F428322

General Info

Members Datasets Scaffolds Average Seq Length
379 225 379 572

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10012271|Ga0099795_100122711
Length 633
Sequence LTNEIPVDCARSGDYFDHLDEPTGCTLISSALRGRGSQEGKMTAPVIRNLLLTALLLPTSGAAQNAVPTQHNEATVAQLQAEMASGRLTAEQLTKEYIGRIAALDQNGPGVNAVIELNPDALVMARNADALRRRGVVLGPLHGIPVLLKDNIDTGDKMQTSAGSFALVGMPALRDSTVAANLRAGGAVILGKTNLSEWANFRSFESISGWSGRGGQTHNPYGIDRNPCGSFGSETDGSIVCPGNANGVVAIKPTVGLTSRAGVVPISHTQDTVGPHGRTVADAAAALSVIQSRTFDGRDPATAGVPLGWQGTGKTRPTNIPTDYTQFVDLNGLQGARLGVTRVGLNGFGNVTTPQPVLEAFEEAMQALQNAGASVIDLDAAGFTFSPADGEFLVLLYDFKFDVANYFKTRVRVPVAGGTLQTAIDFNNAHTGTEMPFFNQDIFDFAESINPDPNFCEPGFTSGVLPTTASCMSYNDALKIGHLAGANGIDAALAQFNLDAVVSATDNPAWATDLLFGDHFIFGTSGLAAAPGYPIVQVPAAFPKLCASPTQPTNCTQYGVPLGISFFGTAFSEPKLIKLASGFEAATQVRAHNLPTFAATAPSTNIQGTTLTVPHRHAAPPASANAKKVPHHL

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
156 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 2.9
Rhizosphere 91.03
Stem 0
Stem Tuber 0
Unclassified 5.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10015747 3300003323 Bacteria 9193
2 Ga0065714_10002938 3300005288 Bacteria 9513
3 Ga0065704_10006929 3300005289 Bacteria 5514
4 Ga0065715_10090294 3300005293 Bacteria 7282
5 Ga0070676_10011260 3300005328 Unclassified 4863
6 Ga0070683_100090305 3300005329 Bacteria 2876
7 Ga0070670_100050504 3300005331 Bacteria 3573
8 Ga0070670_100171758 3300005331 Bacteria 1880
9 Ga0070666_10043453 3300005335 Bacteria 3010
10 Ga0070666_10093277 3300005335 Bacteria 2070
11 Ga0070682_100044845 3300005337 Bacteria 2739
12 Ga0068868_100062376 3300005338 Bacteria 2954
13 Ga0068868_100123372 3300005338 Bacteria 2114
14 Ga0070689_100013949 3300005340 Bacteria 5829
15 Ga0070689_100024132 3300005340 Bacteria 4560
16 Ga0070687_100030825 3300005343 Bacteria 2624
17 Ga0070668_100006773 3300005347 Bacteria 8495
18 Ga0070668_100018538 3300005347 Bacteria 5226
19 Ga0070669_100007746 3300005353 Bacteria 7678
20 Ga0070669_100012981 3300005353 Bacteria 5915
21 Ga0070675_100022069 3300005354 Bacteria 5086
22 Ga0070674_100010070 3300005356 Bacteria 5693
23 Ga0070674_100031235 3300005356 Bacteria 3527
24 Ga0070673_100013569 3300005364 Bacteria 5644
25 Ga0070673_100014084 3300005364 Bacteria 5556
26 Ga0070688_100003908 3300005365 Bacteria 7732
27 Ga0070688_100005607 3300005365 Bacteria 6625
28 Ga0070659_100000527 3300005366 Bacteria 27961
29 Ga0070667_100057190 3300005367 Bacteria 3296
30 Ga0070667_100082805 3300005367 Bacteria 2747
31 Ga0070667_100144240 3300005367 Bacteria 2087
32 Ga0070713_100056722 3300005436 Bacteria 3258
33 Ga0070713_100075836 3300005436 Bacteria 2853
34 Ga0070713_100128751 3300005436 Bacteria 2230
35 Ga0070708_100000569 3300005445 Bacteria 27643
36 Ga0070708_100005176 3300005445 Bacteria 10323
37 Ga0070708_100010647 3300005445 Bacteria 7458
38 Ga0070708_100063479 3300005445 Unclassified 3306
39 Ga0070678_100047303 3300005456 Bacteria 3090
40 Ga0070681_10000508 3300005458 Bacteria 31809
41 Ga0070681_10053755 3300005458 Bacteria 4013
42 Ga0068867_100009755 3300005459 Bacteria 6766
43 Ga0068867_100025139 3300005459 Bacteria 4272
44 Ga0068867_100041938 3300005459 Bacteria 3344
45 Ga0070706_100000084 3300005467 Bacteria 109077
46 Ga0070706_100000210 3300005467 Bacteria 71893
47 Ga0070706_100031923 3300005467 Bacteria 4856
48 Ga0070706_100036522 3300005467 Bacteria 4538
49 Ga0070706_100059306 3300005467 Bacteria 3531
50 Ga0070706_100074398 3300005467 Bacteria 3144
51 Ga0070706_100110216 3300005467 Bacteria 2561
52 Ga0070707_100000921 3300005468 Bacteria 29187
53 Ga0070707_100011410 3300005468 Bacteria 8286
54 Ga0070707_100016015 3300005468 Bacteria 7034
55 Ga0070707_100020926 3300005468 Bacteria 6176
56 Ga0070707_100027194 3300005468 Bacteria 5441
57 Ga0070707_100038569 3300005468 Unclassified 4563
58 Ga0070707_100082998 3300005468 Unclassified 3096
59 Ga0070707_100107192 3300005468 Bacteria 2710
60 Ga0070707_100121309 3300005468 Bacteria 2538
61 Ga0070698_100073435 3300005471 Bacteria 3427
62 Ga0070698_100181691 3300005471 Bacteria 2042
63 Ga0070699_100000496 3300005518 Bacteria 37333
64 Ga0070699_100032053 3300005518 Bacteria 4538
65 Ga0070699_100033902 3300005518 Bacteria 4411
66 Ga0070699_100047532 3300005518 Bacteria 3713
67 Ga0070699_100064704 3300005518 Bacteria 3172
68 Ga0070684_100006345 3300005535 Bacteria 9137
69 Ga0070697_100000246 3300005536 Bacteria 44044
70 Ga0070697_100005201 3300005536 Bacteria 9994
71 Ga0070697_100007344 3300005536 Bacteria 8572
72 Ga0070697_100037369 3300005536 Bacteria 3922
73 Ga0070672_100019102 3300005543 Bacteria 4967
74 Ga0070672_100055257 3300005543 Bacteria 3110
75 Ga0070672_100064271 3300005543 Bacteria 2899
76 Ga0070686_100008506 3300005544 Bacteria 5748
77 Ga0070695_100002610 3300005545 Bacteria 10409
78 Ga0070665_100002500 3300005548 Bacteria 20221
79 Ga0070665_100005755 3300005548 Bacteria 12726
80 Ga0070665_100011357 3300005548 Bacteria 9006
81 Ga0070665_100115224 3300005548 Bacteria 2690
82 Ga0068855_100002522 3300005563 Bacteria 22554
83 Ga0068855_100073543 3300005563 Bacteria 3971
84 Ga0068857_100000556 3300005577 Bacteria 27260
85 Ga0068854_100007304 3300005578 Bacteria 7059
86 Ga0068856_100025155 3300005614 Bacteria 5801
87 Ga0068856_100064531 3300005614 Bacteria 3618
88 Ga0068856_100107886 3300005614 Bacteria 2780
89 Ga0070702_100010816 3300005615 Unclassified 4513
90 Ga0068852_100092895 3300005616 Bacteria 2703
91 Ga0068859_100000528 3300005617 Bacteria 37973
92 Ga0068859_100010970 3300005617 Bacteria 9121
93 Ga0068859_100151264 3300005617 Bacteria 2396
