metagRoot

F428343

General Info

Members	Datasets	Scaffolds	Average Seq Length
379	238	379	119

Family's Representative Sequence

Representative Sequence	3300009147\|Ga0114129_10216383\|Ga0114129_102163832
Length	134
Sequence	VFPFIVSFREHLMAIIGMHALIYSKKDEATRAFFRDVLGFPAVDAGRGWLIFAAPPAELAVHPAEGEAEGDEFHELYLMCDDIEATVADLKRKGVSTGAIQEQPWGRVTQIALPSGDELGLYEPRHPTAIGMPR

Samples

	Sample ID	Description	Type	Environment
1	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
2	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
3	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
4	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
5	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
6	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
7	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
8	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
9	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
10	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
11	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
12	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
13	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
14	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
15	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
16	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
17	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
18	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
19	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
20	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
21	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
22	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
23	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
26	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
27	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
28	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
29	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
30	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
31	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
32	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
33	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
34	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
35	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
36	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
37	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
38	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
39	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
40	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
41	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
42	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
43	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
44	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
45	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
46	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
47	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
48	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
49	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
50	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
53	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
54	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
55	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
56	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
57	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
58	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
59	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
60	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
61	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
62	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
63	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
64	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
65	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
66	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
67	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
68	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
69	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
70	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
71	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
72	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
74	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
75	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
76	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
77	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
78	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
79	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
80	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
81	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
82	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
85	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
86	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
88	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
89	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
90	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
91	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
92	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
93	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
94	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
95	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
96	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
97	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
98	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
99	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
100	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
101	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
102	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
103	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
104	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
105	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
106	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
107	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
108	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
109	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
110	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
111	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
112	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
152	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
153	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
156	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
157	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
158	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
159	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
160	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
161	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
162	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
163	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
164	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
165	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
166	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
167	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
168	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
169	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
170	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
171	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
172	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
173	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
174	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
175	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
176	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
177	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
178	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
179	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
180	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
181	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
182	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
183	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
184	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
185	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
186	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
187	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
188	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
189	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
190	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
191	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
192	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
193	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
194	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
195	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
196	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
197	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
198	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
199	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
200	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
201	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
202	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
203	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
204	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
205	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
206	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
207	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
208	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
209	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
210	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
211	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
212	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
213	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
214	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
215	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
