F428336

General Info

Members Datasets Scaffolds Average Seq Length
379 190 379 124

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10302071|Ga0111539_103020712
Length 132
Sequence MLNYRQFEAGPDPFGRKFQVYFKWLQTAISLRHADTVDVKFVLEEEGGPGVEKTIALXXXDLVRLERETGRKIDDAWCARIAALHLLHLIETGEDVEKDLVTVSFPDLRRYAGALARADQSEVGDRPTFRGK

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
111 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.06
Rhizosphere 97.89
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_11431909 3300004801 Bacteria 959
2 Ga0065707_10564622 3300005295 Bacteria 712
3 Ga0070658_10251650 3300005327 Bacteria 1499
4 Ga0070683_100361412 3300005329 Bacteria 1383
5 Ga0070683_100722578 3300005329 Unclassified 954
6 Ga0070690_100613322 3300005330 Unclassified 827
7 Ga0070690_101187829 3300005330 Bacteria 608
8 Ga0068869_100783977 3300005334 Unclassified 818
9 Ga0070680_100350984 3300005336 Unclassified 1254
10 Ga0070680_101305514 3300005336 Unclassified 628
11 Ga0070682_101366283 3300005337 Bacteria 604
12 Ga0068868_101631004 3300005338 Unclassified 606
13 Ga0070689_100100549 3300005340 Bacteria 2288
14 Ga0070689_101621074 3300005340 Unclassified 588
15 Ga0070687_100728644 3300005343 Bacteria 695
16 Ga0070671_100969102 3300005355 Unclassified 744
17 Ga0070671_101654545 3300005355 Unclassified 568
18 Ga0070659_101219061 3300005366 Bacteria 666
19 Ga0070667_101386826 3300005367 Unclassified 659
20 Ga0070667_101559350 3300005367 Unclassified 621
21 Ga0070709_10078170 3300005434 Bacteria 2152
22 Ga0070709_10195270 3300005434 Unclassified 1430
23 Ga0070714_100375600 3300005435 Unclassified 1339
24 Ga0070711_100385744 3300005439 Bacteria 1134
25 Ga0070711_101000321 3300005439 Bacteria 717
26 Ga0070708_100284656 3300005445 Unclassified 1556
27 Ga0070678_101461242 3300005456 Unclassified 639
28 Ga0070681_10020997 3300005458 Bacteria 6543
29 Ga0070681_10354282 3300005458 Bacteria 1378
30 Ga0070706_100112474 3300005467 Unclassified 2535
31 Ga0070706_100641402 3300005467 Bacteria 986
32 Ga0070699_100249287 3300005518 Bacteria 1586
33 Ga0070679_100338667 3300005530 Unclassified 1452
34 Ga0070679_100813052 3300005530 Bacteria 878
35 Ga0070679_100944423 3300005530 Bacteria 806
36 Ga0070684_100040679 3300005535 Bacteria 4004
37 Ga0070684_100139921 3300005535 Bacteria 2188
38 Ga0070684_100287473 3300005535 Bacteria 1507
39 Ga0070684_100908261 3300005535 Unclassified 825
40 Ga0070697_100105284 3300005536 Bacteria 2347
41 Ga0070697_100159198 3300005536 Bacteria 1907
42 Ga0070697_100287388 3300005536 Bacteria 1412
43 Ga0070672_100368265 3300005543 Unclassified 1227
44 Ga0070672_101617749 3300005543 Unclassified 581
45 Ga0070695_100019355 3300005545 Bacteria 4145
46 Ga0070693_100287733 3300005547 Bacteria 1103
47 Ga0070665_100796330 3300005548 Unclassified 958
48 Ga0070665_101741246 3300005548 Unclassified 630
49 Ga0070704_100340531 3300005549 Bacteria 1263
50 Ga0068855_100560962 3300005563 Unclassified 1235
51 Ga0070664_100844285 3300005564 Unclassified 857
52 Ga0068857_101200829 3300005577 Bacteria 734
53 Ga0068857_101755431 3300005577 Unclassified 607
54 Ga0068857_102039108 3300005577 Bacteria 563
55 Ga0068856_101031869 3300005614 Unclassified 840
56 Ga0070702_101019513 3300005615 Unclassified 656
57 Ga0068852_100673477 3300005616 Unclassified 1043
58 Ga0068852_101915237 3300005616 Unclassified 615
59 Ga0068859_100423639 3300005617 Bacteria 1427
60 Ga0068859_100750705 3300005617 Bacteria 1065
61 Ga0068859_100988123 3300005617 Unclassified 924
62 Ga0068859_101392707 3300005617 Unclassified 773
63 Ga0068864_101395201 3300005618 Unclassified 702
64 Ga0068866_10733453 3300005718 Bacteria 681
65 Ga0068863_100859145 3300005841 Bacteria 906
66 Ga0068863_101036385 3300005841 Unclassified 824
67 Ga0068863_102481116 3300005841 Unclassified 528
68 Ga0068858_101118305 3300005842 Unclassified 773
69 Ga0068858_101666888 3300005842 Unclassified 629
70 Ga0068858_101693975 3300005842 Unclassified 624
71 Ga0070717_10101357 3300006028 Bacteria 2445
72 Ga0070717_11179323 3300006028 Unclassified 697
73 Ga0070717_11485209 3300006028 Unclassified 615
74 Ga0070717_11918465 3300006028 Unclassified 534
75 Ga0070716_100450608 3300006173 Bacteria 938
76 Ga0070716_101497180 3300006173 Unclassified 551
77 Ga0097621_100426851 3300006237 Unclassified 1191
78 Ga0097621_100506555 3300006237 Bacteria 1094
79 Ga0097621_101197788 3300006237 Unclassified 715
80 Ga0068871_100666916 3300006358 Unclassified 950
81 Ga0068871_100774583 3300006358 Bacteria 883
82 Ga0068871_101046942 3300006358 Unclassified 761
83 Ga0068871_101654063 3300006358 Unclassified 607
84 Ga0075430_101113107 3300006846 Unclassified 650
85 Ga0075431_100002583 3300006847 Bacteria 17495
86 Ga0075431_100842342 3300006847 Unclassified 889
87 Ga0075434_101031517 3300006871 Unclassified 836
88 Ga0075429_100510004 3300006880 Bacteria 1054
89 Ga0068865_100876003 3300006881 Unclassified 779
90 Ga0075436_100037531 3300006914 Bacteria 3345
91 Ga0097620_100423633 3300006931 Bacteria 1427
92 Ga0097620_100750719 3300006931 Bacteria 1065
93 Ga0097620_100988401 3300006931 Unclassified 924
94 Ga0097620_101392685 3300006931 Unclassified 773
95 Ga0075435_100360934 3300007076 Bacteria 1246
96 Ga0075435_101710311 3300007076 Bacteria 552
97 Ga0105240_10010091 3300009093 Bacteria 13292
98 Ga0105240_10012811 3300009093 Bacteria 11553
99 Ga0105240_10205698 3300009093 Bacteria 2304
100 Ga0105240_11023568 3300009093 Unclassified 882
