F428363

General Info

Members Datasets Scaffolds Average Seq Length
379 188 758 246

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10351082|Ga0157380_103510822
Length 273
Sequence LFDAMIPVATAPWAHLPFDLLAWGAGTASTVAVYRWRLKDQVRPVAARIDGGYFLFLALGAIPGAWLAGSLNSLREHAPALSHSVAGALVGAIAGVELYKALRGVKGSTGGVFVGSISLGVVIGRLGCFFAGLPDDTYGAPTRLPWAVNLGDGVGRHPVQLYESASMALFLAVYLASLARRRDWAMRRGFYVMCGWYGLQRFCWEFLKPYPRLIGPFNLFHLLCVGLVIYGWVYYRADRRRDRVAQGRALSVPGPDHQPVRDLPGPGRRQGDL

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
179 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
180 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
183 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
184 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
185 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
186 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
187 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
188 2818991435 Caulobacter henricii 536 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.5
Nodule 0
Rhizoplane 0.79
Rhizosphere 85.75
Stem 0
Stem Tuber 0
Unclassified 2.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10351082 3300014326 Bacteria 1380
2 JGI24736J21556_1002316 3300001904 Bacteria 3363
3 JGI24739J22299_10013813 3300001989 Bacteria 2944
4 JGI24737J22298_10000889 3300001990 Bacteria 10645
5 JGI24743J22301_10005850 3300001991 Bacteria 2070
6 Ga0055526_1036942 3300003771 Bacteria 1286
7 Ga0055531_10000622 3300003794 Bacteria 30617
8 Ga0065165_1019552 3300005262 Bacteria 2412
9 Ga0070658_10031086 3300005327 Bacteria 4287
10 Ga0070658_10080617 3300005327 Bacteria 2673
11 Ga0070658_10086591 3300005327 Bacteria 2577
12 Ga0070658_10088778 3300005327 Bacteria 2545
13 Ga0070658_10140604 3300005327 Bacteria 2016
14 Ga0070658_10183248 3300005327 Bacteria 1762
15 Ga0070658_10189679 3300005327 Bacteria 1732
16 Ga0070683_100628441 3300005329 Bacteria 1028
17 Ga0070670_100032460 3300005331 Bacteria 4497
18 Ga0070670_100074422 3300005331 Bacteria 2918
19 Ga0068869_100054412 3300005334 Bacteria 2913
20 Ga0070666_10001395 3300005335 Bacteria 14613
21 Ga0070680_100013302 3300005336 Bacteria 6408
22 Ga0070682_100236097 3300005337 Bacteria 1310
23 Ga0070660_100211992 3300005339 Bacteria 1573
24 Ga0070691_10039734 3300005341 Bacteria 2223
25 Ga0070661_100094371 3300005344 Bacteria 2217
26 Ga0070661_100268591 3300005344 Bacteria 1320
27 Ga0070692_10044328 3300005345 Bacteria 2291
28 Ga0070668_100018385 3300005347 Bacteria 5247
29 Ga0070669_100055184 3300005353 Bacteria 2911
30 Ga0070669_100097265 3300005353 Bacteria 2215
31 Ga0070669_100133735 3300005353 Bacteria 1906
32 Ga0070671_100014919 3300005355 Bacteria 6277
33 Ga0070671_100163316 3300005355 Bacteria 1882
34 Ga0070671_100163417 3300005355 Bacteria 1882
35 Ga0070671_100269226 3300005355 Bacteria 1448
36 Ga0070671_100331324 3300005355 Bacteria 1298
37 Ga0070659_100011452 3300005366 Bacteria 6562
38 Ga0070659_100032817 3300005366 Bacteria 4030
39 Ga0070659_100062920 3300005366 Bacteria 2934
40 Ga0070659_100195605 3300005366 Bacteria 1663
41 Ga0070659_100240089 3300005366 Bacteria 1499
42 Ga0070667_100000112 3300005367 Bacteria 104843
43 Ga0070667_100008851 3300005367 Bacteria 8333
44 Ga0070667_100062957 3300005367 Bacteria 3142
45 Ga0070667_100066683 3300005367 Bacteria 3059
46 Ga0070667_100127915 3300005367 Bacteria 2215
47 Ga0070663_100009279 3300005455 Bacteria 6087
48 Ga0070663_100013084 3300005455 Bacteria 5273
49 Ga0070663_100031259 3300005455 Bacteria 3658
50 Ga0070663_100353937 3300005455 Bacteria 1190
51 Ga0070678_100209934 3300005456 Bacteria 1613
52 Ga0070662_100009972 3300005457 Bacteria 6221
53 Ga0070662_100046731 3300005457 Bacteria 3111