216	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
217	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
218	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
219	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
220	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
221	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
222	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
223	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
224	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
225	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
226	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
227	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
228	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
229	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
230	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
231	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
232	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
233	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
234	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
235	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
236	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
237	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
238	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.8
Nodule	0
Rhizoplane	2.11
Rhizosphere	92.08
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065712_10070920	3300005290	Bacteria	5602
2	Ga0065712_10203148	3300005290	Bacteria	1100
3	Ga0065715_10012696	3300005293	Bacteria	1960
4	Ga0065715_10116664	3300005293	Unclassified	2373
5	Ga0065707_10086329	3300005295	Bacteria	5531
6	Ga0065707_10120670	3300005295	Bacteria	2116
7	Ga0065707_10638138	3300005295	Unclassified	669
8	Ga0070683_100009043	3300005329	Bacteria	8501
9	Ga0070683_100030813	3300005329	Bacteria	4874
10	Ga0070683_100235053	3300005329	Bacteria	1743
11	Ga0070683_100516198	3300005329	Unclassified	1142
12	Ga0070690_100031971	3300005330	Unclassified	3283
13	Ga0070690_100218567	3300005330	Bacteria	1334
14	Ga0070670_100024955	3300005331	Bacteria	5143
15	Ga0070670_100135941	3300005331	Unclassified	2124
16	Ga0070670_101556385	3300005331	Unclassified	607
17	Ga0070677_10229031	3300005333	Bacteria	912
18	Ga0068869_100018140	3300005334	Bacteria	4785
19	Ga0070666_10469548	3300005335	Bacteria	910
20	Ga0070680_101662706	3300005336	Unclassified	553
21	Ga0070682_100003786	3300005337	Bacteria	8408
22	Ga0068868_100058571	3300005338	Bacteria	3045
23	Ga0070660_100141744	3300005339	Bacteria	1929
24	Ga0070689_100050534	3300005340	Unclassified	3213
25	Ga0070689_100803730	3300005340	Bacteria	827
26	Ga0070689_101263569	3300005340	Unclassified	664
27	Ga0070691_10163773	3300005341	Bacteria	1148
28	Ga0070687_100752300	3300005343	Bacteria	686
29	Ga0070661_100004715	3300005344	Bacteria	9382
30	Ga0070661_100394501	3300005344	Bacteria	1093
31	Ga0070692_10001012	3300005345	Bacteria	9672
32	Ga0070692_10257008	3300005345	Unclassified	1048
33	Ga0070669_100001950	3300005353	Bacteria	14896
34	Ga0070675_100028354	3300005354	Bacteria	4506
35	Ga0070675_100042800	3300005354	Bacteria	3701
36	Ga0070671_100344143	3300005355	Bacteria	1272
37	Ga0070673_100566466	3300005364	Bacteria	1033
38	Ga0070688_100092620	3300005365	Unclassified	1977
39	Ga0070688_100751202	3300005365	Unclassified	759
40	Ga0070659_100014062	3300005366	Bacteria	5972
41	Ga0070667_100929938	3300005367	Unclassified	810
42	Ga0070709_10125644	3300005434	Unclassified	1745
43	Ga0070714_101555129	3300005435	Unclassified	646
44	Ga0070713_100002737	3300005436	Bacteria	11520
45	Ga0070701_10014918	3300005438	Unclassified	3573
46	Ga0070711_100178852	3300005439	Unclassified	1623
47	Ga0070711_100747450	3300005439	Bacteria	826
48	Ga0070705_101640510	3300005440	Unclassified	542
49	Ga0070694_100771695	3300005444	Unclassified	786
50	Ga0070708_100000951	3300005445	Bacteria	21957
51	Ga0070678_100111036	3300005456	Unclassified	2145
52	Ga0070662_100003656	3300005457	Bacteria	9604
53	Ga0070681_10006300	3300005458	Bacteria	11533
54	Ga0068867_100215816	3300005459	Bacteria	1543
55	Ga0070685_10232989	3300005466	Bacteria	1212
56	Ga0070706_100676278	3300005467	Bacteria	958
57	Ga0070707_100149081	3300005468	Bacteria	2277
58	Ga0070707_100157419	3300005468	Bacteria	2213
59	Ga0070698_100172516	3300005471	Bacteria	2103
60	Ga0070698_100210268	3300005471	Bacteria	1880
61	Ga0070698_100444697	3300005471	Bacteria	1231
62	Ga0070699_100743240	3300005518	Unclassified	897
63	Ga0070679_100006900	3300005530	Bacteria	10589
64	Ga0070684_100005500	3300005535	Bacteria	9713
65	Ga0070684_100103408	3300005535	Bacteria	2548
66	Ga0070684_100138142	3300005535	Bacteria	2202
67	Ga0070684_100223216	3300005535	Unclassified	1719
68	Ga0070684_100274664	3300005535	Unclassified	1543
69	Ga0068853_100248623	3300005539	Bacteria	1631
70	Ga0070672_100094915	3300005543	Unclassified	2412
71	Ga0070672_101340083	3300005543	Unclassified	639
72	Ga0070686_101940302	3300005544	Bacteria	503
73	Ga0070695_100358264	3300005545	Bacteria	1095
74	Ga0070693_100002418	3300005547	Bacteria	8588
75	Ga0070693_101132979	3300005547	Bacteria	598
76	Ga0070704_100826678	3300005549	Unclassified	829
77	Ga0068855_100051555	3300005563	Bacteria	4848
78	Ga0070664_100004723	3300005564	Bacteria	10927
79	Ga0070664_100525417	3300005564	Bacteria	1093
80	Ga0070664_100659384	3300005564	Unclassified	973
81	Ga0068857_100012158	3300005577	Bacteria	7488
82	Ga0068854_100772843	3300005578	Unclassified	835
83	Ga0068856_100024810	3300005614	Bacteria	5840
84	Ga0068856_100049374	3300005614	Bacteria	4147
85	Ga0068856_100112618	3300005614	Unclassified	2719
86	Ga0070702_100001013	3300005615	Bacteria	11130
87	Ga0068852_100177629	3300005616	Bacteria	2000
88	Ga0068859_100107388	3300005617	Bacteria	2851
89	Ga0068864_100011295	3300005618	Bacteria	7377
90	Ga0068864_100055142	3300005618	Bacteria	3431
91	Ga0068870_10356138	3300005840	Unclassified	940
92	Ga0068870_10641703	3300005840	Unclassified	726
93	Ga0068863_100004917	3300005841	Bacteria	13170
94	Ga0068858_100124087	3300005842	Bacteria	2417
95	Ga0068858_100267251	3300005842	Unclassified	1627
96	Ga0068858_100272734	3300005842	Bacteria	1610
97	Ga0068860_100008601	3300005843	Bacteria	10176
98	Ga0068862_100003981	3300005844	Bacteria	12539
99	Ga0081538_10014986	3300005981	Bacteria	6032
100	Ga0075365_10985837	3300006038	Bacteria	594
101	Ga0075365_11112598	3300006038	Bacteria	556
102	Ga0075368_10013975	3300006042	Bacteria	2956
103	Ga0075364_10002882	3300006051	Bacteria	9695
104	Ga0075364_10007796	3300006051	Bacteria	6377
105	Ga0075364_10126638	3300006051	Bacteria	1713
106	Ga0070712_100350430	3300006175	Bacteria	1208
107	Ga0075367_10031073	3300006178	Bacteria	3066
108	Ga0075367_10209701	3300006178	Bacteria	1218
109	Ga0075369_10007524	3300006186	Bacteria	4153
110	Ga0097621_100259710	3300006237	Unclassified	1523
111	Ga0075370_10047518	3300006353	Bacteria	2430
112	Ga0068871_100226986	3300006358	Bacteria	1620
113	Ga0075428_100008371	3300006844	Bacteria	11467
114	Ga0075428_102513404	3300006844	Unclassified	527
115	Ga0075431_100044732	3300006847	Bacteria	4565
116	Ga0075433_10101366	3300006852	Bacteria	2549
117	Ga0075434_100048195	3300006871	Unclassified	4228
118	Ga0075429_100515328	3300006880	Bacteria	1048
119	Ga0068865_100743041	3300006881	Bacteria	842
120	Ga0075436_100473414	3300006914	Unclassified	914
121	Ga0097620_100107384	3300006931	Bacteria	2851
122	Ga0111539_10000245	3300009094	Bacteria	65047
123	Ga0111539_10019011	3300009094	Bacteria	8494
124	Ga0111539_11466174	3300009094	Unclassified	791
125	Ga0111539_11523016	3300009094	Unclassified	776
126	Ga0105245_10102973	3300009098	Bacteria	2644
127	Ga0105245_11420541	3300009098	Bacteria	744
128	Ga0105247_10374372	3300009101	Unclassified	1008
129	Ga0114129_10142076	3300009147	Bacteria	3289
130	Ga0114129_10216383	3300009147	Bacteria	2587
131	Ga0114129_10827047	3300009147	Bacteria	1179
132	Ga0114129_12396623	3300009147	Unclassified	632
133	Ga0105243_10347364	3300009148	Bacteria	1361
134	Ga0105243_11280051	3300009148	Unclassified	750
135	Ga0105241_10127158	3300009174	Bacteria	2059
136	Ga0105241_10316025	3300009174	Unclassified	1345
137	Ga0105242_10026697	3300009176	Bacteria	4578
138	Ga0105242_10061278	3300009176	Unclassified	3094
139	Ga0105248_10004214	3300009177	Bacteria	15907
140	Ga0105248_10108699	3300009177	Unclassified	3127
141	Ga0105237_10901570	3300009545	Bacteria	891
142	Ga0105238_10059102	3300009551	Unclassified	3842
143	Ga0105238_10142549	3300009551	Bacteria	2373
144	Ga0105238_10365683	3300009551	Bacteria	1432
145	Ga0105249_10000683	3300009553	Bacteria	30864
146	Ga0105249_10069342	3300009553	Bacteria	3254
147	Ga0105249_11926348	3300009553	Bacteria	664
148	Ga0105249_12961439	3300009553	Bacteria	545
149	Ga0105239_10010261	3300010375	Bacteria	10489
150	Ga0105246_10001150	3300011119	Bacteria	15343
151	Ga0157373_10012305	3300013100	Bacteria	6292
152	Ga0157371_10004609	3300013102	Bacteria	11966
153	Ga0157370_10144339	3300013104	Unclassified	2217
154	Ga0157370_11972139	3300013104	Unclassified	524
155	Ga0157369_10221131	3300013105	Unclassified	1982
156	Ga0157369_11362017	3300013105	Bacteria	723
157	Ga0157374_10013386	3300013296	Bacteria	7161
158	Ga0157378_11402857	3300013297	Bacteria	741
159	Ga0163162_11276827	3300013306	Unclassified	834
160	Ga0163162_11998791	3300013306	Bacteria	664
161	Ga0157372_10026715	3300013307	Bacteria	6283
162	Ga0157372_10718592	3300013307	Bacteria	1162
163	Ga0157375_10112247	3300013308	Bacteria	2826
164	Ga0157375_10420786	3300013308	Bacteria	1502
165	Ga0163163_10052106	3300014325	Unclassified	4036
166	Ga0163163_10100478	3300014325	Bacteria	2915
167	Ga0157380_10382278	3300014326	Bacteria	1329
168	Ga0157380_11815522	3300014326	Unclassified	669
169	Ga0157377_10017747	3300014745	Bacteria	3687
170	Ga0157377_10354608	3300014745	Unclassified	985
171	Ga0157379_10093898	3300014968	Bacteria	2691
172	Ga0157379_10498199	3300014968	Bacteria	1129
173	Ga0157376_10009862	3300014969	Bacteria	6962
174	Ga0182005_1121494	3300015265	Bacteria	744
175	Ga0163161_10695973	3300017792	Bacteria	846