101 Ga0105240_11080643 3300009093 Bacteria 854
102 Ga0111539_10302071 3300009094 Bacteria 1863
103 Ga0111539_13382311 3300009094 Unclassified 513
104 Ga0105245_10648571 3300009098 Bacteria 1086
105 Ga0105245_11056404 3300009098 Unclassified 857
106 Ga0105247_11053216 3300009101 Unclassified 639
107 Ga0105247_11303125 3300009101 Unclassified 583
108 Ga0114129_10327139 3300009147 Unclassified 2036
109 Ga0114129_10364419 3300009147 Bacteria 1912
110 Ga0105243_12882387 3300009148 Unclassified 521
111 Ga0105241_11053667 3300009174 Unclassified 763
112 Ga0105242_10338159 3300009176 Unclassified 1386
113 Ga0105242_10730981 3300009176 Unclassified 972
114 Ga0105242_11001785 3300009176 Unclassified 843
115 Ga0105242_11861360 3300009176 Bacteria 641
116 Ga0105242_12858854 3300009176 Unclassified 533
117 Ga0105242_13306389 3300009176 Bacteria 501
118 Ga0105248_10034373 3300009177 Bacteria 5668
119 Ga0105248_10035249 3300009177 Bacteria 5598
120 Ga0105248_10128601 3300009177 Bacteria 2858
121 Ga0105248_10273961 3300009177 Unclassified 1900
122 Ga0105248_10543495 3300009177 Bacteria 1311
123 Ga0105248_10766429 3300009177 Unclassified 1089
124 Ga0105248_10818624 3300009177 Unclassified 1051
125 Ga0105248_10972986 3300009177 Unclassified 958
126 Ga0105248_11594036 3300009177 Unclassified 739
127 Ga0105248_12227578 3300009177 Unclassified 624
128 Ga0105248_12961563 3300009177 Bacteria 541
129 Ga0105237_10001392 3300009545 Bacteria 31950
130 Ga0105237_10122574 3300009545 Bacteria 2594
131 Ga0105237_10567552 3300009545 Bacteria 1141
132 Ga0105237_11027592 3300009545 Unclassified 831
133 Ga0105237_11206864 3300009545 Bacteria 763
134 Ga0105237_11873360 3300009545 Bacteria 608
135 Ga0105238_10505459 3300009551 Bacteria 1210
136 Ga0105238_10946360 3300009551 Unclassified 881
137 Ga0105238_12735969 3300009551 Unclassified 530
138 Ga0105239_10490147 3300010375 Unclassified 1397
139 Ga0105239_10545770 3300010375 Bacteria 1320
140 Ga0105239_11204741 3300010375 Bacteria 873
141 Ga0105239_12180412 3300010375 Unclassified 644
142 Ga0105239_12433837 3300010375 Bacteria 610
143 Ga0157370_10354757 3300013104 Unclassified 1352
144 Ga0157370_10635463 3300013104 Unclassified 976
145 Ga0157370_11402173 3300013104 Unclassified 629
146 Ga0157369_10183058 3300013105 Bacteria 2204
147 Ga0157374_10555054 3300013296 Unclassified 1156
148 Ga0157374_10845308 3300013296 Unclassified 932
149 Ga0157374_10931548 3300013296 Bacteria 887
150 Ga0157374_11228549 3300013296 Unclassified 771
151 Ga0157378_10106825 3300013297 Bacteria 2561
152 Ga0157378_10270061 3300013297 Bacteria 1635
153 Ga0157378_10465835 3300013297 Bacteria 1257
154 Ga0163162_10587650 3300013306 Bacteria 1240
155 Ga0163162_10624910 3300013306 Bacteria 1202
156 Ga0157375_10442449 3300013308 Bacteria 1465
157 Ga0157375_10630182 3300013308 Unclassified 1230
158 Ga0157375_10992273 3300013308 Unclassified 980
159 Ga0163163_10176375 3300014325 Bacteria 2184
160 Ga0163163_10425159 3300014325 Bacteria 1387
161 Ga0163163_10922550 3300014325 Unclassified 937
162 Ga0163163_11177678 3300014325 Bacteria 829
163 Ga0163163_12279455 3300014325 Bacteria 600
164 Ga0163163_13117143 3300014325 Unclassified 517
165 Ga0157377_10255885 3300014745 Unclassified 1137
166 Ga0157379_10214812 3300014968 Unclassified 1742
167 Ga0157379_10787035 3300014968 Bacteria 897
168 Ga0157379_11495063 3300014968 Bacteria 657
169 Ga0157376_10031055 3300014969 Bacteria 4273
170 Ga0157376_10096469 3300014969 Bacteria 2573
171 Ga0157376_10926353 3300014969 Bacteria 891
172 Ga0157376_11488999 3300014969 Unclassified 710
173 Ga0157376_11708610 3300014969 Unclassified 665
174 Ga0163161_10891879 3300017792 Bacteria 753
175 Ga0213875_10333812 3300021388 Bacteria 719
176 Ga0207692_10926102 3300025898 Bacteria 574
177 Ga0207680_10313061 3300025903 Unclassified 1096
178 Ga0207684_10082784 3300025910 Bacteria 2733
179 Ga0207684_11417075 3300025910 Unclassified 568
180 Ga0207707_10011586 3300025912 Bacteria 7678
181 Ga0207707_10462723 3300025912 Bacteria 1084
182 Ga0207695_10023524 3300025913 Bacteria 6957
183 Ga0207695_10113577 3300025913 Bacteria 2685
184 Ga0207671_10061861 3300025914 Bacteria 2779
185 Ga0207671_10162502 3300025914 Bacteria 1730
186 Ga0207671_11097072 3300025914 Bacteria 625
187 Ga0207660_10634606 3300025917 Unclassified 871
188 Ga0207662_10880863 3300025918 Unclassified 633
189 Ga0207652_10051882 3300025921 Bacteria 3518
190 Ga0207652_10691259 3300025921 Bacteria 911
191 Ga0207652_11022266 3300025921 Unclassified 726
192 Ga0207681_10789598 3300025923 Unclassified 793
193 Ga0207694_10486224 3300025924 Unclassified 1033
194 Ga0207694_10993059 3300025924 Unclassified 710
195 Ga0207650_10949678 3300025925 Bacteria 731
196 Ga0207650_11546228 3300025925 Unclassified 564
197 Ga0207659_11693652 3300025926 Bacteria 539
198 Ga0207687_10245613 3300025927 Bacteria 1420
199 Ga0207687_10298236 3300025927 Bacteria 1297
200 Ga0207664_10909899 3300025929 Bacteria 790
201 Ga0207644_10771464 3300025931 Unclassified 804
202 Ga0207686_11101779 3300025934 Unclassified 647
203 Ga0207670_10074605 3300025936 Bacteria 2355
204 Ga0207670_10242690 3300025936 Bacteria 1389
205 Ga0207670_10613252 3300025936 Unclassified 894
206 Ga0207669_10833025 3300025937 Bacteria 767
207 Ga0207665_11559269 3300025939 Unclassified 524
208 Ga0207691_10364135 3300025940 Unclassified 1236
209 Ga0207711_10073253 3300025941 Bacteria 2976
210 Ga0207711_10092432 3300025941 Bacteria 2663
211 Ga0207711_10157957 3300025941 Unclassified 2050