94 Ga0068864_100092615 3300005618 Bacteria 2668
95 Ga0068861_100084655 3300005719 Bacteria 2490
96 Ga0068851_10015519 3300005834 Bacteria 3630
97 Ga0068870_10005121 3300005840 Bacteria 5702
98 Ga0068863_100001383 3300005841 Bacteria 24073
99 Ga0068858_100004958 3300005842 Bacteria 13041
100 Ga0068858_100022963 3300005842 Bacteria 5817
101 Ga0068860_100000566 3300005843 Bacteria 44586
102 Ga0068862_100071086 3300005844 Bacteria 3005
103 Ga0070717_10002711 3300006028 Bacteria 12488
104 Ga0070717_10008639 3300006028 Bacteria 7616
105 Ga0070717_10029770 3300006028 Bacteria 4384
106 Ga0070717_10033330 3300006028 Bacteria 4155
107 Ga0075432_10005125 3300006058 Bacteria 4465
108 Ga0070716_100010341 3300006173 Bacteria 4675
109 Ga0070716_100039995 3300006173 Bacteria 2606
110 Ga0070712_100012681 3300006175 Bacteria 5366
111 Ga0070712_100043992 3300006175 Bacteria 3077
112 Ga0097621_100027840 3300006237 Bacteria 4449
113 Ga0068871_100052497 3300006358 Bacteria 3301
114 Ga0068871_100148221 3300006358 Bacteria 2000
115 Ga0068865_100001494 3300006881 Bacteria 13636
116 Ga0068865_100004875 3300006881 Bacteria 8118
117 Ga0068865_100046178 3300006881 Bacteria 2988
118 Ga0097620_100000528 3300006931 Bacteria 37973
119 Ga0097620_100010970 3300006931 Bacteria 9121
120 Ga0097620_100151261 3300006931 Bacteria 2396
121 Ga0075435_100039700 3300007076 Bacteria 3757
122 Ga0075435_100121102 3300007076 Bacteria 2183
123 Ga0099794_10004737 3300007265 Bacteria 5390
124 Ga0099794_10027526 3300007265 Bacteria 2636
125 Ga0099795_10012271 3300007788 Unclassified 2593
126 Ga0105250_10020647 3300009092 Bacteria 2661
127 Ga0105240_10002073 3300009093 Bacteria 32845
128 Ga0105240_10015909 3300009093 Bacteria 10206
129 Ga0105240_10112468 3300009093 Bacteria 3291
130 Ga0105240_10131063 3300009093 Bacteria 3008
131 Ga0105240_10179048 3300009093 Bacteria 2504
132 Ga0105245_10079643 3300009098 Bacteria 2991
133 Ga0105247_10000304 3300009101 Bacteria 44112
134 Ga0114129_10005859 3300009147 Bacteria 17398
135 Ga0105242_10001003 3300009176 Bacteria 22140
136 Ga0105237_10094783 3300009545 Bacteria 2974
137 Ga0105238_10046293 3300009551 Bacteria 4390
138 Ga0105238_10102061 3300009551 Bacteria 2851
139 Ga0105249_10162030 3300009553 Bacteria 2162
140 Ga0099796_10001310 3300010159 Bacteria 4928
141 Ga0099796_10001504 3300010159 Bacteria 4726
142 Ga0105239_10018881 3300010375 Bacteria 7618
143 Ga0105246_10007398 3300011119 Bacteria 6729
144 Ga0157373_10007743 3300013100 Bacteria 7985
145 Ga0157371_10007984 3300013102 Bacteria 8485
146 Ga0157369_10133261 3300013105 Bacteria 2632
147 Ga0157374_10036661 3300013296 Bacteria 4493
148 Ga0157374_10182428 3300013296 Bacteria 2051
149 Ga0157378_10027143 3300013297 Bacteria 5052
150 Ga0157378_10060656 3300013297 Bacteria 3375
151 Ga0157378_10083137 3300013297 Bacteria 2896
152 Ga0157378_10091382 3300013297 Bacteria 2767
153 Ga0157378_10096655 3300013297 Bacteria 2692
154 Ga0157378_10102112 3300013297 Bacteria 2619
155 Ga0163162_10026803 3300013306 Bacteria 5698
156 Ga0163162_10134366 3300013306 Bacteria 2584
157 Ga0163162_10212037 3300013306 Bacteria 2067
158 Ga0157372_10033333 3300013307 Bacteria 5656
159 Ga0157372_10219318 3300013307 Bacteria 2205
160 Ga0157375_10010011 3300013308 Bacteria 8336
161 Ga0157375_10023874 3300013308 Bacteria 5649
162 Ga0157375_10103632 3300013308 Bacteria 2933
163 Ga0157377_10000510 3300014745 Bacteria 16489
164 Ga0157379_10004099 3300014968 Bacteria 12435
165 Ga0157376_10010978 3300014969 Bacteria 6654
166 Ga0157376_10045777 3300014969 Bacteria 3605
167 Ga0182007_10008225 3300015262 Bacteria 4298
168 Ga0163161_10008846 3300017792 Bacteria 6963
169 Ga0206352_10940153 3300020078 Bacteria 1912
170 Ga0213876_10020083 3300021384 Bacteria 3530
171 Ga0224712_10028393 3300022467 Bacteria 1999
172 Ga0207697_10004645 3300025315 Bacteria 6517
173 Ga0207697_10031841 3300025315 Bacteria 2158
174 Ga0207682_10023566 3300025893 Bacteria 2432
175 Ga0207692_10029157 3300025898 Bacteria 2619
176 Ga0207710_10000118 3300025900 Bacteria 97453
177 Ga0207688_10015865 3300025901 Bacteria 4087
178 Ga0207680_10009348 3300025903 Bacteria 4859
179 Ga0207680_10024779 3300025903 Bacteria 3298
180 Ga0207699_10027104 3300025906 Bacteria 3168
181 Ga0207645_10001234 3300025907 Bacteria 21056
182 Ga0207645_10013051 3300025907 Bacteria 5614
183 Ga0207643_10002519 3300025908 Bacteria 9907
184 Ga0207684_10000006 3300025910 Bacteria 688605
185 Ga0207684_10000028 3300025910 Bacteria 306450
186 Ga0207684_10000040 3300025910 Bacteria 262703
187 Ga0207684_10033282 3300025910 Bacteria 4383
188 Ga0207707_10000973 3300025912 Bacteria 27532
189 Ga0207695_10006973 3300025913 Bacteria 14504
190 Ga0207695_10017905 3300025913 Bacteria 8207
191 Ga0207695_10040662 3300025913 Bacteria 4982
192 Ga0207671_10042615 3300025914 Bacteria 3359
193 Ga0207693_10019679 3300025915 Bacteria 5368
194 Ga0207693_10048395 3300025915 Bacteria 3338
195 Ga0207662_10011109 3300025918 Unclassified 4981
196 Ga0207657_10001839 3300025919 Bacteria 22917
197 Ga0207646_10000116 3300025922 Bacteria 110396
198 Ga0207646_10002363 3300025922 Bacteria 22298
199 Ga0207646_10005442 3300025922 Bacteria 13391
200 Ga0207646_10041714 3300025922 Unclassified 4124
201 Ga0207646_10093818 3300025922 Bacteria 2688
202 Ga0207646_10152800 3300025922 Bacteria 2082
203 Ga0207650_10000150 3300025925 Bacteria 83380
204 Ga0207650_10050085 3300025925 Bacteria 3087
205 Ga0207650_10095056 3300025925 Bacteria 2284
206 Ga0207659_10017310 3300025926 Bacteria 4707