176	Ga0207653_10236983	3300025885	Unclassified	696
177	Ga0207688_10072247	3300025901	Bacteria	1959
178	Ga0207699_10096849	3300025906	Unclassified	1863
179	Ga0207654_10097618	3300025911	Bacteria	1804
180	Ga0207707_10029989	3300025912	Bacteria	4755
181	Ga0207663_11053571	3300025916	Bacteria	653
182	Ga0207660_10486860	3300025917	Bacteria	1000
183	Ga0207662_10074067	3300025918	Bacteria	2066
184	Ga0207657_10097628	3300025919	Bacteria	2442
185	Ga0207649_10002771	3300025920	Bacteria	9689
186	Ga0207652_10062103	3300025921	Bacteria	3228
187	Ga0207646_10062119	3300025922	Bacteria	3335
188	Ga0207681_10208422	3300025923	Bacteria	1505
189	Ga0207681_10419078	3300025923	Unclassified	1084
190	Ga0207694_10786421	3300025924	Bacteria	804
191	Ga0207650_10238317	3300025925	Unclassified	1469
192	Ga0207650_10739142	3300025925	Bacteria	832
193	Ga0207650_11590753	3300025925	Unclassified	555
194	Ga0207659_10072271	3300025926	Bacteria	2521
195	Ga0207659_10125306	3300025926	Unclassified	1975
196	Ga0207687_11337634	3300025927	Bacteria	616
197	Ga0207700_10041530	3300025928	Unclassified	3366
198	Ga0207644_10404196	3300025931	Bacteria	1117
199	Ga0207706_10009079	3300025933	Bacteria	9143
200	Ga0207686_10021241	3300025934	Bacteria	3723
201	Ga0207686_10485394	3300025934	Bacteria	956
202	Ga0207670_10434883	3300025936	Bacteria	1055
203	Ga0207670_10473126	3300025936	Bacteria	1013
204	Ga0207670_11068228	3300025936	Unclassified	681
205	Ga0207691_10139403	3300025940	Unclassified	2138
206	Ga0207691_11001198	3300025940	Unclassified	697
207	Ga0207711_10062483	3300025941	Bacteria	3212
208	Ga0207689_10000825	3300025942	Bacteria	29884
209	Ga0207661_10001898	3300025944	Bacteria	14342
210	Ga0207661_10097758	3300025944	Unclassified	2459
211	Ga0207679_10004982	3300025945	Bacteria	8291
212	Ga0207679_10750636	3300025945	Bacteria	887
213	Ga0207667_10940107	3300025949	Unclassified	854
214	Ga0207651_10506579	3300025960	Bacteria	1044
215	Ga0207712_10006106	3300025961	Bacteria	7603
216	Ga0207712_10492865	3300025961	Bacteria	1046
217	Ga0207712_11376177	3300025961	Bacteria	631
218	Ga0207668_11796866	3300025972	Unclassified	553
219	Ga0207703_10253998	3300026035	Bacteria	1586
220	Ga0207703_10298091	3300026035	Bacteria	1469
221	Ga0207703_10509790	3300026035	Bacteria	1130
222	Ga0207639_11742046	3300026041	Unclassified	583
223	Ga0207708_10300038	3300026075	Bacteria	1306
224	Ga0207708_10924780	3300026075	Unclassified	755
225	Ga0207702_10003730	3300026078	Bacteria	13776
226	Ga0207702_10123205	3300026078	Unclassified	2323
227	Ga0207702_11175734	3300026078	Bacteria	761
228	Ga0207641_10021607	3300026088	Bacteria	5287
229	Ga0207676_10003504	3300026095	Bacteria	11105
230	Ga0207676_10688542	3300026095	Bacteria	989
231	Ga0207674_10000256	3300026116	Bacteria	66474
232	Ga0207698_10099936	3300026142	Bacteria	2401
233	Ga0207698_10386269	3300026142	Unclassified	1333
234	Ga0209813_10030985	3300027866	Unclassified	1576
235	Ga0207428_10020179	3300027907	Bacteria	5666
236	Ga0268265_10007416	3300028380	Bacteria	7410
237	Ga0268264_10416804	3300028381	Bacteria	1294
238	Ga0373926_0364344	3300035083	Unclassified	568
239	Ga0373929_0000011	3300035085	Bacteria	190392
240	Ga0373934_0003314	3300035086	Bacteria	5894
241	Ga0373934_0010773	3300035086	Unclassified	3434
242	Ga0373923_0002572	3300035111	Bacteria	5620
243	Ga0373941_0183175	3300035115	Bacteria	787
244	Ga0373953_0202167	3300035117	Bacteria	859
245	Ga0373953_0287054	3300035117	Unclassified	717
246	Ga0373954_0050037	3300035118	Bacteria	1960
247	Ga0373954_0613499	3300035118	Unclassified	539
248	Ga0373956_0381468	3300035119	Unclassified	672
249	Ga0373957_0115331	3300035120	Unclassified	1084
250	Ga0373943_0549485	3300035170	Bacteria	678
251	Ga0373946_0272907	3300035171	Bacteria	830
252	Ga0373955_0038059	3300035172	Bacteria	2561
253	Ga0373955_0040040	3300035172	Unclassified	2504
254	Ga0373924_0311873	3300035410	Unclassified	699
255	Ga0373931_0003372	3300035691	Bacteria	7166
256	Ga0373935_0083953	3300035692	Unclassified	2074
257	Ga0373935_0346824	3300035692	Unclassified	1058
258	Ga0373927_0045049	3300035695	Bacteria	2854
259	Ga0373927_0050336	3300035695	Bacteria	2694
260	Ga0373927_0072324	3300035695	Bacteria	2231
261	Ga0373933_0010194	3300035724	Bacteria	5147
262	Ga0373933_0020925	3300035724	Unclassified	3710
263	Ga0373933_1078233	3300035724	Bacteria	529
264	Ga0373947_0189001	3300035725	Bacteria	1343
265	Ga0373937_0002000	3300036401	Bacteria	17046
266	Ga0373937_0003231	3300036401	Bacteria	13658
267	Ga0373937_0007000	3300036401	Bacteria	9734
268	Ga0373937_0914909	3300036401	Bacteria	826
269	Ga0373937_0974353	3300036401	Bacteria	797
270	Ga0466963_0322402	3300044694	Unclassified	1087
271	Ga0451576_0440540	3300045051	Bacteria	1367
272	Ga0451576_0464707	3300045051	Bacteria	1329
273	Ga0451576_0560315	3300045051	Bacteria	1201
274	Ga0466967_0111252	3300045976	Bacteria	2517
275	Ga0495592_0079751	3300046454	Unclassified	2369
276	Ga0495603_0388784	3300046455	Unclassified	800
277	Ga0495629_0047641	3300046459	Bacteria	3007
278	Ga0495629_0089559	3300046459	Bacteria	2146
279	Ga0495638_0127778	3300046460	Bacteria	1496
280	Ga0495651_0014779	3300046462	Bacteria	6036
281	Ga0495651_0177228	3300046462	Bacteria	1512
282	Ga0495653_0151102	3300046463	Bacteria	1622
283	Ga0495653_0326462	3300046463	Unclassified	993
284	Ga0495653_0696913	3300046463	Bacteria	617
285	Ga0495580_0008420	3300046472	Bacteria	8205
286	Ga0495580_0201164	3300046472	Bacteria	1372
287	Ga0495580_0224995	3300046472	Unclassified	1289
288	Ga0495582_0108311	3300046473	Bacteria	1560
289	Ga0495639_0028798	3300046475	Bacteria	2462
290	Ga0495639_0138730	3300046475	Bacteria	1168
291	Ga0495664_0041346	3300046477	Bacteria	2727
292	Ga0495594_0006066	3300046499	Bacteria	6210
293	Ga0495594_0007640	3300046499	Bacteria	5562
294	Ga0495594_0185504	3300046499	Bacteria	1185
295	Ga0495608_0010513	3300046511	Bacteria	6458
296	Ga0495608_0464468	3300046511	Unclassified	769
297	Ga0495618_0047263	3300046514	Bacteria	2717
298	Ga0495628_0017478	3300046516	Bacteria	5972
299	Ga0495628_0023973	3300046516	Bacteria	5001
300	Ga0495628_0661035	3300046516	Bacteria	741
301	Ga0495630_0062233	3300046517	Bacteria	2803
302	Ga0495630_0280285	3300046517	Bacteria	1273
303	Ga0495630_0792846	3300046517	Unclassified	723
304	Ga0495666_0120385	3300046526	Bacteria	1230
305	Ga0495652_0120770	3300046529	Bacteria	2090
306	Ga0495640_0249837	3300046533	Bacteria	1111
307	Ga0495586_0262460	3300046535	Unclassified	986
308	Ga0495587_0001345	3300046536	Bacteria	16323
309	Ga0495587_0002107	3300046536	Bacteria	13292
310	Ga0495645_0000591	3300046543	Bacteria	24957
311	Ga0495645_0059771	3300046543	Bacteria	2763
312	Ga0495633_0393321	3300046558	Unclassified	627
313	Ga0495667_0001064	3300046559	Bacteria	17851
314	Ga0495667_0088654	3300046559	Bacteria	2005
315	Ga0495667_0122993	3300046559	Bacteria	1675
316	Ga0495667_0137296	3300046559	Bacteria	1576
317	Ga0495634_0028366	3300046642	Bacteria	3886
318	Ga0495588_0068057	3300046674	Bacteria	1849
319	Ga0495657_0032040	3300046675	Bacteria	3672
320	Ga0495599_0003629	3300046678	Bacteria	9057
321	Ga0495623_0002264	3300046679	Bacteria	12809
322	Ga0495623_0002466	3300046679	Bacteria	12279
323	Ga0495623_0056320	3300046679	Bacteria	2475
324	Ga0495658_0064202	3300046683	Bacteria	2115
325	Ga0495658_0102285	3300046683	Bacteria	1712
326	Ga0495600_0094476	3300046809	Bacteria	1950
327	Ga0495581_0374824	3300047315	Bacteria	830
328	Ga0495581_0615981	3300047315	Bacteria	628
329	Ga0495604_0299625	3300047317	Bacteria	1080
330	Ga0495604_0336587	3300047317	Unclassified	1006
331	Ga0495674_0211420	3300047319	Unclassified	1606
332	Ga0495675_0001134	3300047444	Bacteria	16185
333	Ga0495675_0001396	3300047444	Bacteria	14640
334	Ga0495675_0005472	3300047444	Bacteria	7747
335	Ga0495684_0003259	3300047471	Bacteria	12756
336	Ga0495684_0005039	3300047471	Bacteria	10309
337	Ga0495684_0088019	3300047471	Bacteria	2354
338	Ga0495684_0215619	3300047471	Unclassified	1409
339	Ga0495602_0003596	3300048088	Bacteria	16052
340	Ga0495602_0016792	3300048088	Bacteria	7348
341	Ga0496102_0059625	3300048905	Bacteria	3490
342	Ga0496104_0339650	3300048907	Bacteria	1415
343	Ga0496104_0697719	3300048907	Bacteria	923
344	Ga0496108_0569027	3300048911	Unclassified	988
345	Ga0496109_0011273	3300048912	Bacteria	7677
346	Ga0496110_0514100	3300048913	Unclassified	1090
347	Ga0496112_0007756	3300048915	Bacteria	9552
348	Ga0496113_0262589	3300048916	Unclassified	1379
349	nmdc:mga03683_224307_c1	3300050489	Bacteria	868
350	nmdc:mga03n38_28155_c1	3300050490	Bacteria	2339
351	nmdc:mga03n38_940152_c1	3300050490	Bacteria	510
352	nmdc:mga00v17_1401_c1	3300050491	Bacteria	12640
353	nmdc:mga00v17_26090_c1	3300050491	Bacteria	3401
354	nmdc:mga00v17_94575_c1	3300050491	Bacteria	1880
355	nmdc:mga0yw44_255977_c1	3300050492	Bacteria	1166
356	nmdc:mga06z11_195363_c1	3300050494	Unclassified	1173
357	nmdc:mga04h51_43427_c1	3300050495	Unclassified	1479
358	nmdc:mga07m45_14628_c1	3300050496	Bacteria	4184
359	nmdc:mga05p37_1050591_c1	3300050507	Unclassified	859
360	nmdc:mga05p37_33802_c1	3300050507	Bacteria	5260
361	nmdc:mga09592_181997_c1	3300050508	Unclassified	1818
362	nmdc:mga09592_487421_c1	3300050508	Bacteria	1062
363	nmdc:mga09592_655285_c1	3300050508	Unclassified	896
364	nmdc:mga06r32_13366_c1	3300050510	Bacteria	7434
365	nmdc:mga08y16_129501_c1	3300050511	Bacteria	2625
366	nmdc:mga08y16_185100_c1	3300050511	Unclassified	2162
367	nmdc:mga0n895_137269_c1	3300050512	Unclassified	2472
368	nmdc:mga0n895_41673_c1	3300050512	Bacteria	3013
369	nmdc:mga08x19_991702_c1	3300050514	Unclassified	597
370	nmdc:mga0a205_31325_c1	3300050515	Bacteria	5095
371	nmdc:mga0sz30_13851_c1	3300050516	Bacteria	3165
372	Ga0495601_0010964	3300053077	Bacteria	5412
373	Ga0495601_0623509	3300053077	Unclassified	691
374	Ga0495612_0029121	3300053078	Bacteria	2223
375	Ga0495595_0245427	3300053084	Unclassified	896
376	Ga0495595_0482255	3300053084	Unclassified	631
377	Ga0495619_0099901	3300053085	Unclassified	1974
378	Ga0495619_0364671	3300053085	Bacteria	999
379	Ga0495619_0614107	3300053085	Unclassified	743