212 Ga0207711_10433854 3300025941 Unclassified 1223
213 Ga0207661_10107369 3300025944 Bacteria 2355
214 Ga0207661_10548343 3300025944 Bacteria 1059
215 Ga0207651_10274026 3300025960 Bacteria 1391
216 Ga0207658_10600359 3300025986 Unclassified 989
217 Ga0207677_11061410 3300026023 Unclassified 737
218 Ga0207677_12018253 3300026023 Unclassified 536
219 Ga0207703_10587358 3300026035 Unclassified 1053
220 Ga0207703_10714623 3300026035 Unclassified 953
221 Ga0207676_10067723 3300026095 Bacteria 2853
222 Ga0207674_12026583 3300026116 Unclassified 540
223 Ga0207683_10993934 3300026121 Unclassified 779
224 Ga0207683_11840444 3300026121 Bacteria 554
225 Ga0207698_10063023 3300026142 Bacteria 2899
226 Ga0268266_10142494 3300028379 Bacteria 2152
227 Ga0268266_10153832 3300028379 Bacteria 2076
228 Ga0268266_11453714 3300028379 Unclassified 661
229 Ga0265323_10000210 3300028653 Bacteria 34672
230 Ga0265762_1039877 3300030760 Bacteria 916
231 Ga0265760_10044542 3300031090 Bacteria 1328
232 Ga0265330_10073270 3300031235 Unclassified 1481
233 Ga0265332_10140438 3300031238 Unclassified 1012
234 Ga0265328_10218804 3300031239 Unclassified 725
235 Ga0265329_10193713 3300031242 Unclassified 667
236 Ga0265339_10117584 3300031249 Bacteria 1369
237 Ga0265316_10000788 3300031344 Bacteria 34909
238 Ga0265316_10001101 3300031344 Bacteria 29304
239 Ga0265316_10013606 3300031344 Bacteria 7219
240 Ga0265316_10027733 3300031344 Bacteria 4682
241 Ga0265316_10098625 3300031344 Bacteria 2223
242 Ga0265316_10694212 3300031344 Unclassified 718
243 Ga0265314_10465053 3300031711 Unclassified 671
244 Ga0373926_0037013 3300035083 Unclassified 1735
245 Ga0373934_0249660 3300035086 Bacteria 733
246 Ga0373936_0109700 3300035113 Bacteria 1171
247 Ga0373945_0054285 3300035116 Unclassified 1481
248 Ga0373953_0142532 3300035117 Unclassified 1025
249 Ga0373954_0078936 3300035118 Unclassified 1571
250 Ga0373954_0093941 3300035118 Unclassified 1443
251 Ga0373954_0164838 3300035118 Bacteria 1085
252 Ga0373956_0057034 3300035119 Bacteria 1764
253 Ga0373957_0061696 3300035120 Bacteria 1454
254 Ga0373943_0578539 3300035170 Bacteria 660
255 Ga0373943_0624233 3300035170 Unclassified 636
256 Ga0373955_0123325 3300035172 Unclassified 1507
257 Ga0373955_0205147 3300035172 Bacteria 1174
258 Ga0373931_0677931 3300035691 Unclassified 679
259 Ga0373931_0799628 3300035691 Unclassified 629
260 Ga0373935_0056646 3300035692 Unclassified 2500
261 Ga0373935_0623463 3300035692 Bacteria 790
262 Ga0373927_0001310 3300035695 Bacteria 18820
263 Ga0373927_0014589 3300035695 Bacteria 5197
264 Ga0373927_0093276 3300035695 Unclassified 1956
265 Ga0373927_0254611 3300035695 Bacteria 1154
266 Ga0373927_0975357 3300035695 Unclassified 559
267 Ga0373933_0345634 3300035724 Bacteria 966
268 Ga0373947_0012635 3300035725 Bacteria 4842
269 Ga0373947_0364605 3300035725 Bacteria 971
270 Ga0373937_0063251 3300036401 Bacteria 3403
271 Ga0373937_0321253 3300036401 Unclassified 1465
272 Ga0373937_0585003 3300036401 Bacteria 1060
273 Ga0373925_0000134 3300037068 Bacteria 78733
274 Ga0373925_0017393 3300037068 Bacteria 5211
275 Ga0373925_0148851 3300037068 Unclassified 1837
276 Ga0373925_0941533 3300037068 Bacteria 712
277 Ga0373925_1137446 3300037068 Unclassified 642
278 Ga0373925_1446099 3300037068 Unclassified 563
279 Ga0436364_1274819 3300037853 Bacteria 6143
280 Ga0436365_1675121 3300039437 Bacteria 2356
281 Ga0451577_1089727 3300042876 Unclassified 715
282 Ga0453683_0081991 3300044673 Bacteria 2021
283 Ga0466966_0483125 3300044684 Bacteria 745
284 Ga0466963_0380486 3300044694 Unclassified 995
285 Ga0466959_0655505 3300045049 Bacteria 705
286 Ga0451576_0018852 3300045051 Bacteria 7544
287 Ga0451576_0253384 3300045051 Bacteria 1840
288 Ga0451576_0950176 3300045051 Bacteria 901
289 Ga0451576_1119731 3300045051 Bacteria 824
290 Ga0451576_1429158 3300045051 Unclassified 719
291 Ga0451576_1652996 3300045051 Unclassified 664
292 Ga0495592_0009761 3300046454 Bacteria 7225
293 Ga0495592_0402308 3300046454 Unclassified 867
294 Ga0495592_0955002 3300046454 Unclassified 501
295 Ga0495651_0008441 3300046462 Bacteria 7897
296 Ga0495651_0016669 3300046462 Bacteria 5690
297 Ga0495651_0215518 3300046462 Bacteria 1333
298 Ga0495653_0071605 3300046463 Unclassified 2591
299 Ga0495580_0002410 3300046472 Bacteria 16339
300 Ga0495580_0043807 3300046472 Bacteria 3184
301 Ga0495580_0090823 3300046472 Bacteria 2126
302 Ga0495580_0185487 3300046472 Bacteria 1436
303 Ga0495580_0274936 3300046472 Bacteria 1150
304 Ga0495580_0377755 3300046472 Unclassified 957
305 Ga0495580_0476529 3300046472 Unclassified 835
306 Ga0495582_0575482 3300046473 Unclassified 652
307 Ga0495662_0005975 3300046476 Bacteria 6085
308 Ga0495664_0001299 3300046477 Bacteria 13084
309 Ga0495608_0160869 3300046511 Unclassified 1428
310 Ga0495628_0004454 3300046516 Bacteria 12426
311 Ga0495628_0143323 3300046516 Unclassified 1823
312 Ga0495630_0595690 3300046517 Unclassified 847
313 Ga0495666_0176531 3300046526 Bacteria 987
314 Ga0495652_0536492 3300046529 Unclassified 806
315 Ga0495665_0066207 3300046531 Bacteria 1907
316 Ga0495665_0184317 3300046531 Bacteria 1084
317 Ga0495665_0202136 3300046531 Bacteria 1030
318 Ga0495586_0755170 3300046535 Unclassified 561
319 Ga0495587_0022921 3300046536 Bacteria 3841
320 Ga0495587_0047148 3300046536 Unclassified 2556
321 Ga0495587_0086817 3300046536 Unclassified 1811
322 Ga0495645_0023792 3300046543 Bacteria 4439
323 Ga0495645_0047392 3300046543 Unclassified 3131