54 Ga0070662_100358014 3300005457 Bacteria 1197
55 Ga0070662_100488036 3300005457 Bacteria 1026
56 Ga0070681_10120149 3300005458 Bacteria 2563
57 Ga0068853_100040695 3300005539 Bacteria 3966
58 Ga0068853_100072020 3300005539 Bacteria 3011
59 Ga0068853_100118819 3300005539 Bacteria 2356
60 Ga0070672_100433946 3300005543 Bacteria 1130
61 Ga0070686_100223455 3300005544 Bacteria 1362
62 Ga0070693_100030465 3300005547 Bacteria 2949
63 Ga0070665_100008168 3300005548 Bacteria 10598
64 Ga0070665_100022386 3300005548 Bacteria 6360
65 Ga0070665_100024836 3300005548 Bacteria 6038
66 Ga0070665_100039252 3300005548 Bacteria 4761
67 Ga0070665_100077129 3300005548 Bacteria 3339
68 Ga0070665_100216636 3300005548 Bacteria 1915
69 Ga0070665_100278741 3300005548 Bacteria 1674
70 Ga0070664_100034160 3300005564 Bacteria 4265
71 Ga0068857_100060505 3300005577 Bacteria 3364
72 Ga0068857_100142184 3300005577 Bacteria 2169
73 Ga0068854_100026930 3300005578 Bacteria 3956
74 Ga0068854_100036839 3300005578 Bacteria 3430
75 Ga0068854_100160030 3300005578 Bacteria 1743
76 Ga0068854_100420120 3300005578 Unclassified 1110
77 Ga0068852_100031061 3300005616 Bacteria 4403
78 Ga0068852_100056814 3300005616 Bacteria 3384
79 Ga0068852_100352984 3300005616 Bacteria 1436
80 Ga0068859_100021029 3300005617 Bacteria 6548
81 Ga0068859_100049893 3300005617 Bacteria 4204
82 Ga0068859_100052448 3300005617 Bacteria 4100
83 Ga0068859_100366756 3300005617 Bacteria 1535
84 Ga0068864_100000110 3300005618 Bacteria 80031
85 Ga0068864_100002687 3300005618 Bacteria 14661
86 Ga0068864_100126791 3300005618 Bacteria 2288
87 Ga0068864_100164039 3300005618 Bacteria 2022
88 Ga0068864_100199092 3300005618 Bacteria 1839
89 Ga0068864_100284551 3300005618 Bacteria 1544
90 Ga0068861_100000023 3300005719 Bacteria 72781
91 Ga0068861_100013196 3300005719 Bacteria 5779
92 Ga0068861_100117331 3300005719 Bacteria 2142
93 Ga0068851_10003307 3300005834 Bacteria 7161
94 Ga0068851_10006341 3300005834 Bacteria 5397
95 Ga0068863_100000223 3300005841 Bacteria 60094
96 Ga0068863_100010974 3300005841 Bacteria 8785
97 Ga0068863_100012118 3300005841 Bacteria 8329
98 Ga0068863_100109343 3300005841 Bacteria 2631
99 Ga0068863_100167469 3300005841 Bacteria 2107
100 Ga0068858_100002458 3300005842 Bacteria 18704
101 Ga0068858_100063482 3300005842 Bacteria 3418
102 Ga0068858_100380526 3300005842 Bacteria 1354
103 Ga0068860_100007154 3300005843 Bacteria 11163
104 Ga0068860_100076732 3300005843 Bacteria 3178
105 Ga0068860_100216692 3300005843 Bacteria 1858
106 Ga0068860_100315594 3300005843 Bacteria 1533
107 Ga0068862_100019231 3300005844 Bacteria 5695
108 Ga0068862_100051003 3300005844 Bacteria 3538
109 Ga0068862_100089704 3300005844 Bacteria 2676
110 Ga0068862_100094994 3300005844 Bacteria 2600
111 Ga0075363_100001685 3300006048 Bacteria 8567
112 Ga0075363_100131722 3300006048 Bacteria 1402
113 Ga0075364_10038527 3300006051 Unclassified 3097
114 Ga0075362_10000003 3300006177 Bacteria 171099
115 Ga0075369_10004346 3300006186 Bacteria 5227
116 Ga0075370_10106495 3300006353 Bacteria 1626
117 Ga0075370_10143658 3300006353 Bacteria 1396
118 Ga0097620_100021031 3300006931 Bacteria 6548
119 Ga0097620_100049893 3300006931 Bacteria 4204
120 Ga0097620_100052448 3300006931 Bacteria 4100
121 Ga0097620_100366764 3300006931 Bacteria 1535
122 Ga0105251_10055311 3300009011 Bacteria 1882
123 Ga0105250_10004482 3300009092 Bacteria 6420
124 Ga0105250_10031004 3300009092 Bacteria 2148
125 Ga0105240_10062997 3300009093 Bacteria 4615
126 Ga0105240_10126383 3300009093 Bacteria 3072
127 Ga0105240_10430411 3300009093 Bacteria 1481
128 Ga0105240_10540743 3300009093 Unclassified 1290
129 Ga0105247_10098080 3300009101 Bacteria 1870
130 Ga0105243_10212923 3300009148 Bacteria 1703