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005329	Ga0070683_100009043	Ga0070683_1000090436	111
2	3300005330	Ga0070690_100031971	Ga0070690_1000319711	111
3	3300005331	Ga0070670_100024955	Ga0070670_1000249555	111
4	3300005334	Ga0068869_100018140	Ga0068869_1000181405	111
5	3300005337	Ga0070682_100003786	Ga0070682_1000037862	111
6	3300005338	Ga0068868_100058571	Ga0068868_1000585711	111
7	3300005339	Ga0070660_100141744	Ga0070660_1001417442	111
8	3300005340	Ga0070689_100050534	Ga0070689_1000505344	111
9	3300005341	Ga0070691_10163773	Ga0070691_101637732	111
10	3300005344	Ga0070661_100004715	Ga0070661_1000047156	111
11	3300005354	Ga0070675_100028354	Ga0070675_1000283543	111
12	3300005364	Ga0070673_100566466	Ga0070673_1005664662	111
13	3300005366	Ga0070659_100014062	Ga0070659_1000140625	111
14	3300005367	Ga0070667_100929938	Ga0070667_1009299381	111
15	3300005456	Ga0070678_100111036	Ga0070678_1001110363	111
16	3300005457	Ga0070662_100003656	Ga0070662_1000036566	111
17	3300005458	Ga0070681_10006300	Ga0070681_100063002	111
18	3300005518	Ga0070699_100743240	Ga0070699_1007432402	111
19	3300005530	Ga0070679_100006900	Ga0070679_1000069008	111
20	3300005535	Ga0070684_100005500	Ga0070684_1000055007	111
21	3300005539	Ga0068853_100248623	Ga0068853_1002486232	111
22	3300005543	Ga0070672_101340083	Ga0070672_1013400832	111
23	3300005544	Ga0070686_101940302	Ga0070686_1019403021	111
24	3300005547	Ga0070693_100002418	Ga0070693_1000024183	111
25	3300005563	Ga0068855_100051555	Ga0068855_1000515553	111
26	3300005564	Ga0070664_100004723	Ga0070664_1000047233	111
27	3300005577	Ga0068857_100012158	Ga0068857_1000121584	111
28	3300005614	Ga0068856_100024810	Ga0068856_1000248105	111
29	3300005615	Ga0070702_100001013	Ga0070702_1000010137	111
30	3300005616	Ga0068852_100177629	Ga0068852_1001776293	111
31	3300005617	Ga0068859_100107388	Ga0068859_1001073882	111
32	3300005618	Ga0068864_100011295	Ga0068864_1000112954	111
33	3300005841	Ga0068863_100004917	Ga0068863_10000491710	111
34	3300005842	Ga0068858_100272734	Ga0068858_1002727342	111
35	3300005843	Ga0068860_100008601	Ga0068860_1000086016	111
36	3300006237	Ga0097621_100259710	Ga0097621_1002597101	111
37	3300006358	Ga0068871_100226986	Ga0068871_1002269861	111
38	3300006914	Ga0075436_100473414	Ga0075436_1004734142	111
39	3300006931	Ga0097620_100107384	Ga0097620_1001073842	111
40	3300013100	Ga0157373_10012305	Ga0157373_100123052	111
41	3300013296	Ga0157374_10013386	Ga0157374_100133862	111
42	3300013306	Ga0163162_11276827	Ga0163162_112768272	111
43	3300025911	Ga0207654_10097618	Ga0207654_100976183	111
44	3300025912	Ga0207707_10029989	Ga0207707_100299892	111
45	3300025917	Ga0207660_10486860	Ga0207660_104868601	111
46	3300025918	Ga0207662_10074067	Ga0207662_100740671	111
47	3300025919	Ga0207657_10097628	Ga0207657_100976282	111
48	3300025920	Ga0207649_10002771	Ga0207649_100027716	111
49	3300025921	Ga0207652_10062103	Ga0207652_100621031	111
50	3300025924	Ga0207694_10786421	Ga0207694_107864211	111
51	3300025925	Ga0207650_10739142	Ga0207650_107391422	111
52	3300025926	Ga0207659_10072271	Ga0207659_100722713	111
53	3300025933	Ga0207706_10009079	Ga0207706_100090796	111
54	3300025934	Ga0207686_10485394	Ga0207686_104853942	111
55	3300025936	Ga0207670_10434883	Ga0207670_104348832	111
56	3300025940	Ga0207691_11001198	Ga0207691_110011982	111
57	3300025941	Ga0207711_10062483	Ga0207711_100624832	111
58	3300025942	Ga0207689_10000825	Ga0207689_100008256	111
59	3300025944	Ga0207661_10001898	Ga0207661_100018984	111
60	3300025945	Ga0207679_10004982	Ga0207679_100049825	111
61	3300025949	Ga0207667_10940107	Ga0207667_109401071	111
62	3300025960	Ga0207651_10506579	Ga0207651_105065792	111
63	3300026035	Ga0207703_10298091	Ga0207703_102980912	111
64	3300026041	Ga0207639_11742046	Ga0207639_117420462	111
65	3300026078	Ga0207702_10003730	Ga0207702_100037307	111
66	3300026088	Ga0207641_10021607	Ga0207641_100216073	111
67	3300026095	Ga0207676_10003504	Ga0207676_100035044	111
68	3300026116	Ga0207674_10000256	Ga0207674_1000025647	111
69	3300026142	Ga0207698_10099936	Ga0207698_100999362	111
70	3300028381	Ga0268264_10416804	Ga0268264_104168041	111
71	3300046460	Ga0495638_0127778	Ga0495638_0127778_722_1087	111
72	3300053084	Ga0495595_0482255	Ga0495595_0482255_277_618	111
73	3300005468	Ga0070707_100157419	Ga0070707_1001574191	114
74	3300035724	Ga0373933_1078233	Ga0373933_1078233_108_452	114
75	3300036401	Ga0373937_0914909	Ga0373937_0914909_268_612	114
76	3300005435	Ga0070714_101555129	Ga0070714_1015551292	115
77	3300006051	Ga0075364_10002882	Ga0075364_100028828	115
78	3300006175	Ga0070712_100350430	Ga0070712_1003504301	115
79	3300006178	Ga0075367_10209701	Ga0075367_102097011	115
80	3300006186	Ga0075369_10007524	Ga0075369_100075244	115
81	3300009094	Ga0111539_11523016	Ga0111539_115230162	115
82	3300009147	Ga0114129_12396623	Ga0114129_123966232	115
83	3300009545	Ga0105237_10901570	Ga0105237_109015702	115
84	3300025885	Ga0207653_10236983	Ga0207653_102369831	115
85	3300046472	Ga0495580_0201164	Ga0495580_0201164_320_670	115
86	3300048905	Ga0496102_0059625	Ga0496102_0059625_105_458	115
87	3300050489	nmdc:mga03683_224307_c1	nmdc:mga03683_224307_c1_334_681	115
88	3300050490	nmdc:mga03n38_28155_c1	nmdc:mga03n38_28155_c1_1758_2105	115
89	3300050491	nmdc:mga00v17_1401_c1	nmdc:mga00v17_1401_c1_8675_9022	115
90	3300050512	nmdc:mga0n895_137269_c1	nmdc:mga0n895_137269_c1_890_1243	115
91	3300050516	nmdc:mga0sz30_13851_c1	nmdc:mga0sz30_13851_c1_188_535	115
92	3300005290	Ga0065712_10070920	Ga0065712_100709205	116
93	3300005290	Ga0065712_10203148	Ga0065712_102031481	116
94	3300005293	Ga0065715_10012696	Ga0065715_100126961	116
95	3300005293	Ga0065715_10116664	Ga0065715_101166643	116
96	3300005295	Ga0065707_10086329	Ga0065707_100863297	116
97	3300005295	Ga0065707_10120670	Ga0065707_101206702	116
98	3300005295	Ga0065707_10638138	Ga0065707_106381382	116