207 Ga0207659_10050791 3300025926 Bacteria 2947
208 Ga0207700_10043049 3300025928 Bacteria 3314
209 Ga0207700_10130492 3300025928 Bacteria 2051
210 Ga0207644_10000598 3300025931 Bacteria 22999
211 Ga0207644_10029993 3300025931 Bacteria 3777
212 Ga0207644_10054531 3300025931 Bacteria 2879
213 Ga0207706_10000790 3300025933 Bacteria 32752
214 Ga0207706_10026332 3300025933 Bacteria 5205
215 Ga0207686_10070906 3300025934 Bacteria 2240
216 Ga0207670_10065218 3300025936 Bacteria 2498
217 Ga0207669_10021917 3300025937 Bacteria 3383
218 Ga0207704_10015184 3300025938 Bacteria 3916
219 Ga0207704_10029478 3300025938 Bacteria 3061
220 Ga0207665_10000312 3300025939 Bacteria 33656
221 Ga0207665_10003990 3300025939 Bacteria 9862
222 Ga0207691_10019964 3300025940 Bacteria 6339
223 Ga0207691_10047591 3300025940 Bacteria 3935
224 Ga0207661_10000422 3300025944 Bacteria 27313
225 Ga0207667_10009676 3300025949 Bacteria 11338
226 Ga0207651_10052972 3300025960 Bacteria 2770
227 Ga0207658_10024449 3300025986 Unclassified 4227
228 Ga0207658_10045330 3300025986 Bacteria 3205
229 Ga0207677_10059541 3300026023 Bacteria 2634
230 Ga0207677_10066067 3300026023 Bacteria 2527
231 Ga0207677_10100219 3300026023 Bacteria 2129
232 Ga0207703_10001123 3300026035 Bacteria 25270
233 Ga0207703_10001175 3300026035 Bacteria 24706
234 Ga0207702_10105542 3300026078 Bacteria 2495
235 Ga0207641_10000147 3300026088 Bacteria 99902
236 Ga0207641_10000197 3300026088 Bacteria 81805
237 Ga0207648_10001035 3300026089 Bacteria 31211
238 Ga0207648_10002984 3300026089 Bacteria 17884
239 Ga0207648_10016359 3300026089 Bacteria 6778
240 Ga0207676_10005773 3300026095 Bacteria 8753
241 Ga0207674_10000432 3300026116 Bacteria 54683
242 Ga0207675_100014652 3300026118 Bacteria 7310
243 Ga0207683_10000692 3300026121 Bacteria 30940
244 Ga0207683_10062744 3300026121 Bacteria 3273
245 Ga0207683_10091017 3300026121 Bacteria 2717
246 Ga0207683_10142795 3300026121 Bacteria 2157
247 Ga0268266_10002158 3300028379 Bacteria 21584
248 Ga0268266_10022597 3300028379 Bacteria 5356
249 Ga0268266_10023737 3300028379 Bacteria 5219
250 Ga0268266_10037619 3300028379 Bacteria 4121
251 Ga0268266_10053112 3300028379 Bacteria 3480
252 Ga0268265_10084597 3300028380 Bacteria 2515
253 Ga0268265_10172706 3300028380 Bacteria 1849
254 Ga0268264_10000025 3300028381 Bacteria 468619
255 Ga0268264_10085576 3300028381 Bacteria 2706
256 Ga0268264_10105195 3300028381 Bacteria 2461
257 Ga0265338_10022985 3300028800 Bacteria 6429
258 Ga0307511_10000449 3300030521 Bacteria 44264
259 Ga0265328_10027904 3300031239 Bacteria 2114
260 Ga0265320_10003148 3300031240 Bacteria 11196
261 Ga0265339_10050086 3300031249 Bacteria 2285
262 Ga0265331_10014746 3300031250 Bacteria 4150
263 Ga0265316_10007894 3300031344 Bacteria 9959
264 Ga0265316_10019082 3300031344 Bacteria 5874
265 Ga0307508_10017833 3300031616 Bacteria 6455
266 Ga0265314_10013308 3300031711 Bacteria 6653
267 Ga0265314_10069231 3300031711 Bacteria 2369
268 Ga0307516_10000260 3300031730 Bacteria 67580
269 Ga0307510_10000012 3300033180 Bacteria 345634
270 Ga0307510_10010978 3300033180 Bacteria 10767
271 Ga0373936_0017159 3300035113 Bacteria 2786
272 Ga0373943_0023446 3300035170 Unclassified 2870
273 Ga0373947_0049184 3300035725 Unclassified 2531
274 Ga0373937_0014408 3300036401 Bacteria 6981
275 Ga0373925_0002744 3300037068 Bacteria 13935
276 Ga0373925_0107150 3300037068 Unclassified 2155
277 Ga0395900_0046260 3300037418 Bacteria 4481
278 Ga0395898_0069348 3300037466 Unclassified 3411
279 Ga0436364_0352896 3300037853 Bacteria 22874
280 Ga0436365_1386032 3300039437 Bacteria 6383
281 Ga0436365_1466484 3300039437 Bacteria 15322
282 Ga0436362_1263978 3300039453 Bacteria 3954
283 Ga0439438_008970 3300041405 Bacteria 3269
284 Ga0450902_000472 3300042137 Bacteria 5016
285 Ga0466959_0008481 3300045049 Bacteria 7271
286 Ga0466959_0032101 3300045049 Bacteria 3887
287 Ga0466958_0047751 3300045836 Bacteria 2585
288 Ga0495617_002651 3300046452 Bacteria 6972
289 Ga0495617_005864 3300046452 Bacteria 4333
290 Ga0495627_004466 3300046453 Bacteria 5851
291 Ga0495627_010394 3300046453 Bacteria 3385
292 Ga0495590_0001160 3300046457 Bacteria 11534
293 Ga0495591_000207 3300046458 Bacteria 59959
294 Ga0495591_009962 3300046458 Bacteria 3729
295 Ga0495629_0010647 3300046459 Bacteria 6690
296 Ga0495638_0003952 3300046460 Bacteria 11436
297 Ga0495638_0006328 3300046460 Bacteria 8629
298 Ga0495650_0003602 3300046471 Bacteria 11162
299 Ga0495580_0008403 3300046472 Bacteria 8212
300 Ga0495582_0011604 3300046473 Bacteria 4855
301 Ga0495605_0008209 3300046474 Bacteria 5905
302 Ga0495584_0020728 3300046491 Bacteria 3338
303 Ga0495596_0000222 3300046500 Bacteria 38778
304 Ga0495607_0001977 3300046501 Bacteria 17257
305 Ga0495606_0012546 3300046507 Bacteria 6787
306 Ga0495610_0005399 3300046512 Bacteria 9102
307 Ga0495616_0009739 3300046513 Bacteria 5599
308 Ga0495620_0020784 3300046515 Bacteria 3198
309 Ga0495631_0003267 3300046518 Bacteria 8911
310 Ga0495632_0001556 3300046519 Bacteria 18927
311 Ga0495637_0000526 3300046520 Bacteria 27770
312 Ga0495637_0012710 3300046520 Bacteria 4018
313 Ga0495643_0009529 3300046522 Bacteria 6031
314 Ga0495644_0000444 3300046523 Bacteria 18207
315 Ga0495648_0015853 3300046524 Bacteria 5447
316 Ga0495654_0001779 3300046530 Bacteria 14375
317 Ga0495598_0009337 3300046537 Bacteria 2316
318 Ga0495597_0006910 3300046542 Bacteria 5821
319 Ga0495668_0001646 3300046616 Bacteria 20843
320 Ga0495625_0004785 3300046660 Bacteria 12658