131 Ga0105248_10006973 3300009177 Bacteria 12375
132 Ga0105248_10016808 3300009177 Bacteria 8054
133 Ga0105248_10026434 3300009177 Bacteria 6457
134 Ga0105248_10048415 3300009177 Bacteria 4768
135 Ga0105248_10174083 3300009177 Bacteria 2426
136 Ga0105237_10002659 3300009545 Bacteria 21965
137 Ga0105238_10196665 3300009551 Bacteria 1992
138 Ga0105249_10234893 3300009553 Bacteria 1810
139 Ga0105249_10412217 3300009553 Bacteria 1383
140 Ga0105239_10000113 3300010375 Bacteria 114562
141 Ga0105239_10178379 3300010375 Bacteria 2376
142 Ga0105239_10496527 3300010375 Unclassified 1387
143 Ga0105246_10062283 3300011119 Bacteria 2598
144 Ga0157373_10038979 3300013100 Bacteria 3403
145 Ga0157373_10060639 3300013100 Bacteria 2680
146 Ga0157373_10348628 3300013100 Unclassified 1056
147 Ga0157371_10074586 3300013102 Bacteria 2402
148 Ga0157370_10177278 3300013104 Bacteria 1981
149 Ga0157369_10093375 3300013105 Bacteria 3212
150 Ga0157374_10135693 3300013296 Bacteria 2385
151 Ga0163162_10031861 3300013306 Bacteria 5231
152 Ga0157372_10043372 3300013307 Bacteria 4979
153 Ga0157372_10047521 3300013307 Bacteria 4770
154 Ga0157372_10477176 3300013307 Bacteria 1454
155 Ga0157375_10139174 3300013308 Bacteria 2553
156 Ga0157375_10274206 3300013308 Bacteria 1849
157 Ga0163163_10000489 3300014325 Bacteria 35830
158 Ga0157379_10054486 3300014968 Bacteria 3573
159 Ga0163161_10419548 3300017792 Bacteria 1076
160 Ga0213876_10000313 3300021384 Bacteria 42627
161 Ga0209257_1000036 3300025304 Bacteria 616006
162 Ga0207656_10005007 3300025321 Bacteria 4655
163 Ga0207656_10005121 3300025321 Bacteria 4610
164 Ga0207696_1026524 3300025711 Bacteria 1792
165 Ga0207680_10003344 3300025903 Bacteria 7553
166 Ga0207647_10017378 3300025904 Bacteria 4890
167 Ga0207647_10029176 3300025904 Bacteria 3573
168 Ga0207645_10381971 3300025907 Bacteria 945
169 Ga0207705_10004453 3300025909 Bacteria 10585
170 Ga0207705_10004761 3300025909 Bacteria 10224
171 Ga0207705_10016791 3300025909 Bacteria 5242
172 Ga0207705_10113889 3300025909 Bacteria 2000
173 Ga0207654_10191116 3300025911 Bacteria 1342
174 Ga0207707_10044815 3300025912 Bacteria 3855
175 Ga0207695_10067731 3300025913 Bacteria 3661
176 Ga0207695_10073744 3300025913 Bacteria 3477
177 Ga0207695_10104860 3300025913 Bacteria 2815
178 Ga0207695_10304557 3300025913 Bacteria 1484
179 Ga0207671_10002047 3300025914 Bacteria 22140
180 Ga0207660_10000670 3300025917 Bacteria 22876
181 Ga0207657_10007581 3300025919 Bacteria 11120
182 Ga0207657_10012838 3300025919 Bacteria 8242
183 Ga0207657_10018734 3300025919 Bacteria 6595
184 Ga0207657_10049960 3300025919 Bacteria 3641
185 Ga0207657_10189971 3300025919 Bacteria 1657
186 Ga0207649_10129571 3300025920 Bacteria 1711
187 Ga0207649_10207751 3300025920 Bacteria 1387
188 Ga0207652_10024424 3300025921 Bacteria 5014
189 Ga0207681_10042575 3300025923 Bacteria 3034
190 Ga0207650_10017192 3300025925 Bacteria 5062
191 Ga0207650_10021410 3300025925 Bacteria 4569
192 Ga0207650_10108748 3300025925 Bacteria 2143
193 Ga0207644_10004908 3300025931 Bacteria 8719
194 Ga0207644_10090430 3300025931 Bacteria 2281
195 Ga0207644_10092433 3300025931 Bacteria 2257
196 Ga0207644_10147276 3300025931 Bacteria 1819
197 Ga0207644_10163726 3300025931 Bacteria 1731
198 Ga0207644_10473893 3300025931 Bacteria 1030
199 Ga0207690_10002210 3300025932 Bacteria 11862
200 Ga0207690_10042266 3300025932 Bacteria 2992
201 Ga0207690_10051994 3300025932 Bacteria 2742
202 Ga0207690_10189224 3300025932 Bacteria 1556
203 Ga0207690_10306419 3300025932 Bacteria 1244
204 Ga0207706_10039082 3300025933 Bacteria 4207
205 Ga0207706_10170108 3300025933 Bacteria 1915
206 Ga0207709_10133072 3300025935 Bacteria 1697