324 Ga0495645_0354352 3300046543 Bacteria 945
325 Ga0495645_0712798 3300046543 Bacteria 608
326 Ga0495667_0019744 3300046559 Bacteria 4548
327 Ga0495667_0067687 3300046559 Unclassified 2333
328 Ga0495667_0119344 3300046559 Archaea 1703
329 Ga0495635_0051342 3300046663 Archaea 2842
330 Ga0495635_0620396 3300046663 Unclassified 705
331 Ga0495635_0660761 3300046663 Unclassified 680
332 Ga0495657_0107120 3300046675 Bacteria 1774
333 Ga0495657_0406146 3300046675 Unclassified 801
334 Ga0495623_0183233 3300046679 Unclassified 1215
335 Ga0495646_0067002 3300046680 Bacteria 2123
336 Ga0495658_0714496 3300046683 Unclassified 642
337 Ga0495613_0377555 3300046689 Bacteria 970
338 Ga0495600_0007309 3300046809 Bacteria 6751
339 Ga0495581_0251452 3300047315 Bacteria 1034
340 Ga0495604_0032955 3300047317 Bacteria 4103
341 Ga0495604_0098981 3300047317 Unclassified 2147
342 Ga0495604_0140481 3300047317 Unclassified 1726
343 Ga0495604_0301904 3300047317 Unclassified 1075
344 Ga0495604_0546833 3300047317 Unclassified 747
345 Ga0495674_0003236 3300047319 Bacteria 15813
346 Ga0495674_0009241 3300047319 Bacteria 9369
347 Ga0495674_0144438 3300047319 Bacteria 1998
348 Ga0495674_0214672 3300047319 Bacteria 1593
349 Ga0495680_0197651 3300047322 Unclassified 1444
350 Ga0495680_0304343 3300047322 Unclassified 1118
351 Ga0495675_0063103 3300047444 Bacteria 2345
352 Ga0495675_0078555 3300047444 Archaea 2078
353 Ga0495675_0134141 3300047444 Bacteria 1538
354 Ga0495675_0262476 3300047444 Bacteria 1034
355 Ga0495684_0002790 3300047471 Bacteria 13787
356 Ga0495684_0014601 3300047471 Bacteria 6045
357 Ga0495684_0055027 3300047471 Bacteria 3034
358 Ga0495684_0354913 3300047471 Bacteria 1040
359 Ga0495684_0530947 3300047471 Unclassified 804
360 Ga0495593_0356417 3300047673 Unclassified 731
361 Ga0495602_0002727 3300048088 Bacteria 18037
362 Ga0495602_0173228 3300048088 Archaea 1673
363 Ga0495602_0324811 3300048088 Unclassified 1118
364 Ga0495614_0396647 3300048089 Unclassified 648
365 Ga0496100_0706775 3300048903 Unclassified 787
366 Ga0496104_0132344 3300048907 Bacteria 2396
367 Ga0496112_1396371 3300048915 Unclassified 615
368 Ga0496115_0489583 3300048918 Unclassified 989
369 nmdc:mga05p37_354902_c1 3300050507 Unclassified 1725
370 nmdc:mga05p37_475792_c1 3300050507 Bacteria 1440
371 nmdc:mga09592_469205_c1 3300050508 Bacteria 1085
372 nmdc:mga0qj67_997965_c1 3300050509 Unclassified 657
373 nmdc:mga06r32_10428_c1 3300050510 Bacteria 8384
374 nmdc:mga08y16_2098417_c1 3300050511 Unclassified 513
375 nmdc:mga0n895_2017687_c1 3300050512 Unclassified 534
376 nmdc:mga0rr50_1326721_c1 3300050513 Unclassified 610
377 Ga0495601_0180670 3300053077 Bacteria 1380
378 Ga0495601_0999600 3300053077 Unclassified 526
379 Ga0501082_0002361 3300060353 Bacteria 16522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10543495 Ga0105248_105434952 108
2 3300042876 Ga0451577_1089727 Ga0451577_1089727_271_603 109
3 3300045051 Ga0451576_1652996 Ga0451576_1652996_90_422 109
4 3300031344 Ga0265316_10000788 Ga0265316_100007889 111
5 3300035118 Ga0373954_0164838 Ga0373954_0164838_530_910 111
6 3300035724 Ga0373933_0345634 Ga0373933_0345634_77_457 111
7 3300036401 Ga0373937_0585003 Ga0373937_0585003_248_628 111
8 3300028653 Ga0265323_10000210 Ga0265323_1000021020 112
9 3300031235 Ga0265330_10073270 Ga0265330_100732702 112
10 3300031344 Ga0265316_10694212 Ga0265316_106942122 112
11 3300005295 Ga0065707_10564622 Ga0065707_105646222 114
12 3300005330 Ga0070690_101187829 Ga0070690_1011878292 114
13 3300005718 Ga0068866_10733453 Ga0068866_107334532 114
14 3300006847 Ga0075431_100842342 Ga0075431_1008423422 114
15 3300006881 Ga0068865_100876003 Ga0068865_1008760032 114
16 3300007076 Ga0075435_101710311 Ga0075435_1017103112 114
17 3300009147 Ga0114129_10364419 Ga0114129_103644193 114
18 3300009148 Ga0105243_12882387 Ga0105243_128823871 114
19 3300009177 Ga0105248_11594036 Ga0105248_115940362 114
20 3300050507 nmdc:mga05p37_354902_c1 nmdc:mga05p37_354902_c1_926_1270 114
21 3300005518 Ga0070699_100249287 Ga0070699_1002492872 115
22 3300009147 Ga0114129_10327139 Ga0114129_103271392 115
23 3300031249 Ga0265339_10117584 Ga0265339_101175842 115
24 3300031711 Ga0265314_10465053 Ga0265314_104650532 115
25 3300050507 nmdc:mga05p37_475792_c1 nmdc:mga05p37_475792_c1_922_1269 115
26 3300005617 Ga0068859_100750705 Ga0068859_1007507051 116
27 3300006871 Ga0075434_101031517 Ga0075434_1010315172 116
28 3300006931 Ga0097620_100750719 Ga0097620_1007507191 116
29 3300005536 Ga0070697_100105284 Ga0070697_1001052843 118
30 3300047317 Ga0495604_0546833 Ga0495604_0546833_264_620 118
31 3300046543 Ga0495645_0712798 Ga0495645_0712798_44_418 119
32 3300005329 Ga0070683_100361412 Ga0070683_1003614122 120
33 3300005329 Ga0070683_100722578 Ga0070683_1007225782 120
34 3300005334 Ga0068869_100783977 Ga0068869_1007839771 120
35 3300005336 Ga0070680_100350984 Ga0070680_1003509842 120
36 3300005338 Ga0068868_101631004 Ga0068868_1016310041 120
37 3300005340 Ga0070689_100100549 Ga0070689_1001005492 120
38 3300005343 Ga0070687_100728644 Ga0070687_1007286441 120
39 3300005355 Ga0070671_101654545 Ga0070671_1016545451 120
40 3300005366 Ga0070659_101219061 Ga0070659_1012190611 120
41 3300005367 Ga0070667_101386826 Ga0070667_1013868261 120
42 3300005367 Ga0070667_101559350 Ga0070667_1015593501 120
43 3300005434 Ga0070709_10195270 Ga0070709_101952702 120
44 3300005435 Ga0070714_100375600 Ga0070714_1003756002 120
45 3300005439 Ga0070711_101000321 Ga0070711_1010003211 120