321 Ga0495625_0059544 3300046660 Bacteria 2709
322 Ga0495661_0009662 3300046665 Bacteria 6608
323 Ga0495661_0077446 3300046665 Bacteria 1926
324 Ga0495669_0009158 3300046684 Unclassified 4171
325 Ga0495670_0023851 3300046691 Bacteria 3020
326 Ga0495649_0021540 3300046694 Bacteria 3610
327 Ga0495649_0027165 3300046694 Bacteria 3176
328 Ga0495589_0003444 3300046794 Bacteria 8561
329 Ga0495660_0033833 3300046810 Bacteria 2862
330 Ga0495660_0052498 3300046810 Bacteria 2214
331 Ga0495672_0003964 3300047320 Bacteria 12392
332 Ga0495672_0017568 3300047320 Bacteria 4781
333 Ga0495683_0002210 3300047323 Bacteria 11902
334 Ga0495683_0005408 3300047323 Bacteria 7088
335 Ga0495687_012734 3300047443 Bacteria 4432
336 Ga0495681_0000985 3300047470 Bacteria 21803
337 Ga0495681_0001937 3300047470 Bacteria 15147
338 Ga0495681_0031281 3300047470 Bacteria 2696
339 Ga0495686_0008702 3300047472 Bacteria 7410
340 Ga0495686_0020599 3300047472 Bacteria 4395
341 Ga0495626_0000595 3300048091 Bacteria 35439
342 Ga0495626_0052346 3300048091 Bacteria 1882
343 Ga0496107_0094191 3300048910 Bacteria 2191
344 Ga0496108_0000051 3300048911 Bacteria 131546
345 Ga0496109_0000105 3300048912 Bacteria 87116
346 Ga0496109_0089548 3300048912 Bacteria 2845
347 Ga0496110_0000941 3300048913 Bacteria 20418
348 Ga0496112_0014151 3300048915 Bacteria 7390
349 Ga0496112_0021630 3300048915 Bacteria 6118
350 Ga0496112_0058111 3300048915 Bacteria 3809
351 Ga0496113_0000254 3300048916 Bacteria 25129
352 Ga0496114_0000008 3300048917 Bacteria 420692
353 Ga0496115_0199622 3300048918 Unclassified 1652
354 Ga0496117_0000110 3300048920 Bacteria 184627
355 Ga0496118_0000014 3300048921 Bacteria 561628
356 Ga0496119_0000203 3300048922 Bacteria 84250
357 Ga0496119_0010792 3300048922 Bacteria 7646
358 Ga0496120_0000018 3300048923 Bacteria 263952
359 Ga0496121_0005145 3300048924 Bacteria 17009
360 Ga0496121_0021747 3300048924 Bacteria 6267
361 Ga0496125_0000362 3300048928 Bacteria 85671
362 Ga0496125_0015867 3300048928 Bacteria 7257
363 Ga0496126_0011815 3300048929 Bacteria 8985
364 Ga0496126_0013935 3300048929 Bacteria 8155
365 Ga0496126_0063432 3300048929 Bacteria 3312
366 Ga0495678_002119 3300049459 Bacteria 14093
367 Ga0501068_0008818 3300049584 Bacteria 5625
368 Ga0501071_0019483 3300049587 Bacteria 4708
369 Ga0501077_0024350 3300049593 Bacteria 3843
370 Ga0501079_0000568 3300049741 Bacteria 24335
371 Ga0501080_0014450 3300049742 Bacteria 7272
372 Ga0501083_0012797 3300049744 Bacteria 5869
373 nmdc:mga05p37_194900_c1 3300050507 Bacteria 2457
374 nmdc:mga05p37_65507_c1 3300050507 Bacteria 4470
375 nmdc:mga0rr50_15681_c1 3300050513 Bacteria 3802
376 nmdc:mga0a205_170663_c1 3300050515 Bacteria 2071
377 nmdc:mga0a205_34439_c1 3300050515 Bacteria 4858
378 Ga0500577_0001331 3300053142 Bacteria 6321
379 Ga0501084_0023493 3300054114 Bacteria 5144

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048918 Ga0496115_0199622 Ga0496115_0199622_15_1565 477
2 3300041405 Ga0439438_008970 Ga0439438_008970_1382_2860 485
3 3300042137 Ga0450902_000472 Ga0450902_000472_2905_4383 485
4 3300046460 Ga0495638_0006328 Ga0495638_0006328_2947_4425 485
5 3300046522 Ga0495643_0009529 Ga0495643_0009529_3394_4872 485
6 3300046542 Ga0495597_0006910 Ga0495597_0006910_396_1874 485
7 3300046665 Ga0495661_0077446 Ga0495661_0077446_11_1489 485
8 3300046694 Ga0495649_0021540 Ga0495649_0021540_751_2229 485
9 3300046810 Ga0495660_0052498 Ga0495660_0052498_634_2112 485
10 3300047320 Ga0495672_0017568 Ga0495672_0017568_168_1646 485
11 3300047472 Ga0495686_0008702 Ga0495686_0008702_751_2229 485
12 3300048091 Ga0495626_0052346 Ga0495626_0052346_20_1498 485
13 3300049459 Ga0495678_002119 Ga0495678_002119_9676_11154 485
14 3300005288 Ga0065714_10002938 Ga0065714_100029384 489
15 3300006058 Ga0075432_10005125 Ga0075432_100051255 489
16 3300046452 Ga0495617_002651 Ga0495617_002651_2346_3848 489
17 3300046452 Ga0495617_005864 Ga0495617_005864_1702_3192 489
18 3300046453 Ga0495627_004466 Ga0495627_004466_4257_5759 489
19 3300046453 Ga0495627_010394 Ga0495627_010394_1364_2854 489
20 3300046457 Ga0495590_0001160 Ga0495590_0001160_6623_8113 489
21 3300046458 Ga0495591_000207 Ga0495591_000207_22585_24075 489
22 3300046458 Ga0495591_009962 Ga0495591_009962_1954_3456 489
23 3300046460 Ga0495638_0003952 Ga0495638_0003952_3569_5059 489
24 3300046471 Ga0495650_0003602 Ga0495650_0003602_3295_4785 489
25 3300046474 Ga0495605_0008209 Ga0495605_0008209_2845_4347 489
26 3300046491 Ga0495584_0020728 Ga0495584_0020728_186_1676 489
27 3300046500 Ga0495596_0000222 Ga0495596_0000222_14801_16291 489
28 3300046501 Ga0495607_0001977 Ga0495607_0001977_10081_11583 489
29 3300046507 Ga0495606_0012546 Ga0495606_0012546_4883_6373 489
30 3300046512 Ga0495610_0005399 Ga0495610_0005399_5832_7322 489
31 3300046513 Ga0495616_0009739 Ga0495616_0009739_237_1739 489
32 3300046515 Ga0495620_0020784 Ga0495620_0020784_135_1625 489
33 3300046518 Ga0495631_0003267 Ga0495631_0003267_3830_5320 489
34 3300046519 Ga0495632_0001556 Ga0495632_0001556_10737_12227 489
35 3300046520 Ga0495637_0000526 Ga0495637_0000526_11499_12989 489
36 3300046520 Ga0495637_0012710 Ga0495637_0012710_1878_3380 489
37 3300046523 Ga0495644_0000444 Ga0495644_0000444_12561_14063 489
38 3300046524 Ga0495648_0015853 Ga0495648_0015853_2039_3529 489
39 3300046530 Ga0495654_0001779 Ga0495654_0001779_6679_8169 489
40 3300046616 Ga0495668_0001646 Ga0495668_0001646_14133_15623 489
41 3300046660 Ga0495625_0004785 Ga0495625_0004785_5624_7114 489
42 3300046660 Ga0495625_0059544 Ga0495625_0059544_683_2185 489