207 Ga0207691_10041706 3300025940 Bacteria 4236
208 Ga0207691_10131047 3300025940 Bacteria 2215
209 Ga0207711_10000042 3300025941 Bacteria 158782
210 Ga0207711_10000552 3300025941 Bacteria 38214
211 Ga0207711_10034475 3300025941 Bacteria 4286
212 Ga0207711_10034869 3300025941 Bacteria 4262
213 Ga0207711_10095491 3300025941 Bacteria 2622
214 Ga0207689_10058784 3300025942 Bacteria 3163
215 Ga0207679_10039899 3300025945 Bacteria 3356
216 Ga0207679_10296200 3300025945 Bacteria 1393
217 Ga0207679_10311961 3300025945 Bacteria 1359
218 Ga0207667_10041925 3300025949 Bacteria 4867
219 Ga0207667_10043326 3300025949 Bacteria 4776
220 Ga0207712_10153241 3300025961 Bacteria 1782
221 Ga0207712_10267695 3300025961 Bacteria 1389
222 Ga0207712_10284192 3300025961 Bacteria 1351
223 Ga0207668_10033787 3300025972 Bacteria 3391
224 Ga0207640_10012880 3300025981 Bacteria 4777
225 Ga0207640_10041618 3300025981 Bacteria 2923
226 Ga0207640_10097498 3300025981 Bacteria 2053
227 Ga0207640_10097537 3300025981 Bacteria 2052
228 Ga0207658_10007296 3300025986 Bacteria 7539
229 Ga0207658_10007535 3300025986 Bacteria 7413
230 Ga0207658_10036993 3300025986 Bacteria 3503
231 Ga0207658_10051233 3300025986 Bacteria 3041
232 Ga0207703_10002493 3300026035 Bacteria 15957
233 Ga0207703_10014504 3300026035 Bacteria 6147
234 Ga0207703_10137347 3300026035 Bacteria 2118
235 Ga0207639_10071179 3300026041 Bacteria 2719
236 Ga0207639_10132834 3300026041 Bacteria 2063
237 Ga0207678_10005746 3300026067 Bacteria 11072
238 Ga0207678_10010821 3300026067 Bacteria 8016
239 Ga0207678_10011581 3300026067 Bacteria 7746
240 Ga0207678_10191031 3300026067 Bacteria 1750
241 Ga0207702_10423733 3300026078 Unclassified 1287
242 Ga0207641_10000134 3300026088 Bacteria 109053
243 Ga0207641_10000927 3300026088 Bacteria 30260
244 Ga0207641_10014890 3300026088 Bacteria 6376
245 Ga0207641_10072119 3300026088 Bacteria 2973
246 Ga0207648_10116522 3300026089 Bacteria 2348
247 Ga0207676_10000502 3300026095 Bacteria 33005
248 Ga0207676_10029118 3300026095 Bacteria 4131
249 Ga0207676_10030794 3300026095 Bacteria 4030
250 Ga0207676_10102726 3300026095 Bacteria 2374
251 Ga0207676_10642326 3300026095 Bacteria 1023
252 Ga0207674_10004963 3300026116 Bacteria 15898
253 Ga0207674_10014364 3300026116 Bacteria 8747
254 Ga0207675_100000022 3300026118 Bacteria 116711
255 Ga0207675_100011933 3300026118 Bacteria 8118
256 Ga0207675_100164661 3300026118 Bacteria 2117
257 Ga0207683_10261165 3300026121 Bacteria 1581
258 Ga0207698_10009623 3300026142 Bacteria 6171
259 Ga0207698_10060086 3300026142 Bacteria 2954
260 Ga0268266_10000832 3300028379 Bacteria 40381
261 Ga0268266_10015556 3300028379 Bacteria 6523
262 Ga0268266_10053684 3300028379 Bacteria 3463
263 Ga0268266_10109634 3300028379 Bacteria 2444
264 Ga0268266_10261824 3300028379 Bacteria 1603
265 Ga0268265_10016189 3300028380 Bacteria 5119
266 Ga0268265_10035387 3300028380 Bacteria 3648
267 Ga0268265_10081356 3300028380 Bacteria 2557
268 Ga0268265_10328864 3300028380 Unclassified 1387
269 Ga0268264_10048157 3300028381 Bacteria 3545
270 Ga0268264_10127111 3300028381 Bacteria 2254
271 Ga0268264_10151326 3300028381 Bacteria 2080
272 Ga0268264_10189303 3300028381 Bacteria 1875
273 Ga0268264_10194196 3300028381 Bacteria 1852
274 Ga0268264_10862402 3300028381 Bacteria 907
275 Ga0307517_10066935 3300028786 Bacteria 3297
276 Ga0265338_10014780 3300028800 Bacteria 8643
277 Ga0307511_10021310 3300030521 Bacteria 6107
278 Ga0307413_10266194 3300031824 Bacteria 1281
279 Ga0307406_10292931 3300031901 Bacteria 1247
280 Ga0307414_10097581 3300032004 Bacteria 2202
281 Ga0307411_10152933 3300032005 Bacteria 1717
282 Ga0307510_10001429 3300033180 Bacteria 26250
283 Ga0395899_0102403 3300037312 Bacteria 2066