46 3300005445 Ga0070708_100284656 Ga0070708_1002846563 120
47 3300005456 Ga0070678_101461242 Ga0070678_1014612422 120
48 3300005458 Ga0070681_10020997 Ga0070681_100209973 120
49 3300005467 Ga0070706_100112474 Ga0070706_1001124745 120
50 3300005530 Ga0070679_100338667 Ga0070679_1003386672 120
51 3300005535 Ga0070684_100040679 Ga0070684_1000406792 120
52 3300005535 Ga0070684_100139921 Ga0070684_1001399211 120
53 3300005535 Ga0070684_100287473 Ga0070684_1002874731 120
54 3300005535 Ga0070684_100908261 Ga0070684_1009082611 120
55 3300005536 Ga0070697_100159198 Ga0070697_1001591982 120
56 3300005543 Ga0070672_100368265 Ga0070672_1003682651 120
57 3300005543 Ga0070672_101617749 Ga0070672_1016177491 120
58 3300005545 Ga0070695_100019355 Ga0070695_1000193556 120
59 3300005548 Ga0070665_100796330 Ga0070665_1007963302 120
60 3300005548 Ga0070665_101741246 Ga0070665_1017412461 120
61 3300005563 Ga0068855_100560962 Ga0068855_1005609622 120
62 3300005564 Ga0070664_100844285 Ga0070664_1008442852 120
63 3300005577 Ga0068857_101755431 Ga0068857_1017554312 120
64 3300005577 Ga0068857_102039108 Ga0068857_1020391081 120
65 3300005614 Ga0068856_101031869 Ga0068856_1010318691 120
66 3300005615 Ga0070702_101019513 Ga0070702_1010195132 120
67 3300005616 Ga0068852_100673477 Ga0068852_1006734772 120
68 3300005616 Ga0068852_101915237 Ga0068852_1019152372 120
69 3300005617 Ga0068859_100423639 Ga0068859_1004236392 120
70 3300005617 Ga0068859_100988123 Ga0068859_1009881232 120
71 3300005617 Ga0068859_101392707 Ga0068859_1013927072 120
72 3300005618 Ga0068864_101395201 Ga0068864_1013952012 120
73 3300005841 Ga0068863_100859145 Ga0068863_1008591452 120
74 3300005841 Ga0068863_101036385 Ga0068863_1010363852 120
75 3300005841 Ga0068863_102481116 Ga0068863_1024811162 120
76 3300005842 Ga0068858_101118305 Ga0068858_1011183052 120
77 3300005842 Ga0068858_101666888 Ga0068858_1016668882 120
78 3300006028 Ga0070717_10101357 Ga0070717_101013572 120
79 3300006028 Ga0070717_11179323 Ga0070717_111793232 120
80 3300006028 Ga0070717_11918465 Ga0070717_119184652 120
81 3300006173 Ga0070716_100450608 Ga0070716_1004506081 120
82 3300006173 Ga0070716_101497180 Ga0070716_1014971801 120
83 3300006237 Ga0097621_100426851 Ga0097621_1004268512 120
84 3300006237 Ga0097621_100506555 Ga0097621_1005065552 120
85 3300006237 Ga0097621_101197788 Ga0097621_1011977881 120
86 3300006358 Ga0068871_100666916 Ga0068871_1006669162 120
87 3300006358 Ga0068871_100774583 Ga0068871_1007745832 120
88 3300006358 Ga0068871_101046942 Ga0068871_1010469421 120
89 3300006358 Ga0068871_101654063 Ga0068871_1016540632 120
90 3300006846 Ga0075430_101113107 Ga0075430_1011131072 120
91 3300006847 Ga0075431_100002583 Ga0075431_10000258314 120
92 3300006880 Ga0075429_100510004 Ga0075429_1005100041 120
93 3300006931 Ga0097620_100423633 Ga0097620_1004236332 120
94 3300006931 Ga0097620_100988401 Ga0097620_1009884011 120
95 3300006931 Ga0097620_101392685 Ga0097620_1013926852 120
96 3300009093 Ga0105240_10012811 Ga0105240_100128112 120
97 3300009093 Ga0105240_10205698 Ga0105240_102056982 120
98 3300009093 Ga0105240_11080643 Ga0105240_110806432 120
99 3300009094 Ga0111539_10302071 Ga0111539_103020712 120
100 3300009094 Ga0111539_13382311 Ga0111539_133823111 120
101 3300009098 Ga0105245_11056404 Ga0105245_110564042 120
102 3300009101 Ga0105247_11053216 Ga0105247_110532162 120
103 3300009101 Ga0105247_11303125 Ga0105247_113031251 120
104 3300009174 Ga0105241_11053667 Ga0105241_110536672 120
105 3300009176 Ga0105242_10338159 Ga0105242_103381592 120
106 3300009176 Ga0105242_10730981 Ga0105242_107309812 120
107 3300009176 Ga0105242_11001785 Ga0105242_110017852 120
108 3300009176 Ga0105242_11861360 Ga0105242_118613601 120
109 3300009176 Ga0105242_12858854 Ga0105242_128588542 120
110 3300009176 Ga0105242_13306389 Ga0105242_133063891 120
111 3300009177 Ga0105248_10034373 Ga0105248_100343735 120
112 3300009177 Ga0105248_10035249 Ga0105248_100352494 120
113 3300009177 Ga0105248_10128601 Ga0105248_101286012 120
114 3300009177 Ga0105248_10273961 Ga0105248_102739612 120
115 3300009177 Ga0105248_10766429 Ga0105248_107664292 120
116 3300009177 Ga0105248_10818624 Ga0105248_108186242 120
117 3300009177 Ga0105248_12227578 Ga0105248_122275782 120
118 3300009545 Ga0105237_10122574 Ga0105237_101225743 120
119 3300009545 Ga0105237_11027592 Ga0105237_110275922 120
120 3300009545 Ga0105237_11206864 Ga0105237_112068641 120
121 3300009545 Ga0105237_11873360 Ga0105237_118733601 120
122 3300009551 Ga0105238_10505459 Ga0105238_105054592 120
123 3300009551 Ga0105238_10946360 Ga0105238_109463602 120
124 3300009551 Ga0105238_12735969 Ga0105238_127359691 120
125 3300010375 Ga0105239_10490147 Ga0105239_104901471 120
126 3300010375 Ga0105239_10545770 Ga0105239_105457701 120
127 3300010375 Ga0105239_11204741 Ga0105239_112047411 120
128 3300010375 Ga0105239_12180412 Ga0105239_121804122 120
129 3300013104 Ga0157370_10354757 Ga0157370_103547572 120
130 3300013104 Ga0157370_10635463 Ga0157370_106354632 120
131 3300013104 Ga0157370_11402173 Ga0157370_114021732 120
132 3300013105 Ga0157369_10183058 Ga0157369_101830582 120
133 3300013296 Ga0157374_10555054 Ga0157374_105550541 120
134 3300013296 Ga0157374_10845308 Ga0157374_108453082 120
135 3300013296 Ga0157374_11228549 Ga0157374_112285491 120
136 3300013297 Ga0157378_10270061 Ga0157378_102700612 120
137 3300013297 Ga0157378_10465835 Ga0157378_104658352 120
138 3300013306 Ga0163162_10587650 Ga0163162_105876502 120