43 3300046665 Ga0495661_0009662 Ga0495661_0009662_3849_5339 489
44 3300046691 Ga0495670_0023851 Ga0495670_0023851_205_1707 489
45 3300046694 Ga0495649_0027165 Ga0495649_0027165_936_2426 489
46 3300046794 Ga0495589_0003444 Ga0495589_0003444_6657_8147 489
47 3300046810 Ga0495660_0033833 Ga0495660_0033833_770_2260 489
48 3300047320 Ga0495672_0003964 Ga0495672_0003964_10394_11935 489
49 3300047323 Ga0495683_0002210 Ga0495683_0002210_3278_4819 489
50 3300047323 Ga0495683_0005408 Ga0495683_0005408_2046_3536 489
51 3300047470 Ga0495681_0000985 Ga0495681_0000985_13613_15103 489
52 3300047470 Ga0495681_0001937 Ga0495681_0001937_11841_13343 489
53 3300047470 Ga0495681_0031281 Ga0495681_0031281_748_2250 489
54 3300047472 Ga0495686_0020599 Ga0495686_0020599_2068_3558 489
55 3300048091 Ga0495626_0000595 Ga0495626_0000595_19786_21276 489
56 3300046459 Ga0495629_0010647 Ga0495629_0010647_4786_6486 491
57 3300053142 Ga0500577_0001331 Ga0500577_0001331_3501_5072 504
58 3300039437 Ga0436365_1386032 Ga0436365_1386032_1123_2793 514
59 3300005518 Ga0070699_100000496 Ga0070699_1000004967 526
60 3300025922 Ga0207646_10152800 Ga0207646_101528001 529
61 3300005367 Ga0070667_100144240 Ga0070667_1001442401 530
62 3300025986 Ga0207658_10045330 Ga0207658_100453302 530
63 3300048917 Ga0496114_0000008 Ga0496114_0000008_205787_207478 530
64 3300005445 Ga0070708_100005176 Ga0070708_1000051766 533
65 3300005467 Ga0070706_100000084 Ga0070706_10000008444 533
66 3300005468 Ga0070707_100016015 Ga0070707_1000160155 533
67 3300005471 Ga0070698_100073435 Ga0070698_1000734353 533
68 3300006028 Ga0070717_10002711 Ga0070717_100027117 533
69 3300025910 Ga0207684_10000040 Ga0207684_10000040221 533
70 3300005468 Ga0070707_100011410 Ga0070707_10001141011 536
71 3300005518 Ga0070699_100033902 Ga0070699_1000339022 536
72 3300005536 Ga0070697_100000246 Ga0070697_10000024629 536
73 3300025922 Ga0207646_10002363 Ga0207646_1000236323 536
74 3300009093 Ga0105240_10112468 Ga0105240_101124682 539
75 3300005289 Ga0065704_10006929 Ga0065704_100069292 541
76 3300031616 Ga0307508_10017833 Ga0307508_100178334 541
77 3300005467 Ga0070706_100036522 Ga0070706_1000365223 542
78 3300005518 Ga0070699_100032053 Ga0070699_1000320533 542
79 3300025910 Ga0207684_10000006 Ga0207684_10000006677 542
80 3300025922 Ga0207646_10000116 Ga0207646_1000011610 542
81 3300006173 Ga0070716_100039995 Ga0070716_1000399952 543
82 3300005841 Ga0068863_100001383 Ga0068863_10000138316 544
83 3300009092 Ga0105250_10020647 Ga0105250_100206472 544
84 3300009101 Ga0105247_10000304 Ga0105247_1000030426 544
85 3300014968 Ga0157379_10004099 Ga0157379_100040996 544
86 3300025900 Ga0207710_10000118 Ga0207710_1000011854 544
87 3300025931 Ga0207644_10000598 Ga0207644_1000059814 544
88 3300048924 Ga0496121_0005145 Ga0496121_0005145_8784_10535 544
89 3300049584 Ga0501068_0008818 Ga0501068_0008818_1189_2919 546
90 3300049587 Ga0501071_0019483 Ga0501071_0019483_957_2687 546
91 3300049593 Ga0501077_0024350 Ga0501077_0024350_442_2172 546
92 3300049741 Ga0501079_0000568 Ga0501079_0000568_19211_20941 546
93 3300049742 Ga0501080_0014450 Ga0501080_0014450_1188_2918 546
94 3300049744 Ga0501083_0012797 Ga0501083_0012797_3441_5171 546
95 3300054114 Ga0501084_0023493 Ga0501084_0023493_1622_3352 546
96 3300031344 Ga0265316_10007894 Ga0265316_100078942 547
97 3300031711 Ga0265314_10013308 Ga0265314_100133082 547
98 3300005335 Ga0070666_10043453 Ga0070666_100434532 548
99 3300005338 Ga0068868_100123372 Ga0068868_1001233721 548
100 3300005445 Ga0070708_100000569 Ga0070708_10000056924 548
101 3300005459 Ga0068867_100041938 Ga0068867_1000419383 548
102 3300005617 Ga0068859_100000528 Ga0068859_10000052821 548
103 3300006358 Ga0068871_100052497 Ga0068871_1000524972 548
104 3300006881 Ga0068865_100001494 Ga0068865_10000149412 548
105 3300006931 Ga0097620_100000528 Ga0097620_10000052821 548
106 3300009176 Ga0105242_10001003 Ga0105242_100010037 548
107 3300014969 Ga0157376_10045777 Ga0157376_100457772 548
108 3300025934 Ga0207686_10070906 Ga0207686_100709061 548
109 3300026023 Ga0207677_10100219 Ga0207677_101002191 548
110 3300026035 Ga0207703_10001175 Ga0207703_100011751 548
111 3300028380 Ga0268265_10172706 Ga0268265_101727061 548
112 3300025939 Ga0207665_10003990 Ga0207665_100039904 549
113 3300005445 Ga0070708_100063479 Ga0070708_1000634792 550
114 3300005467 Ga0070706_100074398 Ga0070706_1000743982 550
115 3300005468 Ga0070707_100038569 Ga0070707_1000385694 550
116 3300025922 Ga0207646_10041714 Ga0207646_100417142 550
117 3300013297 Ga0157378_10102112 Ga0157378_101021122 551
118 3300028381 Ga0268264_10085576 Ga0268264_100855762 551
119 3300035170 Ga0373943_0023446 Ga0373943_0023446_973_2742 552
120 3300037068 Ga0373925_0107150 Ga0373925_0107150_286_2055 552
121 3300005468 Ga0070707_100027194 Ga0070707_1000271945 553
122 3300006173 Ga0070716_100010341 Ga0070716_1000103413 553
123 3300007788 Ga0099795_10012271 Ga0099795_100122711 553
124 3300025922 Ga0207646_10093818 Ga0207646_100938181 553
125 3300007265 Ga0099794_10027526 Ga0099794_100275262 554
126 3300005436 Ga0070713_100075836 Ga0070713_1000758362 557
127 3300005468 Ga0070707_100082998 Ga0070707_1000829981 557
128 3300035725 Ga0373947_0049184 Ga0373947_0049184_496_2277 557
129 3300037068 Ga0373925_0002744 Ga0373925_0002744_6899_8680 557
130 3300005467 Ga0070706_100110216 Ga0070706_1001102161 558
131 3300005471 Ga0070698_100181691 Ga0070698_1001816911 558
132 3300005536 Ga0070697_100037369 Ga0070697_1000373693 558
