100218518 Ga0068859_1002185182 281
166 3300005719 Ga0068861_100185437 Ga0068861_1001854372 281
167 3300005834 Ga0068851_10185145 Ga0068851_101851451 281
168 3300005842 Ga0068858_100185063 Ga0068858_1001850632 281
169 3300005843 Ga0068860_100158768 Ga0068860_1001587682 281
170 3300005983 Ga0081540_1030546 Ga0081540_10305463 281
171 3300006028 Ga0070717_10006061 Ga0070717_1000606112 281
172 3300006028 Ga0070717_10169378 Ga0070717_101693783 281
173 3300006173 Ga0070716_100001085 Ga0070716_1000010853 281
174 3300006173 Ga0070716_100020370 Ga0070716_1000203704 281
175 3300006175 Ga0070712_100001711 Ga0070712_10000171113 281
176 3300006175 Ga0070712_100002289 Ga0070712_1000022892 281
177 3300006175 Ga0070712_100002489 Ga0070712_10000248911 281
178 3300006175 Ga0070712_100216443 Ga0070712_1002164431 281
179 3300006237 Ga0097621_100014797 Ga0097621_1000147972 281
180 3300006358 Ga0068871_100224460 Ga0068871_1002244602 281
181 3300006914 Ga0075436_100004693 Ga0075436_10000469310 281
182 3300006931 Ga0097620_100218518 Ga0097620_1002185181 281
183 3300007265 Ga0099794_10006675 Ga0099794_100066752 281
184 3300007265 Ga0099794_10040747 Ga0099794_100407471 281
185 3300007265 Ga0099794_10050103 Ga0099794_100501032 281
186 3300007265 Ga0099794_10067791 Ga0099794_100677912 281
187 3300009092 Ga0105250_10113236 Ga0105250_101132362 281
188 3300009093 Ga0105240_10111490 Ga0105240_101114902 281
189 3300009148 Ga0105243_10036452 Ga0105243_100364522 281
190 3300009174 Ga0105241_10028102 Ga0105241_100281025 281
191 3300009174 Ga0105241_10092134 Ga0105241_100921342 281
192 3300009176 Ga0105242_10024658 Ga0105242_100246584 281
193 3300009176 Ga0105242_10220452 Ga0105242_102204521 281
194 3300009177 Ga0105248_10237816 Ga0105248_102378162 281
195 3300009551 Ga0105238_10182237 Ga0105238_101822372 281
196 3300009553 Ga0105249_10004935 Ga0105249_100049358 281
197 3300013102 Ga0157371_10010312 Ga0157371_100103124 281
198 3300013104 Ga0157370_10348053 Ga0157370_103480532 281
199 3300013105 Ga0157369_10168137 Ga0157369_101681373 281
200 3300013105 Ga0157369_10337700 Ga0157369_103377002 281
201 3300013296 Ga0157374_10004000 Ga0157374_100040008 281
202 3300013306 Ga0163162_10353488 Ga0163162_103534881 281
203 3300013307 Ga0157372_10005161 Ga0157372_1000516110 281
204 3300013307 Ga0157372_10019884 Ga0157372_100198846 281
205 3300013307 Ga0157372_10141154 Ga0157372_101411543 281
206 3300024225 Ga0224572_1006954 Ga0224572_10069542 281
207 3300025321 Ga0207656_10056209 Ga0207656_100562092 281
208 3300025903 Ga0207680_10098015 Ga0207680_100980152 281
209 3300025904 Ga0207647_10068910 Ga0207647_100689102 281
210 3300025906 Ga0207699_10069738 Ga0207699_100697382 281
211 3300025906 Ga0207699_10104835 Ga0207699_101048352 281
212 3300025906 Ga0207699_10275090 Ga0207699_102750901 281
213 3300025906 Ga0207699_10291443 Ga0207699_102914431 281
214 3300025910 Ga0207684_10003864 Ga0207684_100038643 281
215 3300025910 Ga0207684_10009913 Ga0207684_100099136 281
216 3300025910 Ga0207684_10012365 Ga0207684_100123656 281
217 3300025910 Ga0207684_10059124 Ga0207684_100591242 281
218 3300025910 Ga0207684_10084121 Ga0207684_100841212 281
219 3300025910 Ga0207684_10086143 Ga0207684_100861432 281
220 3300025911 Ga0207654_10004925 Ga0207654_100049256 281
221 3300025912 Ga0207707_10218630 Ga0207707_102186302 281
222 3300025913 Ga0207695_10007887 Ga0207695_100078879 281
223 3300025913 Ga0207695_10008581 Ga0207695_100085812 281
224 3300025914 Ga0207671_10195380 Ga0207671_101953802 281
225 3300025915 Ga0207693_10000084 Ga0207693_1000008465 281
226 3300025915 Ga0207693_10000386 Ga0207693_1000038613 281