99	3300005329	Ga0070683_100030813	Ga0070683_1000308132	116
100	3300005329	Ga0070683_100235053	Ga0070683_1002350532	116
101	3300005329	Ga0070683_100516198	Ga0070683_1005161982	116
102	3300005330	Ga0070690_100218567	Ga0070690_1002185672	116
103	3300005331	Ga0070670_100135941	Ga0070670_1001359413	116
104	3300005331	Ga0070670_101556385	Ga0070670_1015563851	116
105	3300005333	Ga0070677_10229031	Ga0070677_102290312	116
106	3300005335	Ga0070666_10469548	Ga0070666_104695482	116
107	3300005336	Ga0070680_101662706	Ga0070680_1016627061	116
108	3300005340	Ga0070689_100803730	Ga0070689_1008037302	116
109	3300005340	Ga0070689_101263569	Ga0070689_1012635691	116
110	3300005343	Ga0070687_100752300	Ga0070687_1007523002	116
111	3300005344	Ga0070661_100394501	Ga0070661_1003945012	116
112	3300005345	Ga0070692_10001012	Ga0070692_100010122	116
113	3300005345	Ga0070692_10257008	Ga0070692_102570082	116
114	3300005353	Ga0070669_100001950	Ga0070669_1000019504	116
115	3300005354	Ga0070675_100042800	Ga0070675_1000428005	116
116	3300005355	Ga0070671_100344143	Ga0070671_1003441432	116
117	3300005365	Ga0070688_100092620	Ga0070688_1000926202	116
118	3300005365	Ga0070688_100751202	Ga0070688_1007512021	116
119	3300005434	Ga0070709_10125644	Ga0070709_101256442	116
120	3300005436	Ga0070713_100002737	Ga0070713_1000027376	116
121	3300005438	Ga0070701_10014918	Ga0070701_100149183	116
122	3300005439	Ga0070711_100178852	Ga0070711_1001788522	116
123	3300005439	Ga0070711_100747450	Ga0070711_1007474502	116
124	3300005440	Ga0070705_101640510	Ga0070705_1016405101	116
125	3300005444	Ga0070694_100771695	Ga0070694_1007716951	116
126	3300005445	Ga0070708_100000951	Ga0070708_10000095111	116
127	3300005459	Ga0068867_100215816	Ga0068867_1002158161	116
128	3300005466	Ga0070685_10232989	Ga0070685_102329892	116
129	3300005467	Ga0070706_100676278	Ga0070706_1006762782	116
130	3300005468	Ga0070707_100149081	Ga0070707_1001490812	116
131	3300005471	Ga0070698_100172516	Ga0070698_1001725161	116
132	3300005471	Ga0070698_100210268	Ga0070698_1002102683	116
133	3300005471	Ga0070698_100444697	Ga0070698_1004446972	116
134	3300005535	Ga0070684_100103408	Ga0070684_1001034083	116
135	3300005535	Ga0070684_100138142	Ga0070684_1001381422	116
136	3300005535	Ga0070684_100223216	Ga0070684_1002232163	116
137	3300005535	Ga0070684_100274664	Ga0070684_1002746642	116
138	3300005543	Ga0070672_100094915	Ga0070672_1000949153	116
139	3300005545	Ga0070695_100358264	Ga0070695_1003582642	116
140	3300005547	Ga0070693_101132979	Ga0070693_1011329791	116
141	3300005549	Ga0070704_100826678	Ga0070704_1008266782	116
142	3300005564	Ga0070664_100525417	Ga0070664_1005254172	116
143	3300005564	Ga0070664_100659384	Ga0070664_1006593842	116
144	3300005578	Ga0068854_100772843	Ga0068854_1007728432	116
145	3300005614	Ga0068856_100049374	Ga0068856_1000493743	116
146	3300005614	Ga0068856_100112618	Ga0068856_1001126183	116
147	3300005618	Ga0068864_100055142	Ga0068864_1000551424	116
148	3300005840	Ga0068870_10356138	Ga0068870_103561382	116
149	3300005840	Ga0068870_10641703	Ga0068870_106417032	116
150	3300005842	Ga0068858_100124087	Ga0068858_1001240872	116
151	3300005842	Ga0068858_100267251	Ga0068858_1002672512	116
152	3300005844	Ga0068862_100003981	Ga0068862_1000039818	116
153	3300005981	Ga0081538_10014986	Ga0081538_100149862	116
154	3300006038	Ga0075365_10985837	Ga0075365_109858372	116
155	3300006038	Ga0075365_11112598	Ga0075365_111125981	116
156	3300006042	Ga0075368_10013975	Ga0075368_100139755	116
157	3300006051	Ga0075364_10007796	Ga0075364_100077967	116
158	3300006051	Ga0075364_10126638	Ga0075364_101266383	116
159	3300006178	Ga0075367_10031073	Ga0075367_100310732	116
160	3300006353	Ga0075370_10047518	Ga0075370_100475183	116
161	3300006844	Ga0075428_100008371	Ga0075428_1000083718	116
162	3300006844	Ga0075428_102513404	Ga0075428_1025134041	116
163	3300006847	Ga0075431_100044732	Ga0075431_1000447326	116
164	3300006852	Ga0075433_10101366	Ga0075433_101013661	116
165	3300006871	Ga0075434_100048195	Ga0075434_1000481953	116
166	3300006880	Ga0075429_100515328	Ga0075429_1005153282	116
167	3300006881	Ga0068865_100743041	Ga0068865_1007430412	116
168	3300009094	Ga0111539_10000245	Ga0111539_1000024562	116
169	3300009094	Ga0111539_10019011	Ga0111539_100190115	116
170	3300009094	Ga0111539_11466174	Ga0111539_114661742	116
171	3300009098	Ga0105245_10102973	Ga0105245_101029731	116
172	3300009098	Ga0105245_11420541	Ga0105245_114205412	116
173	3300009101	Ga0105247_10374372	Ga0105247_103743721	116
174	3300009147	Ga0114129_10142076	Ga0114129_101420762	116
175	3300009147	Ga0114129_10216383	Ga0114129_102163832	116
176	3300009147	Ga0114129_10827047	Ga0114129_108270472	116
177	3300009148	Ga0105243_10347364	Ga0105243_103473643	116
178	3300009148	Ga0105243_11280051	Ga0105243_112800512	116
179	3300009174	Ga0105241_10127158	Ga0105241_101271583	116
180	3300009174	Ga0105241_10316025	Ga0105241_103160253	116
181	3300009176	Ga0105242_10026697	Ga0105242_100266974	116
182	3300009176	Ga0105242_10061278	Ga0105242_100612784	116
183	3300009177	Ga0105248_10004214	Ga0105248_1000421414	116
184	3300009177	Ga0105248_10108699	Ga0105248_101086992	116
185	3300009551	Ga0105238_10059102	Ga0105238_100591022	116
186	3300009551	Ga0105238_10142549	Ga0105238_101425492	116
187	3300009551	Ga0105238_10365683	Ga0105238_103656832	116
188	3300009553	Ga0105249_10000683	Ga0105249_1000068320	116
189	3300009553	Ga0105249_10069342	Ga0105249_100693425	116
190	3300009553	Ga0105249_11926348	Ga0105249_119263481	116
191	3300009553	Ga0105249_12961439	Ga0105249_129614391	116
192	3300010375	Ga0105239_10010261	Ga0105239_100102613	116
193	3300011119	Ga0105246_10001150	Ga0105246_1000115014	116
194	3300013102	Ga0157371_10004609	Ga0157371_100046097	116
195	3300013104	Ga0157370_10144339	Ga0157370_101443393	116
196	3300013104	Ga0157370_11972139	Ga0157370_119721391	116