284 Ga0395900_0016860 3300037418 Bacteria 7454
285 Ga0395900_0073501 3300037418 Bacteria 3515
286 Ga0395900_0490514 3300037418 Bacteria 1180
287 Ga0395900_0856610 3300037418 Bacteria 834
288 Ga0395898_0019484 3300037466 Bacteria 6904
289 Ga0395905_0001708 3300037471 Bacteria 25795
290 Ga0395905_0006483 3300037471 Bacteria 11777
291 Ga0395905_0018651 3300037471 Bacteria 6581
292 Ga0395905_0020349 3300037471 Bacteria 6286
293 Ga0395905_0066841 3300037471 Bacteria 3366
294 Ga0395905_0335308 3300037471 Bacteria 1403
295 Ga0395905_0351149 3300037471 Bacteria 1367
296 Ga0395905_0397332 3300037471 Bacteria 1273
297 Ga0395901_0023888 3300038443 Bacteria 6270
298 Ga0395901_0027343 3300038443 Bacteria 5860
299 Ga0395901_0086215 3300038443 Bacteria 3283
300 Ga0395901_0171441 3300038443 Bacteria 2277
301 Ga0436365_1064014 3300039437 Bacteria 1989
302 Ga0436365_1505547 3300039437 Bacteria 55840
303 Ga0436363_1153786 3300039450 Bacteria 2769
304 Ga0466970_0080612 3300044765 Unclassified 1759
305 Ga0466959_0450224 3300045049 Bacteria 873
306 Ga0495590_0000535 3300046457 Bacteria 18196
307 Ga0495638_0031858 3300046460 Bacteria 3385
308 Ga0495638_0041790 3300046460 Bacteria 2898
309 Ga0495650_0110512 3300046471 Bacteria 1021
310 Ga0495583_0051226 3300046506 Bacteria 1883
311 Ga0495610_0001771 3300046512 Bacteria 18879
312 Ga0495610_0063358 3300046512 Bacteria 1751
313 Ga0495616_0000026 3300046513 Bacteria 141705
314 Ga0495631_0001314 3300046518 Bacteria 15218
315 Ga0495632_0001718 3300046519 Bacteria 17806
316 Ga0495637_0012256 3300046520 Bacteria 4104
317 Ga0495643_0033612 3300046522 Bacteria 2836
318 Ga0495648_0049274 3300046524 Bacteria 2584
319 Ga0495642_0002858 3300046528 Bacteria 6892
320 Ga0495654_0062722 3300046530 Bacteria 1781
321 Ga0495622_0003459 3300046557 Bacteria 7442
322 Ga0495668_0015692 3300046616 Bacteria 4415
323 Ga0495668_0015704 3300046616 Bacteria 4413
324 Ga0495668_0064544 3300046616 Bacteria 2015
325 Ga0495668_0072216 3300046616 Bacteria 1896
326 Ga0495668_0077048 3300046616 Bacteria 1831
327 Ga0495668_0186445 3300046616 Bacteria 1136
328 Ga0495611_0150144 3300046648 Unclassified 1088
329 Ga0495625_0011163 3300046660 Bacteria 7349
330 Ga0495625_0149945 3300046660 Bacteria 1568
331 Ga0495625_0188274 3300046660 Bacteria 1368
332 Ga0495669_0010319 3300046684 Bacteria 3947
333 Ga0495669_0017978 3300046684 Bacteria 3036
334 Ga0495671_0018067 3300046692 Bacteria 3750
335 Ga0495649_0020667 3300046694 Bacteria 3690
336 Ga0495660_0003436 3300046810 Bacteria 9788
337 Ga0495672_0048142 3300047320 Bacteria 2529
338 Ga0495681_0037792 3300047470 Bacteria 2374
339 Ga0495681_0079474 3300047470 Bacteria 1467
340 Ga0495686_0001551 3300047472 Bacteria 24521
341 Ga0496107_0234912 3300048910 Bacteria 1364
342 Ga0496109_0493018 3300048912 Bacteria 1156
343 Ga0496118_0007607 3300048921 Bacteria 11419
344 Ga0496121_0000079 3300048924 Bacteria 232653
345 Ga0496121_0000797 3300048924 Bacteria 57614
346 Ga0496121_0003516 3300048924 Bacteria 22258
347 Ga0496126_0011320 3300048929 Bacteria 9253
348 Ga0496126_0083471 3300048929 Bacteria 2820
349 Ga0496126_0257086 3300048929 Bacteria 1454
350 Ga0495678_012368 3300049459 Bacteria 4050
351 Ga0501068_0205453 3300049584 Unclassified 1250
352 Ga0501044_0158260 3300049823 Bacteria 2244
353 nmdc:mga03n38_46178_c1 3300050490 Bacteria 1922
354 nmdc:mga00v17_33321_c1 3300050491 Unclassified 3052
355 nmdc:mga0k408_25_c1 3300050493 Bacteria 96034
356 nmdc:mga0k408_7084_c1 3300050493 Bacteria 5990
357 nmdc:mga07m45_132890_c1 3300050496 Bacteria 1440
358 nmdc:mga07m45_8_c1 3300050496 Bacteria 214050
359 nmdc:mga0sz30_1206_c1 3300050516 Bacteria 9271
360 Ga0500578_0000960 3300053086 Bacteria 31970
361 Ga0500643_001096 3300053087 Bacteria 16262