227 3300025915 Ga0207693_10113611 Ga0207693_101136113 281
228 3300025916 Ga0207663_10005053 Ga0207663_100050531 281
229 3300025916 Ga0207663_10006167 Ga0207663_100061676 281
230 3300025916 Ga0207663_10025514 Ga0207663_100255145 281
231 3300025919 Ga0207657_10000770 Ga0207657_100007709 281
232 3300025920 Ga0207649_10057566 Ga0207649_100575663 281
233 3300025921 Ga0207652_10024653 Ga0207652_100246532 281
234 3300025921 Ga0207652_10030236 Ga0207652_100302364 281
235 3300025921 Ga0207652_10197583 Ga0207652_101975832 281
236 3300025922 Ga0207646_10003435 Ga0207646_1000343512 281
237 3300025922 Ga0207646_10011035 Ga0207646_100110356 281
238 3300025922 Ga0207646_10015638 Ga0207646_100156385 281
239 3300025922 Ga0207646_10270316 Ga0207646_102703161 281
240 3300025923 Ga0207681_10300750 Ga0207681_103007502 281
241 3300025927 Ga0207687_10002428 Ga0207687_100024281 281
242 3300025928 Ga0207700_10000207 Ga0207700_1000020736 281
243 3300025928 Ga0207700_10146976 Ga0207700_101469761 281
244 3300025929 Ga0207664_10032750 Ga0207664_100327503 281
245 3300025929 Ga0207664_10118116 Ga0207664_101181161 281
246 3300025932 Ga0207690_10147690 Ga0207690_101476901 281
247 3300025933 Ga0207706_10000687 Ga0207706_1000068710 281
248 3300025935 Ga0207709_10039842 Ga0207709_100398421 281
249 3300025936 Ga0207670_10321532 Ga0207670_103215321 281
250 3300025938 Ga0207704_10405356 Ga0207704_104053561 281
251 3300025939 Ga0207665_10000136 Ga0207665_100001367 281
252 3300025939 Ga0207665_10071045 Ga0207665_100710452 281
253 3300025939 Ga0207665_10154867 Ga0207665_101548672 281
254 3300025939 Ga0207665_10250025 Ga0207665_102500252 281
255 3300025941 Ga0207711_10007257 Ga0207711_100072574 281
256 3300025944 Ga0207661_10681313 Ga0207661_106813131 281
257 3300025945 Ga0207679_10321918 Ga0207679_103219182 281
258 3300025949 Ga0207667_10004797 Ga0207667_100047978 281
259 3300025961 Ga0207712_10022215 Ga0207712_100222152 281
260 3300025972 Ga0207668_10042604 Ga0207668_100426041 281
261 3300025981 Ga0207640_10044971 Ga0207640_100449713 281
262 3300025986 Ga0207658_10185185 Ga0207658_101851852 281
263 3300026041 Ga0207639_10422591 Ga0207639_104225912 281
264 3300026067 Ga0207678_10001244 Ga0207678_1000124421 281
265 3300026078 Ga0207702_10012479 Ga0207702_100124794 281
266 3300026089 Ga0207648_10006876 Ga0207648_100068765 281
267 3300026095 Ga0207676_10472614 Ga0207676_104726142 281
268 3300026116 Ga0207674_10008896 Ga0207674_100088962 281
269 3300026118 Ga0207675_100560763 Ga0207675_1005607631 281
270 3300026142 Ga0207698_10393534 Ga0207698_103935341 281
271 3300027671 Ga0209588_1002852 Ga0209588_10028522 281
272 3300027671 Ga0209588_1003168 Ga0209588_10031682 281
273 3300027671 Ga0209588_1039267 Ga0209588_10392672 281
274 3300028016 Ga0265354_1002258 Ga0265354_10022582 281
275 3300028016 Ga0265354_1002285 Ga0265354_10022852 281
276 3300028379 Ga0268266_10059538 Ga0268266_100595382 281
277 3300028380 Ga0268265_10133918 Ga0268265_101339182 281
278 3300028381 Ga0268264_10335056 Ga0268264_103350562 281
279 3300031090 Ga0265760_10008935 Ga0265760_100089352 281
280 3300031090 Ga0265760_10015907 Ga0265760_100159072 281
281 3300031241 Ga0265325_10005033 Ga0265325_100050337 281
282 3300031249 Ga0265339_10083817 Ga0265339_100838172 281
283 3300031344 Ga0265316_10000888 Ga0265316_1000088822 281
284 3300031344 Ga0265316_10126132 Ga0265316_101261321 281
285 3300031344 Ga0265316_10154855 Ga0265316_101548552 281
286 3300033547 Ga0316212_1005887 Ga0316212_10058872 281
287 3300035111 Ga0373923_0071912 Ga0373923_0071912_356_1204 281
288 3300035111 Ga0373923_0102041 Ga0373923_0102041_205_1065 281