197	3300013105	Ga0157369_10221131	Ga0157369_102211313	116
198	3300013105	Ga0157369_11362017	Ga0157369_113620171	116
199	3300013297	Ga0157378_11402857	Ga0157378_114028572	116
200	3300013306	Ga0163162_11998791	Ga0163162_119987912	116
201	3300013307	Ga0157372_10026715	Ga0157372_100267156	116
202	3300013307	Ga0157372_10718592	Ga0157372_107185921	116
203	3300013308	Ga0157375_10112247	Ga0157375_101122472	116
204	3300013308	Ga0157375_10420786	Ga0157375_104207862	116
205	3300014325	Ga0163163_10052106	Ga0163163_100521064	116
206	3300014325	Ga0163163_10100478	Ga0163163_101004782	116
207	3300014326	Ga0157380_10382278	Ga0157380_103822782	116
208	3300014326	Ga0157380_11815522	Ga0157380_118155221	116
209	3300014745	Ga0157377_10017747	Ga0157377_100177472	116
210	3300014745	Ga0157377_10354608	Ga0157377_103546082	116
211	3300014968	Ga0157379_10093898	Ga0157379_100938981	116
212	3300014968	Ga0157379_10498199	Ga0157379_104981992	116
213	3300014969	Ga0157376_10009862	Ga0157376_100098622	116
214	3300015265	Ga0182005_1121494	Ga0182005_11214941	116
215	3300017792	Ga0163161_10695973	Ga0163161_106959732	116
216	3300025901	Ga0207688_10072247	Ga0207688_100722474	116
217	3300025906	Ga0207699_10096849	Ga0207699_100968493	116
218	3300025916	Ga0207663_11053571	Ga0207663_110535712	116
219	3300025922	Ga0207646_10062119	Ga0207646_100621194	116
220	3300025923	Ga0207681_10208422	Ga0207681_102084222	116
221	3300025923	Ga0207681_10419078	Ga0207681_104190782	116
222	3300025925	Ga0207650_10238317	Ga0207650_102383173	116
223	3300025925	Ga0207650_11590753	Ga0207650_115907531	116
224	3300025926	Ga0207659_10125306	Ga0207659_101253063	116
225	3300025927	Ga0207687_11337634	Ga0207687_113376341	116
226	3300025928	Ga0207700_10041530	Ga0207700_100415302	116
227	3300025931	Ga0207644_10404196	Ga0207644_104041962	116
228	3300025934	Ga0207686_10021241	Ga0207686_100212414	116
229	3300025936	Ga0207670_10473126	Ga0207670_104731262	116
230	3300025936	Ga0207670_11068228	Ga0207670_110682281	116
231	3300025940	Ga0207691_10139403	Ga0207691_101394032	116
232	3300025944	Ga0207661_10097758	Ga0207661_100977582	116
233	3300025945	Ga0207679_10750636	Ga0207679_107506362	116
234	3300025961	Ga0207712_10006106	Ga0207712_100061066	116
235	3300025961	Ga0207712_10492865	Ga0207712_104928653	116
236	3300025961	Ga0207712_11376177	Ga0207712_113761772	116
237	3300025972	Ga0207668_11796866	Ga0207668_117968661	116
238	3300026035	Ga0207703_10253998	Ga0207703_102539982	116
239	3300026035	Ga0207703_10509790	Ga0207703_105097902	116
240	3300026075	Ga0207708_10300038	Ga0207708_103000382	116
241	3300026075	Ga0207708_10924780	Ga0207708_109247801	116
242	3300026078	Ga0207702_10123205	Ga0207702_101232054	116
243	3300026078	Ga0207702_11175734	Ga0207702_111757342	116
244	3300026095	Ga0207676_10688542	Ga0207676_106885422	116
245	3300026142	Ga0207698_10386269	Ga0207698_103862692	116
246	3300027866	Ga0209813_10030985	Ga0209813_100309853	116
247	3300027907	Ga0207428_10020179	Ga0207428_100201793	116
248	3300028380	Ga0268265_10007416	Ga0268265_1000741610	116
249	3300035083	Ga0373926_0364344	Ga0373926_0364344_22_378	116
250	3300035085	Ga0373929_0000011	Ga0373929_0000011_136203_136559	116
251	3300035086	Ga0373934_0003314	Ga0373934_0003314_542_898	116
252	3300035086	Ga0373934_0010773	Ga0373934_0010773_829_1185	116
253	3300035111	Ga0373923_0002572	Ga0373923_0002572_4226_4582	116
254	3300035115	Ga0373941_0183175	Ga0373941_0183175_128_493	116
255	3300035117	Ga0373953_0202167	Ga0373953_0202167_338_694	116
256	3300035117	Ga0373953_0287054	Ga0373953_0287054_167_523	116
257	3300035118	Ga0373954_0050037	Ga0373954_0050037_1105_1461	116
258	3300035118	Ga0373954_0613499	Ga0373954_0613499_155_511	116
259	3300035119	Ga0373956_0381468	Ga0373956_0381468_144_500	116
260	3300035120	Ga0373957_0115331	Ga0373957_0115331_438_794	116
261	3300035170	Ga0373943_0549485	Ga0373943_0549485_121_486	116
262	3300035171	Ga0373946_0272907	Ga0373946_0272907_314_679	116
263	3300035172	Ga0373955_0038059	Ga0373955_0038059_1480_1836	116
264	3300035172	Ga0373955_0040040	Ga0373955_0040040_1594_1950	116
265	3300035410	Ga0373924_0311873	Ga0373924_0311873_309_665	116
266	3300035691	Ga0373931_0003372	Ga0373931_0003372_3608_3973	116
267	3300035692	Ga0373935_0083953	Ga0373935_0083953_1488_1853	116
268	3300035692	Ga0373935_0346824	Ga0373935_0346824_268_624	116
269	3300035695	Ga0373927_0045049	Ga0373927_0045049_530_895	116
270	3300035695	Ga0373927_0050336	Ga0373927_0050336_1367_1723	116
271	3300035695	Ga0373927_0072324	Ga0373927_0072324_805_1170	116
272	3300035724	Ga0373933_0010194	Ga0373933_0010194_4441_4797	116
273	3300035724	Ga0373933_0020925	Ga0373933_0020925_374_730	116
274	3300035725	Ga0373947_0189001	Ga0373947_0189001_647_1012	116
275	3300036401	Ga0373937_0002000	Ga0373937_0002000_1173_1529	116
276	3300036401	Ga0373937_0003231	Ga0373937_0003231_4278_4634	116
277	3300036401	Ga0373937_0007000	Ga0373937_0007000_6951_7307	116
278	3300036401	Ga0373937_0974353	Ga0373937_0974353_107_463	116
279	3300044694	Ga0466963_0322402	Ga0466963_0322402_115_477	116
280	3300045051	Ga0451576_0440540	Ga0451576_0440540_786_1160	116
281	3300045051	Ga0451576_0464707	Ga0451576_0464707_881_1234	116
282	3300045051	Ga0451576_0560315	Ga0451576_0560315_382_747	116
283	3300045976	Ga0466967_0111252	Ga0466967_0111252_1637_1999	116
284	3300046454	Ga0495592_0079751	Ga0495592_0079751_424_780	116
285	3300046455	Ga0495603_0388784	Ga0495603_0388784_76_438	116
286	3300046459	Ga0495629_0047641	Ga0495629_0047641_954_1319	116
287	3300046459	Ga0495629_0089559	Ga0495629_0089559_91_450	116
288	3300046462	Ga0495651_0014779	Ga0495651_0014779_1414_1770	116
289	3300046462	Ga0495651_0177228	Ga0495651_0177228_138_494	116
290	3300046463	Ga0495653_0151102	Ga0495653_0151102_136_492	116
291	3300046463	Ga0495653_0326462	Ga0495653_0326462_378_734	116
292	3300046463	Ga0495653_0696913	Ga0495653_0696913_241_597	116