362 Ga0500643_005609 3300053087 Bacteria 5378
363 Ga0500644_0004425 3300053088 Bacteria 3516
364 Ga0500651_0218617 3300053093 Bacteria 1118
365 Ga0500651_0327130 3300053093 Bacteria 874
366 Ga0500556_0000076 3300053104 Bacteria 95452
367 Ga0500562_003998 3300053108 Bacteria 3717
368 Ga0500562_042531 3300053108 Bacteria 1209
369 Ga0500594_0000301 3300053118 Bacteria 11171
370 Ga0500658_0000232 3300053134 Bacteria 26163
371 Ga0500616_0003677 3300053153 Bacteria 11504
372 Ga0500622_0001594 3300053156 Bacteria 17841
373 Ga0500622_0014412 3300053156 Bacteria 4245
374 Ga0500637_0022229 3300053178 Bacteria 3454
375 Ga0500611_005308 3300053727 Bacteria 1803
376 Ga0500645_006308 3300053730 Bacteria 4249
377 Ga0500609_004950 3300053731 Bacteria 1824
378 2600204062 2599185354 Bacteria 4398675
379 2819539947 2818991435 Bacteria 5433759
380 Ga0157380_10351082
381 JGI24736J21556_1002316
382 JGI24739J22299_10013813
383 JGI24737J22298_10000889
384 JGI24743J22301_10005850
385 Ga0055526_1036942
386 Ga0055531_10000622
387 Ga0065165_1019552
388 Ga0070658_10031086
389 Ga0070658_10080617
390 Ga0070658_10086591
391 Ga0070658_10088778
392 Ga0070658_10140604
393 Ga0070658_10183248
394 Ga0070658_10189679
395 Ga0070683_100628441
396 Ga0070670_100032460
397 Ga0070670_100074422
398 Ga0068869_100054412
399 Ga0070666_10001395
400 Ga0070680_100013302
401 Ga0070682_100236097
402 Ga0070660_100211992
403 Ga0070691_10039734
404 Ga0070661_100094371
405 Ga0070661_100268591
406 Ga0070692_10044328
407 Ga0070668_100018385
408 Ga0070669_100055184
409 Ga0070669_100097265
410 Ga0070669_100133735
411 Ga0070671_100014919
412 Ga0070671_100163316
413 Ga0070671_100163417
414 Ga0070671_100269226
415 Ga0070671_100331324
416 Ga0070659_100011452
417 Ga0070659_100032817
418 Ga0070659_100062920
419 Ga0070659_100195605
420 Ga0070659_100240089
421 Ga0070667_100000112
422 Ga0070667_100008851
423 Ga0070667_100062957
424 Ga0070667_100066683
425 Ga0070667_100127915
426 Ga0070663_100009279
427 Ga0070663_100013084
428 Ga0070663_100031259
429 Ga0070663_100353937
430 Ga0070678_100209934
431 Ga0070662_100009972
432 Ga0070662_100046731
433 Ga0070662_100358014
434 Ga0070662_100488036
435 Ga0070681_10120149
436 Ga0068853_100040695
437 Ga0068853_100072020
438 Ga0068853_100118819
439 Ga0070672_100433946
440 Ga0070686_100223455
441 Ga0070693_100030465
442 Ga0070665_100008168
443 Ga0070665_100022386
444 Ga0070665_100024836
445 Ga0070665_100039252
446 Ga0070665_100077129
447 Ga0070665_100216636
448 Ga0070665_100278741
449 Ga0070664_100034160
450 Ga0068857_100060505
451 Ga0068857_100142184
452 Ga0068854_100026930
453 Ga0068854_100036839
454 Ga0068854_100160030
455 Ga0068854_100420120
456 Ga0068852_100031061
457 Ga0068852_100056814
458 Ga0068852_100352984
459 Ga0068859_100021029
460 Ga0068859_100049893
461 Ga0068859_100052448
462 Ga0068859_100366756
463 Ga0068864_100000110
464 Ga0068864_100002687
465 Ga0068864_100126791
466 Ga0068864_100164039
467 Ga0068864_100199092
468 Ga0068864_100284551
469 Ga0068861_100000023
470 Ga0068861_100013196
471 Ga0068861_100117331
472 Ga0068851_10003307
473 Ga0068851_10006341
474 Ga0068863_100000223
475 Ga0068863_100010974
476 Ga0068863_100012118
477 Ga0068863_100109343
478 Ga0068863_100167469
479 Ga0068858_100002458
480 Ga0068858_100063482
481 Ga0068858_100380526
482 Ga0068860_100007154
483 Ga0068860_100076732
484 Ga0068860_100216692
485 Ga0068860_100315594
486 Ga0068862_100019231
487 Ga0068862_100051003
488 Ga0068862_100089704
489 Ga0068862_100094994
490 Ga0075363_100001685
491 Ga0075363_100131722
492 Ga0075364_10038527
493 Ga0075362_10000003
494 Ga0075369_10004346
495 Ga0075370_10106495
496 Ga0075370_10143658
497 Ga0097620_100021031
498 Ga0097620_100049893