289 3300035118 Ga0373954_0010981 Ga0373954_0010981_1538_2398 281
290 3300035118 Ga0373954_0028488 Ga0373954_0028488_666_1514 281
291 3300035170 Ga0373943_0048102 Ga0373943_0048102_43_891 281
292 3300035170 Ga0373943_0182571 Ga0373943_0182571_170_1018 281
293 3300035172 Ga0373955_0003600 Ga0373955_0003600_5332_6192 281
294 3300035241 Ga0373961_0032079 Ga0373961_0032079_443_1291 281
295 3300035692 Ga0373935_0157858 Ga0373935_0157858_103_951 281
296 3300035724 Ga0373933_0001405 Ga0373933_0001405_1450_2310 281
297 3300036401 Ga0373937_0000250 Ga0373937_0000250_43614_44474 281
298 3300036401 Ga0373937_0012670 Ga0373937_0012670_2247_3095 281
299 3300036401 Ga0373937_0305405 Ga0373937_0305405_387_1235 281
300 3300036401 Ga0373937_0598456 Ga0373937_0598456_85_981 281
301 3300044694 Ga0466963_0047166 Ga0466963_0047166_1095_1943 281
302 3300045976 Ga0466967_0026613 Ga0466967_0026613_1861_2709 281
303 3300045976 Ga0466967_0157527 Ga0466967_0157527_1175_2044 281
304 3300046459 Ga0495629_0017843 Ga0495629_0017843_1609_2457 281
305 3300046462 Ga0495651_0009448 Ga0495651_0009448_6449_7309 281
306 3300046463 Ga0495653_0090055 Ga0495653_0090055_1033_1893 281
307 3300046472 Ga0495580_0001042 Ga0495580_0001042_15393_16241 281
308 3300046473 Ga0495582_0000860 Ga0495582_0000860_6018_6866 281
309 3300046536 Ga0495587_0003432 Ga0495587_0003432_6888_7748 281
310 3300046536 Ga0495587_0011610 Ga0495587_0011610_4288_5133 281
311 3300046559 Ga0495667_0016069 Ga0495667_0016069_3467_4327 281
312 3300046675 Ga0495657_0138271 Ga0495657_0138271_276_1136 281
313 3300046679 Ga0495623_0099894 Ga0495623_0099894_464_1324 281
314 3300047317 Ga0495604_0000529 Ga0495604_0000529_6954_7814 281
315 3300047471 Ga0495684_0002283 Ga0495684_0002283_13341_14201 281
316 3300048088 Ga0495602_0012902 Ga0495602_0012902_7058_7918 281
317 3300048909 Ga0496106_0028712 Ga0496106_0028712_3186_4034 281
318 3300048912 Ga0496109_0194163 Ga0496109_0194163_813_1661 281
319 3300048915 Ga0496112_0037273 Ga0496112_0037273_235_1083 281
320 3300048916 Ga0496113_0352103 Ga0496113_0352103_150_998 281
321 3300050514 nmdc:mga08x19_190679_c1 nmdc:mga08x19_190679_c1_58_906 281
322 3300050514 nmdc:mga08x19_44433_c1 nmdc:mga08x19_44433_c1_629_1495 281
323 3300005295 Ga0065707_10016457 Ga0065707_100164572 282
324 3300005436 Ga0070713_100207543 Ga0070713_1002075431 282
325 3300005439 Ga0070711_100031845 Ga0070711_1000318453 282
326 3300005444 Ga0070694_100172362 Ga0070694_1001723622 282
327 3300005468 Ga0070707_100000497 Ga0070707_10000049718 282
328 3300005617 Ga0068859_100305528 Ga0068859_1003055281 282
329 3300006844 Ga0075428_100002535 Ga0075428_10000253511 282
330 3300006847 Ga0075431_100556635 Ga0075431_1005566352 282
331 3300006880 Ga0075429_100087842 Ga0075429_1000878423 282
332 3300006931 Ga0097620_100305532 Ga0097620_1003055322 282
333 3300009094 Ga0111539_10033595 Ga0111539_100335954 282
334 3300009177 Ga0105248_10421637 Ga0105248_104216372 282
335 3300025941 Ga0207711_10223390 Ga0207711_102233902 282
336 3300044673 Ga0453683_0045687 Ga0453683_0045687_1766_2617 282
337 3300046543 Ga0495645_0057282 Ga0495645_0057282_1936_2784 282
338 3300047319 Ga0495674_0070404 Ga0495674_0070404_1869_2717 282
339 3300048912 Ga0496109_0779541 Ga0496109_0779541_21_872 282
340 3300050507 nmdc:mga05p37_948258_c1 nmdc:mga05p37_948258_c1_35_886 282
341 3300050512 nmdc:mga0n895_293116_c1 nmdc:mga0n895_293116_c1_748_1599 282
342 3300007076 Ga0075435_100040955 Ga0075435_1000409552 283
343 3300025939 Ga0207665_10090652 Ga0207665_100906523 283
344 3300046683 Ga0495658_0254253 Ga0495658_0254253_165_1079 283