133 3300025907 Ga0207645_10013051 Ga0207645_100130512 558
134 3300031249 Ga0265339_10050086 Ga0265339_100500861 558
135 3300005467 Ga0070706_100031923 Ga0070706_1000319232 559
136 3300005468 Ga0070707_100000921 Ga0070707_10000092114 559
137 3300025939 Ga0207665_10000312 Ga0207665_1000031216 560
138 3300005328 Ga0070676_10011260 Ga0070676_100112602 561
139 3300005337 Ga0070682_100044845 Ga0070682_1000448452 561
140 3300005340 Ga0070689_100013949 Ga0070689_1000139492 561
141 3300005343 Ga0070687_100030825 Ga0070687_1000308252 561
142 3300005347 Ga0070668_100006773 Ga0070668_1000067733 561
143 3300005353 Ga0070669_100012981 Ga0070669_1000129813 561
144 3300005356 Ga0070674_100031235 Ga0070674_1000312352 561
145 3300005365 Ga0070688_100003908 Ga0070688_1000039083 561
146 3300005366 Ga0070659_100000527 Ga0070659_10000052723 561
147 3300005459 Ga0068867_100009755 Ga0068867_1000097553 561
148 3300005535 Ga0070684_100006345 Ga0070684_1000063453 561
149 3300005543 Ga0070672_100019102 Ga0070672_1000191025 561
150 3300005543 Ga0070672_100064271 Ga0070672_1000642712 561
151 3300005544 Ga0070686_100008506 Ga0070686_1000085062 561
152 3300005563 Ga0068855_100073543 Ga0068855_1000735434 561
153 3300005577 Ga0068857_100000556 Ga0068857_10000055616 561
154 3300005578 Ga0068854_100007304 Ga0068854_1000073043 561
155 3300005614 Ga0068856_100064531 Ga0068856_1000645312 561
156 3300005615 Ga0070702_100010816 Ga0070702_1000108162 561
157 3300005616 Ga0068852_100092895 Ga0068852_1000928952 561
158 3300005617 Ga0068859_100151264 Ga0068859_1001512641 561
159 3300005618 Ga0068864_100092615 Ga0068864_1000926152 561
160 3300005719 Ga0068861_100084655 Ga0068861_1000846552 561
161 3300005834 Ga0068851_10015519 Ga0068851_100155191 561
162 3300005840 Ga0068870_10005121 Ga0068870_100051212 561
163 3300005842 Ga0068858_100004958 Ga0068858_1000049585 561
164 3300006237 Ga0097621_100027840 Ga0097621_1000278404 561
165 3300006881 Ga0068865_100004875 Ga0068865_1000048753 561
166 3300006931 Ga0097620_100151261 Ga0097620_1001512611 561
167 3300009098 Ga0105245_10079643 Ga0105245_100796432 561
168 3300009553 Ga0105249_10162030 Ga0105249_101620301 561
169 3300010375 Ga0105239_10018881 Ga0105239_100188813 561
170 3300011119 Ga0105246_10007398 Ga0105246_100073982 561
171 3300013100 Ga0157373_10007743 Ga0157373_100077433 561
172 3300013102 Ga0157371_10007984 Ga0157371_100079844 561
173 3300013297 Ga0157378_10091382 Ga0157378_100913822 561
174 3300013307 Ga0157372_10033333 Ga0157372_100333332 561
175 3300013308 Ga0157375_10023874 Ga0157375_100238746 561
176 3300014745 Ga0157377_10000510 Ga0157377_1000051014 561
177 3300017792 Ga0163161_10008846 Ga0163161_100088464 561
178 3300025893 Ga0207682_10023566 Ga0207682_100235663 561
179 3300025903 Ga0207680_10024779 Ga0207680_100247792 561
180 3300025907 Ga0207645_10001234 Ga0207645_1000123418 561
181 3300025908 Ga0207643_10002519 Ga0207643_100025192 561
182 3300025918 Ga0207662_10011109 Ga0207662_100111094 561
183 3300025919 Ga0207657_10001839 Ga0207657_100018392 561
184 3300025925 Ga0207650_10000150 Ga0207650_1000015020 561
185 3300025931 Ga0207644_10054531 Ga0207644_100545313 561
186 3300025933 Ga0207706_10000790 Ga0207706_100007902 561
187 3300025938 Ga0207704_10029478 Ga0207704_100294782 561
188 3300025940 Ga0207691_10019964 Ga0207691_100199644 561
189 3300025944 Ga0207661_10000422 Ga0207661_100004221 561
190 3300025986 Ga0207658_10024449 Ga0207658_100244492 561
191 3300026023 Ga0207677_10059541 Ga0207677_100595413 561
192 3300026078 Ga0207702_10105542 Ga0207702_101055422 561
193 3300026088 Ga0207641_10000147 Ga0207641_1000014775 561
194 3300026089 Ga0207648_10001035 Ga0207648_1000103527 561
195 3300026089 Ga0207648_10002984 Ga0207648_1000298413 561
196 3300026095 Ga0207676_10005773 Ga0207676_100057733 561
197 3300026116 Ga0207674_10000432 Ga0207674_1000043218 561
198 3300026118 Ga0207675_100014652 Ga0207675_1000146525 561
199 3300026121 Ga0207683_10000692 Ga0207683_100006923 561
200 3300026121 Ga0207683_10091017 Ga0207683_100910172 561
201 3300028379 Ga0268266_10023737 Ga0268266_100237373 561
202 3300028381 Ga0268264_10105195 Ga0268264_101051953 561
203 3300031730 Ga0307516_10000260 Ga0307516_100002606 561
204 3300048910 Ga0496107_0094191 Ga0496107_0094191_256_2079 561
205 3300048911 Ga0496108_0000051 Ga0496108_0000051_87831_89654 561
206 3300048912 Ga0496109_0000105 Ga0496109_0000105_35161_36984 561
207 3300048913 Ga0496110_0000941 Ga0496110_0000941_1093_2916 561
208 3300048915 Ga0496112_0014151 Ga0496112_0014151_4502_6304 561
209 3300048916 Ga0496113_0000254 Ga0496113_0000254_13430_15253 561
210 3300005518 Ga0070699_100064704 Ga0070699_1000647042 562
211 3300015262 Ga0182007_10008225 Ga0182007_100082251 562
212 3300031239 Ga0265328_10027904 Ga0265328_100279041 562
213 3300031240 Ga0265320_10003148 Ga0265320_100031485 562
214 3300031250 Ga0265331_10014746 Ga0265331_100147461 562
215 3300031344 Ga0265316_10019082 Ga0265316_100190821 562
216 3300031711 Ga0265314_10069231 Ga0265314_100692311 562
217 3300009093 Ga0105240_10179048 Ga0105240_101790481 563
218 3300028800 Ga0265338_10022985 Ga0265338_100229858 563
219 3300035113 Ga0373936_0017159 Ga0373936_0017159_59_1795 563
220 3300047443 Ga0495687_012734 Ga0495687_012734_1163_2998 563
221 3300048929 Ga0496126_0011815 Ga0496126_0011815_4015_5748 563
222 3300005331 Ga0070670_100171758 Ga0070670_1001717581 564
223 3300005335 Ga0070666_10093277 Ga0070666_100932772 564
224 3300005338 Ga0068868_100062376 Ga0068868_1000623763 564
225 3300005340 Ga0070689_100024132 Ga0070689_1000241323 564