499 Ga0097620_100052448
500 Ga0097620_100366764
501 Ga0105251_10055311
502 Ga0105250_10004482
503 Ga0105250_10031004
504 Ga0105240_10062997
505 Ga0105240_10126383
506 Ga0105240_10430411
507 Ga0105240_10540743
508 Ga0105247_10098080
509 Ga0105243_10212923
510 Ga0105248_10006973
511 Ga0105248_10016808
512 Ga0105248_10026434
513 Ga0105248_10048415
514 Ga0105248_10174083
515 Ga0105237_10002659
516 Ga0105238_10196665
517 Ga0105249_10234893
518 Ga0105249_10412217
519 Ga0105239_10000113
520 Ga0105239_10178379
521 Ga0105239_10496527
522 Ga0105246_10062283
523 Ga0157373_10038979
524 Ga0157373_10060639
525 Ga0157373_10348628
526 Ga0157371_10074586
527 Ga0157370_10177278
528 Ga0157369_10093375
529 Ga0157374_10135693
530 Ga0163162_10031861
531 Ga0157372_10043372
532 Ga0157372_10047521
533 Ga0157372_10477176
534 Ga0157375_10139174
535 Ga0157375_10274206
536 Ga0163163_10000489
537 Ga0157379_10054486
538 Ga0163161_10419548
539 Ga0213876_10000313
540 Ga0209257_1000036
541 Ga0207656_10005007
542 Ga0207656_10005121
543 Ga0207696_1026524
544 Ga0207680_10003344
545 Ga0207647_10017378
546 Ga0207647_10029176
547 Ga0207645_10381971
548 Ga0207705_10004453
549 Ga0207705_10004761
550 Ga0207705_10016791
551 Ga0207705_10113889
552 Ga0207654_10191116
553 Ga0207707_10044815
554 Ga0207695_10067731
555 Ga0207695_10073744
556 Ga0207695_10104860
557 Ga0207695_10304557
558 Ga0207671_10002047
559 Ga0207660_10000670
560 Ga0207657_10007581
561 Ga0207657_10012838
562 Ga0207657_10018734
563 Ga0207657_10049960
564 Ga0207657_10189971
565 Ga0207649_10129571
566 Ga0207649_10207751
567 Ga0207652_10024424
568 Ga0207681_10042575
569 Ga0207650_10017192
570 Ga0207650_10021410
571 Ga0207650_10108748
572 Ga0207644_10004908
573 Ga0207644_10090430
574 Ga0207644_10092433
575 Ga0207644_10147276
576 Ga0207644_10163726
577 Ga0207644_10473893
578 Ga0207690_10002210
579 Ga0207690_10042266
580 Ga0207690_10051994
581 Ga0207690_10189224
582 Ga0207690_10306419
583 Ga0207706_10039082
584 Ga0207706_10170108
585 Ga0207709_10133072
586 Ga0207691_10041706
587 Ga0207691_10131047
588 Ga0207711_10000042
589 Ga0207711_10000552
590 Ga0207711_10034475
591 Ga0207711_10034869
592 Ga0207711_10095491
593 Ga0207689_10058784
594 Ga0207679_10039899
595 Ga0207679_10296200
596 Ga0207679_10311961
597 Ga0207667_10041925
598 Ga0207667_10043326
599 Ga0207712_10153241
600 Ga0207712_10267695
601 Ga0207712_10284192
602 Ga0207668_10033787
603 Ga0207640_10012880
604 Ga0207640_10041618
605 Ga0207640_10097498
606 Ga0207640_10097537
607 Ga0207658_10007296
608 Ga0207658_10007535
609 Ga0207658_10036993
610 Ga0207658_10051233
611 Ga0207703_10002493
612 Ga0207703_10014504
613 Ga0207703_10137347
614 Ga0207639_10071179
615 Ga0207639_10132834
616 Ga0207678_10005746
617 Ga0207678_10010821
618 Ga0207678_10011581
619 Ga0207678_10191031
620 Ga0207702_10423733
621 Ga0207641_10000134
622 Ga0207641_10000927
623 Ga0207641_10014890
624 Ga0207641_10072119
625 Ga0207648_10116522
626 Ga0207676_10000502
627 Ga0207676_10029118
628 Ga0207676_10030794
629 Ga0207676_10102726
630 Ga0207676_10642326
631 Ga0207674_10004963
632 Ga0207674_10014364
633 Ga0207675_100000022
634 Ga0207675_100011933
635 Ga0207675_100164661
636 Ga0207683_10261165
637 Ga0207698_10009623
638 Ga0207698_10060086
639 Ga0268266_10000832
640 Ga0268266_10015556
641 Ga0268266_10053684
642 Ga0268266_10109634
643 Ga0268266_10261824
644 Ga0268265_10016189
645 Ga0268265_10035387
646 Ga0268265_10081356
647 Ga0268265_10328864
648 Ga0268264_10048157
649 Ga0268264_10127111
650 Ga0268264_10151326
651 Ga0268264_10189303
652 Ga0268264_10194196
653 Ga0268264_10862402
654 Ga0307517_10066935
655 Ga0265338_10014780
656 Ga0307511_10021310
657 Ga0307413_10266194
658 Ga0307406_10292931