345 3300050513 nmdc:mga0rr50_71277_c1 nmdc:mga0rr50_71277_c1_611_1525 283
346 3300005440 Ga0070705_100095722 Ga0070705_1000957221 284
347 3300005549 Ga0070704_100297080 Ga0070704_1002970802 284
348 3300005842 Ga0068858_100101662 Ga0068858_1001016622 284
349 3300006852 Ga0075433_10244465 Ga0075433_102444653 284
350 3300006871 Ga0075434_100013250 Ga0075434_1000132507 284
351 3300007076 Ga0075435_100066051 Ga0075435_1000660513 284
352 3300013296 Ga0157374_10388498 Ga0157374_103884981 284
353 3300013297 Ga0157378_10169641 Ga0157378_101696412 284
354 3300026035 Ga0207703_10057625 Ga0207703_100576252 284
355 3300026088 Ga0207641_10004872 Ga0207641_100048727 284
356 3300028381 Ga0268264_10192567 Ga0268264_101925672 284
357 3300050512 nmdc:mga0n895_103039_c1 nmdc:mga0n895_103039_c1_1681_2565 284
358 3300050513 nmdc:mga0rr50_284748_c1 nmdc:mga0rr50_284748_c1_339_1223 284
359 3300050515 nmdc:mga0a205_218984_c1 nmdc:mga0a205_218984_c1_866_1750 284
360 3300010159 Ga0099796_10075291 Ga0099796_100752912 285
361 3300005440 Ga0070705_100071202 Ga0070705_1000712022 286
362 3300009148 Ga0105243_10191596 Ga0105243_101915962 286
363 3300050507 nmdc:mga05p37_519484_c1 nmdc:mga05p37_519484_c1_367_1266 286
364 3300005293 Ga0065715_10258102 Ga0065715_102581021 287
365 3300005339 Ga0070660_100116091 Ga0070660_1001160912 287
366 3300005344 Ga0070661_100236348 Ga0070661_1002363482 287
367 3300005353 Ga0070669_100319713 Ga0070669_1003197131 287
368 3300005355 Ga0070671_100570491 Ga0070671_1005704911 287
369 3300005455 Ga0070663_100181222 Ga0070663_1001812221 287
370 3300005539 Ga0068853_100214483 Ga0068853_1002144832 287
371 3300006914 Ga0075436_100106836 Ga0075436_1001068362 287
372 3300025915 Ga0207693_10029438 Ga0207693_100294381 287
373 3300025928 Ga0207700_10303624 Ga0207700_103036242 287
374 3300025939 Ga0207665_10050784 Ga0207665_100507842 287
375 3300046526 Ga0495666_0023672 Ga0495666_0023672_822_1781 287
376 3300050508 nmdc:mga09592_76845_c1 nmdc:mga09592_76845_c1_1042_1947 287
377 3300050511 nmdc:mga08y16_6090_c1 nmdc:mga08y16_6090_c1_6561_7466 287
378 3300050514 nmdc:mga08x19_251731_c1 nmdc:mga08x19_251731_c1_159_1118 287
379 3300050515 nmdc:mga0a205_130497_c1 nmdc:mga0a205_130497_c1_34_939 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

51

283

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8787 36 263
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8555 36 263
3l23-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase/epimerase (yp_001303399.1) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8483 36 282
3obe-assembly2.cif.gz_B crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8258 30 284
3obe-assembly1.cif.gz_A crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.8218 32 285
ID Description Score Start End Superfamily
af_P32134_16_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8169 36 266 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8014 36 284 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7955 36 284 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7866 32 285 3.20.20.150
af_P32134_16_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7772 36 266 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A1Q6YDU6-F1-model_v4 Xylose isomerase 0.9953 36 285 GO:0016853
AF-A0A3D1AXT5-F1-model_v4 Xylose isomerase 0.9858 135 287 GO:0016853
AF-A0A359LM66-F1-model_v4 Xylose isomerase 0.9819 35 287 GO:0016853
AF-A0A2V9BM78-F1-model_v4 Xylose isomerase 0.9819 64 166 GO:0016853
AF-A0A1Q6YDU6-F1-model_v4 Xylose isomerase 0.9796 36 285 GO:0016853

Feature Viewer

pLDDT pTM Quality
89.13 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map