139 3300013306 Ga0163162_10624910 Ga0163162_106249102 120
140 3300013308 Ga0157375_10442449 Ga0157375_104424492 120
141 3300013308 Ga0157375_10630182 Ga0157375_106301822 120
142 3300013308 Ga0157375_10992273 Ga0157375_109922731 120
143 3300014325 Ga0163163_10176375 Ga0163163_101763751 120
144 3300014325 Ga0163163_10425159 Ga0163163_104251593 120
145 3300014325 Ga0163163_10922550 Ga0163163_109225502 120
146 3300014325 Ga0163163_11177678 Ga0163163_111776781 120
147 3300014325 Ga0163163_12279455 Ga0163163_122794551 120
148 3300014325 Ga0163163_13117143 Ga0163163_131171431 120
149 3300014745 Ga0157377_10255885 Ga0157377_102558852 120
150 3300014968 Ga0157379_10214812 Ga0157379_102148122 120
151 3300014969 Ga0157376_10031055 Ga0157376_100310554 120
152 3300014969 Ga0157376_10096469 Ga0157376_100964693 120
153 3300014969 Ga0157376_10926353 Ga0157376_109263532 120
154 3300014969 Ga0157376_11488999 Ga0157376_114889991 120
155 3300014969 Ga0157376_11708610 Ga0157376_117086101 120
156 3300017792 Ga0163161_10891879 Ga0163161_108918791 120
157 3300021388 Ga0213875_10333812 Ga0213875_103338122 120
158 3300025898 Ga0207692_10926102 Ga0207692_109261022 120
159 3300025903 Ga0207680_10313061 Ga0207680_103130612 120
160 3300025910 Ga0207684_10082784 Ga0207684_100827843 120
161 3300025912 Ga0207707_10011586 Ga0207707_100115868 120
162 3300025913 Ga0207695_10113577 Ga0207695_101135772 120
163 3300025914 Ga0207671_10162502 Ga0207671_101625022 120
164 3300025914 Ga0207671_11097072 Ga0207671_110970722 120
165 3300025917 Ga0207660_10634606 Ga0207660_106346062 120
166 3300025918 Ga0207662_10880863 Ga0207662_108808631 120
167 3300025921 Ga0207652_10051882 Ga0207652_100518822 120
168 3300025921 Ga0207652_11022266 Ga0207652_110222661 120
169 3300025923 Ga0207681_10789598 Ga0207681_107895981 120
170 3300025924 Ga0207694_10486224 Ga0207694_104862242 120
171 3300025924 Ga0207694_10993059 Ga0207694_109930592 120
172 3300025925 Ga0207650_10949678 Ga0207650_109496782 120
173 3300025925 Ga0207650_11546228 Ga0207650_115462282 120
174 3300025926 Ga0207659_11693652 Ga0207659_116936521 120
175 3300025927 Ga0207687_10245613 Ga0207687_102456132 120
176 3300025929 Ga0207664_10909899 Ga0207664_109098991 120
177 3300025934 Ga0207686_11101779 Ga0207686_111017792 120
178 3300025936 Ga0207670_10074605 Ga0207670_100746052 120
179 3300025936 Ga0207670_10242690 Ga0207670_102426902 120
180 3300025936 Ga0207670_10613252 Ga0207670_106132522 120
181 3300025937 Ga0207669_10833025 Ga0207669_108330252 120
182 3300025939 Ga0207665_11559269 Ga0207665_115592691 120
183 3300025940 Ga0207691_10364135 Ga0207691_103641351 120
184 3300025941 Ga0207711_10073253 Ga0207711_100732533 120
185 3300025941 Ga0207711_10092432 Ga0207711_100924323 120
186 3300025941 Ga0207711_10157957 Ga0207711_101579572 120
187 3300025941 Ga0207711_10433854 Ga0207711_104338542 120
188 3300025944 Ga0207661_10107369 Ga0207661_101073693 120
189 3300025944 Ga0207661_10548343 Ga0207661_105483432 120
190 3300025960 Ga0207651_10274026 Ga0207651_102740263 120
191 3300025986 Ga0207658_10600359 Ga0207658_106003592 120
192 3300026023 Ga0207677_11061410 Ga0207677_110614102 120
193 3300026023 Ga0207677_12018253 Ga0207677_120182532 120
194 3300026035 Ga0207703_10587358 Ga0207703_105873582 120
195 3300026035 Ga0207703_10714623 Ga0207703_107146232 120
196 3300026095 Ga0207676_10067723 Ga0207676_100677232 120
197 3300026121 Ga0207683_10993934 Ga0207683_109939342 120
198 3300026121 Ga0207683_11840444 Ga0207683_118404441 120
199 3300026142 Ga0207698_10063023 Ga0207698_100630232 120
200 3300028379 Ga0268266_10142494 Ga0268266_101424942 120
201 3300028379 Ga0268266_10153832 Ga0268266_101538322 120
202 3300028379 Ga0268266_11453714 Ga0268266_114537142 120
203 3300030760 Ga0265762_1039877 Ga0265762_10398771 120
204 3300031090 Ga0265760_10044542 Ga0265760_100445422 120
205 3300031238 Ga0265332_10140438 Ga0265332_101404382 120
206 3300031239 Ga0265328_10218804 Ga0265328_102188042 120
207 3300031242 Ga0265329_10193713 Ga0265329_101937132 120
208 3300031344 Ga0265316_10001101 Ga0265316_1000110114 120
209 3300031344 Ga0265316_10013606 Ga0265316_100136062 120
210 3300031344 Ga0265316_10027733 Ga0265316_100277333 120
211 3300031344 Ga0265316_10098625 Ga0265316_100986252 120
212 3300035083 Ga0373926_0037013 Ga0373926_0037013_1257_1619 120
213 3300035086 Ga0373934_0249660 Ga0373934_0249660_127_495 120
214 3300035113 Ga0373936_0109700 Ga0373936_0109700_288_650 120
215 3300035116 Ga0373945_0054285 Ga0373945_0054285_1013_1375 120
216 3300035118 Ga0373954_0078936 Ga0373954_0078936_57_437 120
217 3300035118 Ga0373954_0093941 Ga0373954_0093941_127_495 120
218 3300035119 Ga0373956_0057034 Ga0373956_0057034_1316_1684 120
219 3300035120 Ga0373957_0061696 Ga0373957_0061696_233_613 120
220 3300035170 Ga0373943_0578539 Ga0373943_0578539_286_648 120
221 3300035170 Ga0373943_0624233 Ga0373943_0624233_148_528 120
222 3300035172 Ga0373955_0123325 Ga0373955_0123325_208_576 120
223 3300035172 Ga0373955_0205147 Ga0373955_0205147_15_395 120
224 3300035692 Ga0373935_0056646 Ga0373935_0056646_66_428 120
225 3300035692 Ga0373935_0623463 Ga0373935_0623463_269_649 120
226 3300035695 Ga0373927_0001310 Ga0373927_0001310_4446_4808 120
227 3300035695 Ga0373927_0014589 Ga0373927_0014589_4310_4678 120
228 3300035695 Ga0373927_0093276 Ga0373927_0093276_1410_1790 120
229 3300035695 Ga0373927_0254611 Ga0373927_0254611_337_705 120
230 3300035695 Ga0373927_0975357 Ga0373927_0975357_86_466 120