293	3300046472	Ga0495580_0008420	Ga0495580_0008420_5575_5931	116
294	3300046472	Ga0495580_0224995	Ga0495580_0224995_410_775	116
295	3300046473	Ga0495582_0108311	Ga0495582_0108311_1062_1427	116
296	3300046475	Ga0495639_0028798	Ga0495639_0028798_1991_2347	116
297	3300046475	Ga0495639_0138730	Ga0495639_0138730_575_940	116
298	3300046477	Ga0495664_0041346	Ga0495664_0041346_1242_1598	116
299	3300046499	Ga0495594_0006066	Ga0495594_0006066_2841_3197	116
300	3300046499	Ga0495594_0007640	Ga0495594_0007640_1997_2353	116
301	3300046499	Ga0495594_0185504	Ga0495594_0185504_384_743	116
302	3300046511	Ga0495608_0010513	Ga0495608_0010513_921_1277	116
303	3300046511	Ga0495608_0464468	Ga0495608_0464468_377_733	116
304	3300046514	Ga0495618_0047263	Ga0495618_0047263_361_717	116
305	3300046516	Ga0495628_0017478	Ga0495628_0017478_5283_5639	116
306	3300046516	Ga0495628_0023973	Ga0495628_0023973_531_887	116
307	3300046516	Ga0495628_0661035	Ga0495628_0661035_30_386	116
308	3300046517	Ga0495630_0062233	Ga0495630_0062233_1421_1786	116
309	3300046517	Ga0495630_0280285	Ga0495630_0280285_584_940	116
310	3300046517	Ga0495630_0792846	Ga0495630_0792846_232_597	116
311	3300046526	Ga0495666_0120385	Ga0495666_0120385_683_1048	116
312	3300046529	Ga0495652_0120770	Ga0495652_0120770_1281_1637	116
313	3300046533	Ga0495640_0249837	Ga0495640_0249837_496_852	116
314	3300046535	Ga0495586_0262460	Ga0495586_0262460_74_439	116
315	3300046536	Ga0495587_0001345	Ga0495587_0001345_12599_12955	116
316	3300046536	Ga0495587_0002107	Ga0495587_0002107_5436_5792	116
317	3300046543	Ga0495645_0000591	Ga0495645_0000591_11185_11541	116
318	3300046543	Ga0495645_0059771	Ga0495645_0059771_1514_1870	116
319	3300046558	Ga0495633_0393321	Ga0495633_0393321_174_533	116
320	3300046559	Ga0495667_0001064	Ga0495667_0001064_9522_9878	116
321	3300046559	Ga0495667_0088654	Ga0495667_0088654_1408_1764	116
322	3300046559	Ga0495667_0122993	Ga0495667_0122993_1079_1435	116
323	3300046559	Ga0495667_0137296	Ga0495667_0137296_1172_1528	116
324	3300046642	Ga0495634_0028366	Ga0495634_0028366_2169_2525	116
325	3300046674	Ga0495588_0068057	Ga0495588_0068057_1235_1600	116
326	3300046675	Ga0495657_0032040	Ga0495657_0032040_2763_3119	116
327	3300046678	Ga0495599_0003629	Ga0495599_0003629_2973_3329	116
328	3300046679	Ga0495623_0002264	Ga0495623_0002264_8437_8793	116
329	3300046679	Ga0495623_0002466	Ga0495623_0002466_5229_5585	116
330	3300046679	Ga0495623_0056320	Ga0495623_0056320_720_1076	116
331	3300046683	Ga0495658_0064202	Ga0495658_0064202_1270_1635	116
332	3300046683	Ga0495658_0102285	Ga0495658_0102285_677_1033	116
333	3300046809	Ga0495600_0094476	Ga0495600_0094476_290_646	116
334	3300047315	Ga0495581_0374824	Ga0495581_0374824_124_489	116
335	3300047315	Ga0495581_0615981	Ga0495581_0615981_167_532	116
336	3300047317	Ga0495604_0299625	Ga0495604_0299625_686_1042	116
337	3300047317	Ga0495604_0336587	Ga0495604_0336587_46_402	116
338	3300047319	Ga0495674_0211420	Ga0495674_0211420_678_1034	116
339	3300047444	Ga0495675_0001134	Ga0495675_0001134_4967_5323	116
340	3300047444	Ga0495675_0001396	Ga0495675_0001396_8942_9298	116
341	3300047444	Ga0495675_0005472	Ga0495675_0005472_3031_3387	116
342	3300047471	Ga0495684_0003259	Ga0495684_0003259_6600_6956	116
343	3300047471	Ga0495684_0005039	Ga0495684_0005039_5548_5904	116
344	3300047471	Ga0495684_0088019	Ga0495684_0088019_1076_1444	116
345	3300047471	Ga0495684_0215619	Ga0495684_0215619_254_610	116
346	3300048088	Ga0495602_0003596	Ga0495602_0003596_9816_10172	116
347	3300048088	Ga0495602_0016792	Ga0495602_0016792_524_880	116
348	3300048907	Ga0496104_0339650	Ga0496104_0339650_840_1196	116
349	3300048907	Ga0496104_0697719	Ga0496104_0697719_418_783	116
350	3300048911	Ga0496108_0569027	Ga0496108_0569027_366_731	116
351	3300048912	Ga0496109_0011273	Ga0496109_0011273_4182_4547	116
352	3300048913	Ga0496110_0514100	Ga0496110_0514100_168_533	116
353	3300048915	Ga0496112_0007756	Ga0496112_0007756_6342_6707	116
354	3300048916	Ga0496113_0262589	Ga0496113_0262589_283_648	116
355	3300050490	nmdc:mga03n38_940152_c1	nmdc:mga03n38_940152_c1_77_436	116
356	3300050491	nmdc:mga00v17_26090_c1	nmdc:mga00v17_26090_c1_2427_2786	116
357	3300050491	nmdc:mga00v17_94575_c1	nmdc:mga00v17_94575_c1_35_388	116
358	3300050492	nmdc:mga0yw44_255977_c1	nmdc:mga0yw44_255977_c1_616_975	116
359	3300050494	nmdc:mga06z11_195363_c1	nmdc:mga06z11_195363_c1_734_1093	116
360	3300050495	nmdc:mga04h51_43427_c1	nmdc:mga04h51_43427_c1_847_1206	116
361	3300050496	nmdc:mga07m45_14628_c1	nmdc:mga07m45_14628_c1_2969_3328	116
362	3300050507	nmdc:mga05p37_1050591_c1	nmdc:mga05p37_1050591_c1_111_488	116
363	3300050507	nmdc:mga05p37_33802_c1	nmdc:mga05p37_33802_c1_558_914	116
364	3300050508	nmdc:mga09592_181997_c1	nmdc:mga09592_181997_c1_1198_1584	116
365	3300050508	nmdc:mga09592_487421_c1	nmdc:mga09592_487421_c1_119_496	116
366	3300050508	nmdc:mga09592_655285_c1	nmdc:mga09592_655285_c1_380_763	116
367	3300050510	nmdc:mga06r32_13366_c1	nmdc:mga06r32_13366_c1_1278_1634	116
368	3300050511	nmdc:mga08y16_129501_c1	nmdc:mga08y16_129501_c1_285_641	116
369	3300050511	nmdc:mga08y16_185100_c1	nmdc:mga08y16_185100_c1_1328_1714	116
370	3300050512	nmdc:mga0n895_41673_c1	nmdc:mga0n895_41673_c1_195_554	116
371	3300050514	nmdc:mga08x19_991702_c1	nmdc:mga08x19_991702_c1_35_451	116
372	3300050515	nmdc:mga0a205_31325_c1	nmdc:mga0a205_31325_c1_195_554	116
373	3300053077	Ga0495601_0010964	Ga0495601_0010964_1948_2304	116
374	3300053077	Ga0495601_0623509	Ga0495601_0623509_87_443	116
375	3300053078	Ga0495612_0029121	Ga0495612_0029121_1263_1619	116
376	3300053084	Ga0495595_0245427	Ga0495595_0245427_291_647	116
377	3300053085	Ga0495619_0099901	Ga0495619_0099901_1055_1411	116
378	3300053085	Ga0495619_0364671	Ga0495619_0364671_73_429	116
379	3300053085	Ga0495619_0614107	Ga0495619_0614107_167_523	116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

