F428322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 379 | 225 | 379 | 572 |
Family's Representative Sequence
| Representative Sequence | 3300007788|Ga0099795_10012271|Ga0099795_100122711 |
| Length | 633 |
| Sequence | LTNEIPVDCARSGDYFDHLDEPTGCTLISSALRGRGSQEGKMTAPVIRNLLLTALLLPTSGAAQNAVPTQHNEATVAQLQAEMASGRLTAEQLTKEYIGRIAALDQNGPGVNAVIELNPDALVMARNADALRRRGVVLGPLHGIPVLLKDNIDTGDKMQTSAGSFALVGMPALRDSTVAANLRAGGAVILGKTNLSEWANFRSFESISGWSGRGGQTHNPYGIDRNPCGSFGSETDGSIVCPGNANGVVAIKPTVGLTSRAGVVPISHTQDTVGPHGRTVADAAAALSVIQSRTFDGRDPATAGVPLGWQGTGKTRPTNIPTDYTQFVDLNGLQGARLGVTRVGLNGFGNVTTPQPVLEAFEEAMQALQNAGASVIDLDAAGFTFSPADGEFLVLLYDFKFDVANYFKTRVRVPVAGGTLQTAIDFNNAHTGTEMPFFNQDIFDFAESINPDPNFCEPGFTSGVLPTTASCMSYNDALKIGHLAGANGIDAALAQFNLDAVVSATDNPAWATDLLFGDHFIFGTSGLAAAPGYPIVQVPAAFPKLCASPTQPTNCTQYGVPLGISFFGTAFSEPKLIKLASGFEAATQVRAHNLPTFAATAPSTNIQGTTLTVPHRHAAPPASANAKKVPHHL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 136 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 141 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 142 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 144 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 145 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 146 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 147 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 148 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 153 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 154 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 155 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 156 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 157 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 158 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 159 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 205 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 206 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 207 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 208 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 209 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 210 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 213 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 214 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 225 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.47 |
| Metatranscriptomes | 0.53 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.26 |
| Nodule | 0 |
| Rhizoplane | 2.9 |
| Rhizosphere | 91.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10015747 | 3300003323 | Bacteria | 9193 |
| 2 | Ga0065714_10002938 | 3300005288 | Bacteria | 9513 |
| 3 | Ga0065704_10006929 | 3300005289 | Bacteria | 5514 |
| 4 | Ga0065715_10090294 | 3300005293 | Bacteria | 7282 |
| 5 | Ga0070676_10011260 | 3300005328 | Unclassified | 4863 |
| 6 | Ga0070683_100090305 | 3300005329 | Bacteria | 2876 |
| 7 | Ga0070670_100050504 | 3300005331 | Bacteria | 3573 |
| 8 | Ga0070670_100171758 | 3300005331 | Bacteria | 1880 |
| 9 | Ga0070666_10043453 | 3300005335 | Bacteria | 3010 |
| 10 | Ga0070666_10093277 | 3300005335 | Bacteria | 2070 |
| 11 | Ga0070682_100044845 | 3300005337 | Bacteria | 2739 |
| 12 | Ga0068868_100062376 | 3300005338 | Bacteria | 2954 |
| 13 | Ga0068868_100123372 | 3300005338 | Bacteria | 2114 |
| 14 | Ga0070689_100013949 | 3300005340 | Bacteria | 5829 |
| 15 | Ga0070689_100024132 | 3300005340 | Bacteria | 4560 |
| 16 | Ga0070687_100030825 | 3300005343 | Bacteria | 2624 |
| 17 | Ga0070668_100006773 | 3300005347 | Bacteria | 8495 |
| 18 | Ga0070668_100018538 | 3300005347 | Bacteria | 5226 |
| 19 | Ga0070669_100007746 | 3300005353 | Bacteria | 7678 |