231 3300035725 Ga0373947_0012635 Ga0373947_0012635_379_741 120
232 3300035725 Ga0373947_0364605 Ga0373947_0364605_552_914 120
233 3300036401 Ga0373937_0063251 Ga0373937_0063251_670_1038 120
234 3300036401 Ga0373937_0321253 Ga0373937_0321253_201_581 120
235 3300037068 Ga0373925_0000134 Ga0373925_0000134_78231_78593 120
236 3300037068 Ga0373925_0017393 Ga0373925_0017393_670_1050 120
237 3300037068 Ga0373925_0148851 Ga0373925_0148851_759_1127 120
238 3300037068 Ga0373925_0941533 Ga0373925_0941533_29_409 120
239 3300037068 Ga0373925_1137446 Ga0373925_1137446_95_475 120
240 3300037068 Ga0373925_1446099 Ga0373925_1446099_99_479 120
241 3300037853 Ga0436364_1274819 Ga0436364_1274819_2159_2539 120
242 3300039437 Ga0436365_1675121 Ga0436365_1675121_1575_1958 120
243 3300044673 Ga0453683_0081991 Ga0453683_0081991_113_508 120
244 3300044684 Ga0466966_0483125 Ga0466966_0483125_200_580 120
245 3300044694 Ga0466963_0380486 Ga0466963_0380486_560_940 120
246 3300045049 Ga0466959_0655505 Ga0466959_0655505_131_511 120
247 3300045051 Ga0451576_0018852 Ga0451576_0018852_5090_5464 120
248 3300045051 Ga0451576_0253384 Ga0451576_0253384_337_717 120
249 3300045051 Ga0451576_0950176 Ga0451576_0950176_406_774 120
250 3300045051 Ga0451576_1119731 Ga0451576_1119731_15_395 120
251 3300045051 Ga0451576_1429158 Ga0451576_1429158_93_461 120
252 3300046454 Ga0495592_0009761 Ga0495592_0009761_1300_1680 120
253 3300046454 Ga0495592_0402308 Ga0495592_0402308_151_531 120
254 3300046454 Ga0495592_0955002 Ga0495592_0955002_47_427 120
255 3300046462 Ga0495651_0008441 Ga0495651_0008441_4632_5012 120
256 3300046462 Ga0495651_0016669 Ga0495651_0016669_1148_1528 120
257 3300046462 Ga0495651_0215518 Ga0495651_0215518_584_964 120
258 3300046463 Ga0495653_0071605 Ga0495653_0071605_79_459 120
259 3300046472 Ga0495580_0002410 Ga0495580_0002410_10122_10502 120
260 3300046472 Ga0495580_0043807 Ga0495580_0043807_632_1012 120
261 3300046472 Ga0495580_0090823 Ga0495580_0090823_1722_2090 120
262 3300046472 Ga0495580_0185487 Ga0495580_0185487_376_744 120
263 3300046472 Ga0495580_0274936 Ga0495580_0274936_568_948 120
264 3300046472 Ga0495580_0377755 Ga0495580_0377755_46_426 120
265 3300046472 Ga0495580_0476529 Ga0495580_0476529_335_709 120
266 3300046473 Ga0495582_0575482 Ga0495582_0575482_221_589 120
267 3300046476 Ga0495662_0005975 Ga0495662_0005975_1879_2259 120
268 3300046477 Ga0495664_0001299 Ga0495664_0001299_7019_7399 120
269 3300046511 Ga0495608_0160869 Ga0495608_0160869_457_837 120
270 3300046516 Ga0495628_0004454 Ga0495628_0004454_5256_5636 120
271 3300046516 Ga0495628_0143323 Ga0495628_0143323_244_624 120
272 3300046517 Ga0495630_0595690 Ga0495630_0595690_90_470 120
273 3300046526 Ga0495666_0176531 Ga0495666_0176531_112_492 120
274 3300046529 Ga0495652_0536492 Ga0495652_0536492_413_793 120
275 3300046531 Ga0495665_0066207 Ga0495665_0066207_1043_1423 120
276 3300046531 Ga0495665_0184317 Ga0495665_0184317_683_1063 120
277 3300046531 Ga0495665_0202136 Ga0495665_0202136_261_629 120
278 3300046535 Ga0495586_0755170 Ga0495586_0755170_39_401 120
279 3300046536 Ga0495587_0022921 Ga0495587_0022921_190_570 120
280 3300046536 Ga0495587_0047148 Ga0495587_0047148_1861_2241 120
281 3300046536 Ga0495587_0086817 Ga0495587_0086817_332_712 120
282 3300046543 Ga0495645_0023792 Ga0495645_0023792_3581_3961 120
283 3300046543 Ga0495645_0047392 Ga0495645_0047392_1679_2059 120
284 3300046543 Ga0495645_0354352 Ga0495645_0354352_34_414 120
285 3300046559 Ga0495667_0019744 Ga0495667_0019744_4110_4490 120
286 3300046559 Ga0495667_0067687 Ga0495667_0067687_648_1028 120
287 3300046559 Ga0495667_0119344 Ga0495667_0119344_888_1268 120
288 3300046663 Ga0495635_0051342 Ga0495635_0051342_1631_2011 120
289 3300046663 Ga0495635_0620396 Ga0495635_0620396_175_555 120
290 3300046663 Ga0495635_0660761 Ga0495635_0660761_253_633 120
291 3300046675 Ga0495657_0107120 Ga0495657_0107120_1281_1661 120
292 3300046675 Ga0495657_0406146 Ga0495657_0406146_372_752 120
293 3300046679 Ga0495623_0183233 Ga0495623_0183233_231_611 120
294 3300046680 Ga0495646_0067002 Ga0495646_0067002_421_801 120
295 3300046683 Ga0495658_0714496 Ga0495658_0714496_41_421 120
296 3300046689 Ga0495613_0377555 Ga0495613_0377555_79_459 120
297 3300046809 Ga0495600_0007309 Ga0495600_0007309_4201_4581 120
298 3300047315 Ga0495581_0251452 Ga0495581_0251452_611_991 120
299 3300047317 Ga0495604_0032955 Ga0495604_0032955_3602_3982 120
300 3300047317 Ga0495604_0098981 Ga0495604_0098981_1588_1968 120
301 3300047317 Ga0495604_0140481 Ga0495604_0140481_381_761 120
302 3300047317 Ga0495604_0301904 Ga0495604_0301904_116_496 120
303 3300047319 Ga0495674_0003236 Ga0495674_0003236_8746_9114 120
304 3300047319 Ga0495674_0009241 Ga0495674_0009241_796_1176 120
305 3300047319 Ga0495674_0144438 Ga0495674_0144438_1225_1605 120
306 3300047319 Ga0495674_0214672 Ga0495674_0214672_99_479 120
307 3300047322 Ga0495680_0197651 Ga0495680_0197651_476_856 120
308 3300047322 Ga0495680_0304343 Ga0495680_0304343_274_654 120
309 3300047444 Ga0495675_0063103 Ga0495675_0063103_1479_1847 120
310 3300047444 Ga0495675_0078555 Ga0495675_0078555_935_1315 120
311 3300047444 Ga0495675_0134141 Ga0495675_0134141_1007_1387 120
312 3300047444 Ga0495675_0262476 Ga0495675_0262476_15_395 120
313 3300047471 Ga0495684_0002790 Ga0495684_0002790_7992_8372 120
314 3300047471 Ga0495684_0014601 Ga0495684_0014601_268_648 120
315 3300047471 Ga0495684_0055027 Ga0495684_0055027_1202_1582 120
316 3300047471 Ga0495684_0354913 Ga0495684_0354913_311_691 120