659 Ga0307414_10097581
660 Ga0307411_10152933
661 Ga0307510_10001429
662 Ga0395899_0102403
663 Ga0395900_0016860
664 Ga0395900_0073501
665 Ga0395900_0490514
666 Ga0395900_0856610
667 Ga0395898_0019484
668 Ga0395905_0001708
669 Ga0395905_0006483
670 Ga0395905_0018651
671 Ga0395905_0020349
672 Ga0395905_0066841
673 Ga0395905_0335308
674 Ga0395905_0351149
675 Ga0395905_0397332
676 Ga0395901_0023888
677 Ga0395901_0027343
678 Ga0395901_0086215
679 Ga0395901_0171441
680 Ga0436365_1064014
681 Ga0436365_1505547
682 Ga0436363_1153786
683 Ga0466970_0080612
684 Ga0466959_0450224
685 Ga0495590_0000535
686 Ga0495638_0031858
687 Ga0495638_0041790
688 Ga0495650_0110512
689 Ga0495583_0051226
690 Ga0495610_0001771
691 Ga0495610_0063358
692 Ga0495616_0000026
693 Ga0495631_0001314
694 Ga0495632_0001718
695 Ga0495637_0012256
696 Ga0495643_0033612
697 Ga0495648_0049274
698 Ga0495642_0002858
699 Ga0495654_0062722
700 Ga0495622_0003459
701 Ga0495668_0015692
702 Ga0495668_0015704
703 Ga0495668_0064544
704 Ga0495668_0072216
705 Ga0495668_0077048
706 Ga0495668_0186445
707 Ga0495611_0150144
708 Ga0495625_0011163
709 Ga0495625_0149945
710 Ga0495625_0188274
711 Ga0495669_0010319
712 Ga0495669_0017978
713 Ga0495671_0018067
714 Ga0495649_0020667
715 Ga0495660_0003436
716 Ga0495672_0048142
717 Ga0495681_0037792
718 Ga0495681_0079474
719 Ga0495686_0001551
720 Ga0496107_0234912
721 Ga0496109_0493018
722 Ga0496118_0007607
723 Ga0496121_0000079
724 Ga0496121_0000797
725 Ga0496121_0003516
726 Ga0496126_0011320
727 Ga0496126_0083471
728 Ga0496126_0257086
729 Ga0495678_012368
730 Ga0501068_0205453
731 Ga0501044_0158260
732 nmdc:mga03n38_46178_c1
733 nmdc:mga00v17_33321_c1
734 nmdc:mga0k408_25_c1
735 nmdc:mga0k408_7084_c1
736 nmdc:mga07m45_132890_c1
737 nmdc:mga07m45_8_c1
738 nmdc:mga0sz30_1206_c1
739 Ga0500578_0000960
740 Ga0500643_001096
741 Ga0500643_005609
742 Ga0500644_0004425
743 Ga0500651_0218617
744 Ga0500651_0327130
745 Ga0500556_0000076
746 Ga0500562_003998
747 Ga0500562_042531
748 Ga0500594_0000301
749 Ga0500658_0000232
750 Ga0500616_0003677
751 Ga0500622_0001594
752 Ga0500622_0014412
753 Ga0500637_0022229
754 Ga0500611_005308
755 Ga0500645_006308
756 Ga0500609_004950
757 2600204062
758 2819539947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

20

236

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.6111 11 230
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.5654 11 230
6wm5-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii 0.3668 16 233
2jif-assembly1.cif.gz_D structure of human short-branched chain acyl-coa dehydrogenase (acadsb) 0.3557 87 225
6wm5-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii 0.305 16 233
ID Description Score Start End Superfamily
af_G5EEQ9_4_113_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.4408 109 234 1.20.120.550
af_G5EEQ9_4_113_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.43 109 234 1.20.120.550
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.4063 49 177 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.4031 49 177 1.10.3730.20
af_Q2FZ11_2_191_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.3892 83 233 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A537ME35-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9926 1 233 GO:0005886
GO:0008961
GO:0042158
AF-A0A255Y8H6-F1-model_v4 Diacylglyceryl transferase 0.9925 1 232 GO:0005886
GO:0008961
GO:0042158
AF-A0A1G5USW6-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9897 1 232 GO:0005886
GO:0008961
GO:0042158
AF-A0A5C6TX00-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9865 38 233 GO:0005886
GO:0008961
GO:0042158
AF-A0A4Q3SGF1-F1-model_v4 Diacylglyceryl transferase 0.9809 105 232 GO:0005886
GO:0008961
GO:0042158

Map