| 20 | Ga0070669_100012981 | 3300005353 | Bacteria | 5915 |
| 21 | Ga0070675_100022069 | 3300005354 | Bacteria | 5086 |
| 22 | Ga0070674_100010070 | 3300005356 | Bacteria | 5693 |
| 23 | Ga0070674_100031235 | 3300005356 | Bacteria | 3527 |
| 24 | Ga0070673_100013569 | 3300005364 | Bacteria | 5644 |
| 25 | Ga0070673_100014084 | 3300005364 | Bacteria | 5556 |
| 26 | Ga0070688_100003908 | 3300005365 | Bacteria | 7732 |
| 27 | Ga0070688_100005607 | 3300005365 | Bacteria | 6625 |
| 28 | Ga0070659_100000527 | 3300005366 | Bacteria | 27961 |
| 29 | Ga0070667_100057190 | 3300005367 | Bacteria | 3296 |
| 30 | Ga0070667_100082805 | 3300005367 | Bacteria | 2747 |
| 31 | Ga0070667_100144240 | 3300005367 | Bacteria | 2087 |
| 32 | Ga0070713_100056722 | 3300005436 | Bacteria | 3258 |
| 33 | Ga0070713_100075836 | 3300005436 | Bacteria | 2853 |
| 34 | Ga0070713_100128751 | 3300005436 | Bacteria | 2230 |
| 35 | Ga0070708_100000569 | 3300005445 | Bacteria | 27643 |
| 36 | Ga0070708_100005176 | 3300005445 | Bacteria | 10323 |
| 37 | Ga0070708_100010647 | 3300005445 | Bacteria | 7458 |
| 38 | Ga0070708_100063479 | 3300005445 | Unclassified | 3306 |
| 39 | Ga0070678_100047303 | 3300005456 | Bacteria | 3090 |
| 40 | Ga0070681_10000508 | 3300005458 | Bacteria | 31809 |
| 41 | Ga0070681_10053755 | 3300005458 | Bacteria | 4013 |
| 42 | Ga0068867_100009755 | 3300005459 | Bacteria | 6766 |
| 43 | Ga0068867_100025139 | 3300005459 | Bacteria | 4272 |
| 44 | Ga0068867_100041938 | 3300005459 | Bacteria | 3344 |
| 45 | Ga0070706_100000084 | 3300005467 | Bacteria | 109077 |
| 46 | Ga0070706_100000210 | 3300005467 | Bacteria | 71893 |
| 47 | Ga0070706_100031923 | 3300005467 | Bacteria | 4856 |
| 48 | Ga0070706_100036522 | 3300005467 | Bacteria | 4538 |
| 49 | Ga0070706_100059306 | 3300005467 | Bacteria | 3531 |
| 50 | Ga0070706_100074398 | 3300005467 | Bacteria | 3144 |
| 51 | Ga0070706_100110216 | 3300005467 | Bacteria | 2561 |
| 52 | Ga0070707_100000921 | 3300005468 | Bacteria | 29187 |
| 53 | Ga0070707_100011410 | 3300005468 | Bacteria | 8286 |
| 54 | Ga0070707_100016015 | 3300005468 | Bacteria | 7034 |
| 55 | Ga0070707_100020926 | 3300005468 | Bacteria | 6176 |
| 56 | Ga0070707_100027194 | 3300005468 | Bacteria | 5441 |
| 57 | Ga0070707_100038569 | 3300005468 | Unclassified | 4563 |
| 58 | Ga0070707_100082998 | 3300005468 | Unclassified | 3096 |
| 59 | Ga0070707_100107192 | 3300005468 | Bacteria | 2710 |
| 60 | Ga0070707_100121309 | 3300005468 | Bacteria | 2538 |
| 61 | Ga0070698_100073435 | 3300005471 | Bacteria | 3427 |
| 62 | Ga0070698_100181691 | 3300005471 | Bacteria | 2042 |
| 63 | Ga0070699_100000496 | 3300005518 | Bacteria | 37333 |
| 64 | Ga0070699_100032053 | 3300005518 | Bacteria | 4538 |
| 65 | Ga0070699_100033902 | 3300005518 | Bacteria | 4411 |
| 66 | Ga0070699_100047532 | 3300005518 | Bacteria | 3713 |
| 67 | Ga0070699_100064704 | 3300005518 | Bacteria | 3172 |
| 68 | Ga0070684_100006345 | 3300005535 | Bacteria | 9137 |
| 69 | Ga0070697_100000246 | 3300005536 | Bacteria | 44044 |
| 70 | Ga0070697_100005201 | 3300005536 | Bacteria | 9994 |
| 71 | Ga0070697_100007344 | 3300005536 | Bacteria | 8572 |
| 72 | Ga0070697_100037369 | 3300005536 | Bacteria | 3922 |
| 73 | Ga0070672_100019102 | 3300005543 | Bacteria | 4967 |
| 74 | Ga0070672_100055257 | 3300005543 | Bacteria | 3110 |
| 75 | Ga0070672_100064271 | 3300005543 | Bacteria | 2899 |
| 76 | Ga0070686_100008506 | 3300005544 | Bacteria | 5748 |
| 77 | Ga0070695_100002610 | 3300005545 | Bacteria | 10409 |
| 78 | Ga0070665_100002500 | 3300005548 | Bacteria | 20221 |
| 79 | Ga0070665_100005755 | 3300005548 | Bacteria | 12726 |