124

0.87 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5hcw-assembly5.cif.gz_B	crystal structure of c-as lyase with mutations y100h and v102f (monoclinic form)	0.7731	5	107
5v0f-assembly1.cif.gz_A	crystal structure of c-as lyase with mutation k105a and substrate roxarsone	0.7712	6	109
5cb9-assembly1.cif.gz_A	crystal structure of c-as lyase with mercaptoethonal	0.7692	5	107
6pvi-assembly1.cif.gz_A	crystal structure of phqk in complex with paraherquamide l	0.7633	78	106
5hcw-assembly5.cif.gz_A	crystal structure of c-as lyase with mutations y100h and v102f (monoclinic form)	0.7562	5	107

ID	Description	Score	Start	End	Superfamily
af_O17169_46_148_2.60.110.10	Mainly Beta;Sandwich;Thaumatin;Thaumatin	0.8425	79	95	2.60.110.10
3bt3B02	Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1;	0.8383	63	108	3.30.720.110
3itwA02	Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1;	0.7934	61	107	3.30.720.110
af_P9WKQ3_98_165_3.30.720.110	Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1;	0.7837	61	110	3.30.720.110
af_A0A1D8PLS6_1_66_3.30.160.70	Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Methylated DNA-protein cysteine methyltransferase domain	0.7707	80	106	3.30.160.70

ID	Description	Score	Start	End
AF-A0A7S7NLU6-F1-model_v4	VOC domain-containing protein	0.9905	61	110
AF-A0A536DI92-F1-model_v4	Uncharacterized protein	0.9708	63	110
AF-A0A3D6EL51-F1-model_v4	VOC domain-containing protein	0.9483	61	110
AF-A0A6M0AYC2-F1-model_v4	VOC domain-containing protein	0.9478	61	107
AF-A0A843SRX7-F1-model_v4	VOC domain-containing protein	0.9328	61	109

Feature Viewer

pLDDT	pTM	Quality
89.15	0.78	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F428343

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

124

0.87

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map