226 3300005347 Ga0070668_100018538 Ga0070668_1000185385 564
227 3300005353 Ga0070669_100007746 Ga0070669_1000077463 564
228 3300005354 Ga0070675_100022069 Ga0070675_1000220693 564
229 3300005356 Ga0070674_100010070 Ga0070674_1000100701 564
230 3300005364 Ga0070673_100014084 Ga0070673_1000140842 564
231 3300005365 Ga0070688_100005607 Ga0070688_1000056072 564
232 3300005367 Ga0070667_100082805 Ga0070667_1000828052 564
233 3300005456 Ga0070678_100047303 Ga0070678_1000473032 564
234 3300005459 Ga0068867_100025139 Ga0068867_1000251393 564
235 3300005468 Ga0070707_100020926 Ga0070707_1000209262 564
236 3300005536 Ga0070697_100007344 Ga0070697_1000073445 564
237 3300005548 Ga0070665_100115224 Ga0070665_1001152241 564
238 3300006881 Ga0068865_100046178 Ga0068865_1000461783 564
239 3300007265 Ga0099794_10004737 Ga0099794_100047373 564
240 3300009093 Ga0105240_10131063 Ga0105240_101310632 564
241 3300013296 Ga0157374_10036661 Ga0157374_100366612 564
242 3300013297 Ga0157378_10027143 Ga0157378_100271433 564
243 3300013306 Ga0163162_10026803 Ga0163162_100268033 564
244 3300013308 Ga0157375_10103632 Ga0157375_101036321 564
245 3300025315 Ga0207697_10004645 Ga0207697_100046453 564
246 3300025901 Ga0207688_10015865 Ga0207688_100158651 564
247 3300025913 Ga0207695_10040662 Ga0207695_100406622 564
248 3300025926 Ga0207659_10050791 Ga0207659_100507912 564
249 3300025936 Ga0207670_10065218 Ga0207670_100652181 564
250 3300025937 Ga0207669_10021917 Ga0207669_100219172 564
251 3300025938 Ga0207704_10015184 Ga0207704_100151841 564
252 3300025940 Ga0207691_10047591 Ga0207691_100475912 564
253 3300026023 Ga0207677_10066067 Ga0207677_100660671 564
254 3300026089 Ga0207648_10016359 Ga0207648_100163594 564
255 3300026121 Ga0207683_10062744 Ga0207683_100627442 564
256 3300028379 Ga0268266_10022597 Ga0268266_100225972 564
257 3300028380 Ga0268265_10084597 Ga0268265_100845972 564
258 3300030521 Ga0307511_10000449 Ga0307511_100004494 564
259 3300048912 Ga0496109_0089548 Ga0496109_0089548_228_1997 564
260 3300048915 Ga0496112_0058111 Ga0496112_0058111_197_1966 564
261 3300006175 Ga0070712_100012681 Ga0070712_1000126814 565
262 3300010159 Ga0099796_10001504 Ga0099796_100015043 565
263 3300025910 Ga0207684_10033282 Ga0207684_100332821 565
264 3300013297 Ga0157378_10096655 Ga0157378_100966551 566
265 3300025915 Ga0207693_10019679 Ga0207693_100196794 566
266 3300026121 Ga0207683_10142795 Ga0207683_101427951 566
267 3300037853 Ga0436364_0352896 Ga0436364_0352896_10304_12085 566
268 3300039437 Ga0436365_1466484 Ga0436365_1466484_2322_4103 566
269 3300039453 Ga0436362_1263978 Ga0436362_1263978_2132_3913 566
270 3300009093 Ga0105240_10002073 Ga0105240_1000207325 567
271 3300005467 Ga0070706_100059306 Ga0070706_1000593062 568
272 3300005468 Ga0070707_100107192 Ga0070707_1001071922 568
273 3300005468 Ga0070707_100121309 Ga0070707_1001213091 568
274 3300005536 Ga0070697_100005201 Ga0070697_10000520110 568
275 3300006028 Ga0070717_10029770 Ga0070717_100297703 568
276 3300006175 Ga0070712_100043992 Ga0070712_1000439922 568
277 3300007076 Ga0075435_100121102 Ga0075435_1001211022 568
278 3300010159 Ga0099796_10001310 Ga0099796_100013102 568
279 3300013296 Ga0157374_10182428 Ga0157374_101824282 568
280 3300013297 Ga0157378_10083137 Ga0157378_100831372 568
281 3300025915 Ga0207693_10048395 Ga0207693_100483952 568
282 3300025922 Ga0207646_10005442 Ga0207646_1000544212 568
283 3300046472 Ga0495580_0008403 Ga0495580_0008403_6216_8045 568
284 3300046537 Ga0495598_0009337 Ga0495598_0009337_327_2084 568
285 3300046684 Ga0495669_0009158 Ga0495669_0009158_382_2139 568
286 3300006028 Ga0070717_10033330 Ga0070717_100333302 569
287 3300009147 Ga0114129_10005859 Ga0114129_100058596 569
288 3300050507 nmdc:mga05p37_65507_c1 nmdc:mga05p37_65507_c1_2184_4037 569
289 3300050515 nmdc:mga0a205_34439_c1 nmdc:mga0a205_34439_c1_799_2652 569
290 3300005329 Ga0070683_100090305 Ga0070683_1000903052 570
291 3300005436 Ga0070713_100056722 Ga0070713_1000567223 570
292 3300005445 Ga0070708_100010647 Ga0070708_1000106475 570
293 3300005458 Ga0070681_10053755 Ga0070681_100537552 570
294 3300005548 Ga0070665_100002500 Ga0070665_1000025005 570
295 3300005614 Ga0068856_100107886 Ga0068856_1001078862 570
296 3300006358 Ga0068871_100148221 Ga0068871_1001482211 570
297 3300013105 Ga0157369_10133261 Ga0157369_101332612 570
298 3300013297 Ga0157378_10060656 Ga0157378_100606564 570
299 3300013306 Ga0163162_10134366 Ga0163162_101343662 570
300 3300013307 Ga0157372_10219318 Ga0157372_102193181 570
301 3300014969 Ga0157376_10010978 Ga0157376_100109786 570
302 3300020078 Ga0206352_10940153 Ga0206352_109401531 570
303 3300021384 Ga0213876_10020083 Ga0213876_100200832 570
304 3300022467 Ga0224712_10028393 Ga0224712_100283931 570
305 3300028379 Ga0268266_10037619 Ga0268266_100376192 570
306 3300036401 Ga0373937_0014408 Ga0373937_0014408_3521_5278 570
307 3300046473 Ga0495582_0011604 Ga0495582_0011604_1633_3390 570
308 3300005563 Ga0068855_100002522 Ga0068855_10000252212 571
309 3300025913 Ga0207695_10006973 Ga0207695_100069735 571
310 3300025949 Ga0207667_10009676 Ga0207667_100096763 571
311 3300045049 Ga0466959_0008481 Ga0466959_0008481_5503_7260 571
312 3300048915 Ga0496112_0021630 Ga0496112_0021630_276_2042 571
313 3300005293 Ga0065715_10090294 Ga0065715_100902949 572
314 3300005331 Ga0070670_100050504 Ga0070670_1000505042 572
315 3300005364 Ga0070673_100013569 Ga0070673_1000135692 572
316 3300005436 Ga0070713_100128751 Ga0070713_1001287511 572