317 3300047673 Ga0495593_0356417 Ga0495593_0356417_287_667 120
318 3300048088 Ga0495602_0002727 Ga0495602_0002727_7857_8237 120
319 3300048088 Ga0495602_0173228 Ga0495602_0173228_1107_1487 120
320 3300048088 Ga0495602_0324811 Ga0495602_0324811_262_642 120
321 3300048089 Ga0495614_0396647 Ga0495614_0396647_47_427 120
322 3300048915 Ga0496112_1396371 Ga0496112_1396371_42_422 120
323 3300048918 Ga0496115_0489583 Ga0496115_0489583_328_708 120
324 3300050508 nmdc:mga09592_469205_c1 nmdc:mga09592_469205_c1_518_880 120
325 3300050509 nmdc:mga0qj67_997965_c1 nmdc:mga0qj67_997965_c1_51_419 120
326 3300050510 nmdc:mga06r32_10428_c1 nmdc:mga06r32_10428_c1_5531_5893 120
327 3300050511 nmdc:mga08y16_2098417_c1 nmdc:mga08y16_2098417_c1_90_464 120
328 3300050512 nmdc:mga0n895_2017687_c1 nmdc:mga0n895_2017687_c1_36_416 120
329 3300053077 Ga0495601_0180670 Ga0495601_0180670_313_693 120
330 3300053077 Ga0495601_0999600 Ga0495601_0999600_92_472 120
331 3300060353 Ga0501082_0002361 Ga0501082_0002361_611_991 120
332 3300005327 Ga0070658_10251650 Ga0070658_102516502 121
333 3300005336 Ga0070680_101305514 Ga0070680_1013055141 121
334 3300005355 Ga0070671_100969102 Ga0070671_1009691022 121
335 3300005458 Ga0070681_10354282 Ga0070681_103542822 121
336 3300005530 Ga0070679_100944423 Ga0070679_1009444232 121
337 3300005577 Ga0068857_101200829 Ga0068857_1012008292 121
338 3300009093 Ga0105240_10010091 Ga0105240_100100912 121
339 3300009177 Ga0105248_12961563 Ga0105248_129615631 121
340 3300009545 Ga0105237_10001392 Ga0105237_1000139230 121
341 3300010375 Ga0105239_12433837 Ga0105239_124338372 121
342 3300025912 Ga0207707_10462723 Ga0207707_104627232 121
343 3300025913 Ga0207695_10023524 Ga0207695_100235248 121
344 3300025914 Ga0207671_10061861 Ga0207671_100618612 121
345 3300025921 Ga0207652_10691259 Ga0207652_106912592 121
346 3300025931 Ga0207644_10771464 Ga0207644_107714642 121
347 3300026116 Ga0207674_12026583 Ga0207674_120265832 121
348 3300004801 Ga0058860_11431909 Ga0058860_114319092 122
349 3300005330 Ga0070690_100613322 Ga0070690_1006133221 122
350 3300005337 Ga0070682_101366283 Ga0070682_1013662831 122
351 3300005340 Ga0070689_101621074 Ga0070689_1016210742 122
352 3300005434 Ga0070709_10078170 Ga0070709_100781703 122
353 3300005439 Ga0070711_100385744 Ga0070711_1003857443 122
354 3300005467 Ga0070706_100641402 Ga0070706_1006414022 122
355 3300005530 Ga0070679_100813052 Ga0070679_1008130522 122
356 3300005536 Ga0070697_100287388 Ga0070697_1002873882 122
357 3300005547 Ga0070693_100287733 Ga0070693_1002877332 122
358 3300005549 Ga0070704_100340531 Ga0070704_1003405312 122
359 3300005842 Ga0068858_101693975 Ga0068858_1016939751 122
360 3300006028 Ga0070717_11485209 Ga0070717_114852092 122
361 3300006914 Ga0075436_100037531 Ga0075436_1000375311 122
362 3300007076 Ga0075435_100360934 Ga0075435_1003609342 122
363 3300009093 Ga0105240_11023568 Ga0105240_110235682 122
364 3300009098 Ga0105245_10648571 Ga0105245_106485712 122
365 3300009177 Ga0105248_10972986 Ga0105248_109729861 122
366 3300009545 Ga0105237_10567552 Ga0105237_105675522 122
367 3300013296 Ga0157374_10931548 Ga0157374_109315482 122
368 3300013297 Ga0157378_10106825 Ga0157378_101068253 122
369 3300014968 Ga0157379_10787035 Ga0157379_107870352 122
370 3300014968 Ga0157379_11495063 Ga0157379_114950631 122
371 3300025910 Ga0207684_11417075 Ga0207684_114170751 122
372 3300025927 Ga0207687_10298236 Ga0207687_102982362 122
373 3300035117 Ga0373953_0142532 Ga0373953_0142532_20_520 122
374 3300035691 Ga0373931_0677931 Ga0373931_0677931_162_530 122
375 3300035691 Ga0373931_0799628 Ga0373931_0799628_21_389 122
376 3300047471 Ga0495684_0530947 Ga0495684_0530947_168_563 122
377 3300048903 Ga0496100_0706775 Ga0496100_0706775_273_641 122
378 3300048907 Ga0496104_0132344 Ga0496104_0132344_83_451 122
379 3300050513 nmdc:mga0rr50_1326721_c1 nmdc:mga0rr50_1326721_c1_121_498 122

Structural Annotation

Top 5 Hits

ID Description Score Start End
1di2-assembly1.cif.gz_A crystal structure of a dsrna-binding domain complexed with dsrna: molecular basis of double-stranded rna-protein interactions 0.8142 18 55
3adl-assembly1.cif.gz_A structure of trbp2 and its molecule implications for mirna processing 0.7714 18 55
2cpn-assembly1.cif.gz_A solution structure of the second dsrbd of tar rna-binding protein 2 0.7682 18 55
6w90-assembly1.cif.gz_A de novo designed ntf2 fold protein nt-9 0.7645 22 59
4lmi-assembly1.cif.gz_A crystal structure of putative ketosteroid isomerase from kribbella flavida dsm 17836 0.7336 20 59
ID Description Score Start End Superfamily
af_A0A2R8Q731_63_142_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8251 20 55 3.30.160.20
af_Q7ZW47_6_74_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7923 18 55 3.30.160.20
4m2zB02 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7838 20 55 3.30.160.20
af_Q9WTX2_32_106_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7802 18 55 3.30.160.20
2ljhA01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7424 22 55 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A7C5AWZ4-F1-model_v4 Uncharacterized protein 0.9612 5 118
AF-A0A7R8GF08-F1-model_v4 deleted 0.9547 4 116
AF-A0A2U3L3T5-F1-model_v4 Uncharacterized protein 0.9504 4 121
AF-A0A7V5YRF4-F1-model_v4 Uncharacterized protein 0.942 4 116
AF-A0A7C3DCK6-F1-model_v4 Uncharacterized protein 0.94 2 121

Feature Viewer

pLDDT pTM Quality
85.26 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map