317 3300005543 Ga0070672_100055257 Ga0070672_1000552572 572
318 3300005548 Ga0070665_100011357 Ga0070665_1000113577 572
319 3300013308 Ga0157375_10010011 Ga0157375_100100112 572
320 3300025315 Ga0207697_10031841 Ga0207697_100318412 572
321 3300025925 Ga0207650_10095056 Ga0207650_100950561 572
322 3300025926 Ga0207659_10017310 Ga0207659_100173102 572
323 3300025928 Ga0207700_10043049 Ga0207700_100430492 572
324 3300025933 Ga0207706_10026332 Ga0207706_100263322 572
325 3300025960 Ga0207651_10052972 Ga0207651_100529722 572
326 3300028379 Ga0268266_10053112 Ga0268266_100531122 572
327 3300050507 nmdc:mga05p37_194900_c1 nmdc:mga05p37_194900_c1_175_1977 572
328 3300050515 nmdc:mga0a205_170663_c1 nmdc:mga0a205_170663_c1_35_1837 572
329 3300005467 Ga0070706_100000210 Ga0070706_1000002103 573
330 3300025910 Ga0207684_10000028 Ga0207684_1000002878 573
331 3300037418 Ga0395900_0046260 Ga0395900_0046260_217_2070 574
332 3300037466 Ga0395898_0069348 Ga0395898_0069348_1382_3235 574
333 3300005458 Ga0070681_10000508 Ga0070681_1000050827 580
334 3300005518 Ga0070699_100047532 Ga0070699_1000475321 580
335 3300005545 Ga0070695_100002610 Ga0070695_1000026103 580
336 3300006028 Ga0070717_10008639 Ga0070717_100086393 580
337 3300007076 Ga0075435_100039700 Ga0075435_1000397002 580
338 3300025898 Ga0207692_10029157 Ga0207692_100291571 580
339 3300025906 Ga0207699_10027104 Ga0207699_100271043 580
340 3300025912 Ga0207707_10000973 Ga0207707_100009736 580
341 3300025928 Ga0207700_10130492 Ga0207700_101304921 580
342 3300050513 nmdc:mga0rr50_15681_c1 nmdc:mga0rr50_15681_c1_754_2550 580
343 3300003323 rootH1_10015747 rootH1_100157478 586
344 3300005367 Ga0070667_100057190 Ga0070667_1000571903 586
345 3300005548 Ga0070665_100005755 Ga0070665_1000057555 586
346 3300005614 Ga0068856_100025155 Ga0068856_1000251552 586
347 3300005617 Ga0068859_100010970 Ga0068859_1000109702 586
348 3300005842 Ga0068858_100022963 Ga0068858_1000229632 586
349 3300005843 Ga0068860_100000566 Ga0068860_10000056627 586
350 3300005844 Ga0068862_100071086 Ga0068862_1000710863 586
351 3300006931 Ga0097620_100010970 Ga0097620_1000109705 586
352 3300009093 Ga0105240_10015909 Ga0105240_100159099 586
353 3300009545 Ga0105237_10094783 Ga0105237_100947831 586
354 3300009551 Ga0105238_10046293 Ga0105238_100462934 586
355 3300009551 Ga0105238_10102061 Ga0105238_101020612 586
356 3300013306 Ga0163162_10212037 Ga0163162_102120371 586
357 3300025903 Ga0207680_10009348 Ga0207680_100093482 586
358 3300025913 Ga0207695_10017905 Ga0207695_100179059 586
359 3300025914 Ga0207671_10042615 Ga0207671_100426153 586
360 3300025925 Ga0207650_10050085 Ga0207650_100500853 586
361 3300025931 Ga0207644_10029993 Ga0207644_100299931 586
362 3300026035 Ga0207703_10001123 Ga0207703_1000112311 586
363 3300026088 Ga0207641_10000197 Ga0207641_1000019742 586
364 3300028379 Ga0268266_10002158 Ga0268266_100021589 586
365 3300028381 Ga0268264_10000025 Ga0268264_10000025216 586
366 3300033180 Ga0307510_10000012 Ga0307510_10000012213 586
367 3300033180 Ga0307510_10010978 Ga0307510_100109782 586
368 3300045049 Ga0466959_0032101 Ga0466959_0032101_1326_3137 586
369 3300045836 Ga0466958_0047751 Ga0466958_0047751_677_2488 586
370 3300048920 Ga0496117_0000110 Ga0496117_0000110_90742_92505 586
371 3300048921 Ga0496118_0000014 Ga0496118_0000014_511217_512980 586
372 3300048922 Ga0496119_0000203 Ga0496119_0000203_49034_50827 586
373 3300048922 Ga0496119_0010792 Ga0496119_0010792_2198_3961 586
374 3300048923 Ga0496120_0000018 Ga0496120_0000018_155384_157177 586
375 3300048924 Ga0496121_0021747 Ga0496121_0021747_3070_4833 586
376 3300048928 Ga0496125_0000362 Ga0496125_0000362_5690_7450 586
377 3300048928 Ga0496125_0015867 Ga0496125_0015867_5037_6800 586
378 3300048929 Ga0496126_0013935 Ga0496126_0013935_3296_5059 586
379 3300048929 Ga0496126_0063432 Ga0496126_0063432_447_2207 586

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01425

Amidase

Amidase

92

435

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ac3-assembly1.cif.gz_A crystal structure of pam12a 0.9466 31 554
1m21-assembly2.cif.gz_B crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin 0.9453 32 554
1m21-assembly2.cif.gz_B crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin 0.9377 32 554
5ac3-assembly1.cif.gz_A crystal structure of pam12a 0.9353 31 554
1m22-assembly2.cif.gz_B x-ray structure of native peptide amidase from stenotrophomonas maltophilia at 1.4 a 0.9241 31 556
ID Description Score Start End Superfamily
1m22A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9241 31 556 3.90.1300.10
1m22A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9167 31 556 3.90.1300.10
5ewqB00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9146 34 555 3.90.1300.10
af_A0A0P0WV09_96_533_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9016 101 555 3.90.1300.10
af_A0A1P8B760_22_510_3.90.1300.10 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.8901 20 549 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A4Q3U0X7-F1-model_v4 Amidase (EC 3.5.1.4) 0.9745 103 258 GO:0004040
AF-A0A836VI75-F1-model_v4 Amidase (EC 3.5.1.4) 0.9667 47 202 GO:0016787
AF-A0A2P7PDQ9-F1-model_v4 deleted 0.963 81 206
AF-A0A7K0JYU9-F1-model_v4 deleted 0.9577 45 289
AF-A0A3B0TLU1-F1-model_v4 Aspartyl-tRNA(Asn) amidotransferase subunit A @ Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.6, EC 6.3.5.7) 0.9552 37 271 GO:0016740
GO:0050566
GO:0050567

Feature Viewer

pLDDT pTM Quality
86.32 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map