| 80 | Ga0070665_100011357 | 3300005548 | Bacteria | 9006 |
| 81 | Ga0070665_100115224 | 3300005548 | Bacteria | 2690 |
| 82 | Ga0068855_100002522 | 3300005563 | Bacteria | 22554 |
| 83 | Ga0068855_100073543 | 3300005563 | Bacteria | 3971 |
| 84 | Ga0068857_100000556 | 3300005577 | Bacteria | 27260 |
| 85 | Ga0068854_100007304 | 3300005578 | Bacteria | 7059 |
| 86 | Ga0068856_100025155 | 3300005614 | Bacteria | 5801 |
| 87 | Ga0068856_100064531 | 3300005614 | Bacteria | 3618 |
| 88 | Ga0068856_100107886 | 3300005614 | Bacteria | 2780 |
| 89 | Ga0070702_100010816 | 3300005615 | Unclassified | 4513 |
| 90 | Ga0068852_100092895 | 3300005616 | Bacteria | 2703 |
| 91 | Ga0068859_100000528 | 3300005617 | Bacteria | 37973 |
| 92 | Ga0068859_100010970 | 3300005617 | Bacteria | 9121 |
| 93 | Ga0068859_100151264 | 3300005617 | Bacteria | 2396 |
| 94 | Ga0068864_100092615 | 3300005618 | Bacteria | 2668 |
| 95 | Ga0068861_100084655 | 3300005719 | Bacteria | 2490 |
| 96 | Ga0068851_10015519 | 3300005834 | Bacteria | 3630 |
| 97 | Ga0068870_10005121 | 3300005840 | Bacteria | 5702 |
| 98 | Ga0068863_100001383 | 3300005841 | Bacteria | 24073 |
| 99 | Ga0068858_100004958 | 3300005842 | Bacteria | 13041 |
| 100 | Ga0068858_100022963 | 3300005842 | Bacteria | 5817 |
| 101 | Ga0068860_100000566 | 3300005843 | Bacteria | 44586 |
| 102 | Ga0068862_100071086 | 3300005844 | Bacteria | 3005 |
| 103 | Ga0070717_10002711 | 3300006028 | Bacteria | 12488 |
| 104 | Ga0070717_10008639 | 3300006028 | Bacteria | 7616 |
| 105 | Ga0070717_10029770 | 3300006028 | Bacteria | 4384 |
| 106 | Ga0070717_10033330 | 3300006028 | Bacteria | 4155 |
| 107 | Ga0075432_10005125 | 3300006058 | Bacteria | 4465 |
| 108 | Ga0070716_100010341 | 3300006173 | Bacteria | 4675 |
| 109 | Ga0070716_100039995 | 3300006173 | Bacteria | 2606 |
| 110 | Ga0070712_100012681 | 3300006175 | Bacteria | 5366 |
| 111 | Ga0070712_100043992 | 3300006175 | Bacteria | 3077 |
| 112 | Ga0097621_100027840 | 3300006237 | Bacteria | 4449 |
| 113 | Ga0068871_100052497 | 3300006358 | Bacteria | 3301 |
| 114 | Ga0068871_100148221 | 3300006358 | Bacteria | 2000 |
| 115 | Ga0068865_100001494 | 3300006881 | Bacteria | 13636 |
| 116 | Ga0068865_100004875 | 3300006881 | Bacteria | 8118 |
| 117 | Ga0068865_100046178 | 3300006881 | Bacteria | 2988 |
| 118 | Ga0097620_100000528 | 3300006931 | Bacteria | 37973 |
| 119 | Ga0097620_100010970 | 3300006931 | Bacteria | 9121 |
| 120 | Ga0097620_100151261 | 3300006931 | Bacteria | 2396 |
| 121 | Ga0075435_100039700 | 3300007076 | Bacteria | 3757 |
| 122 | Ga0075435_100121102 | 3300007076 | Bacteria | 2183 |
| 123 | Ga0099794_10004737 | 3300007265 | Bacteria | 5390 |
| 124 | Ga0099794_10027526 | 3300007265 | Bacteria | 2636 |
| 125 | Ga0099795_10012271 | 3300007788 | Unclassified | 2593 |
| 126 | Ga0105250_10020647 | 3300009092 | Bacteria | 2661 |
| 127 | Ga0105240_10002073 | 3300009093 | Bacteria | 32845 |
| 128 | Ga0105240_10015909 | 3300009093 | Bacteria | 10206 |
| 129 | Ga0105240_10112468 | 3300009093 | Bacteria | 3291 |
| 130 | Ga0105240_10131063 | 3300009093 | Bacteria | 3008 |
| 131 | Ga0105240_10179048 | 3300009093 | Bacteria | 2504 |
| 132 | Ga0105245_10079643 | 3300009098 | Bacteria | 2991 |
| 133 | Ga0105247_10000304 | 3300009101 | Bacteria | 44112 |
| 134 | Ga0114129_10005859 | 3300009147 | Bacteria | 17398 |
| 135 | Ga0105242_10001003 | 3300009176 | Bacteria | 22140 |
| 136 | Ga0105237_10094783 | 3300009545 | Bacteria | 2974 |
| 137 | Ga0105238_10046293 | 3300009551 | Bacteria | 4390 |
| 138 | Ga0105238_10102061 | 3300009551 | Bacteria | 2851 |
| 139 | Ga0105249_10162030 | 3300009553 | Bacteria | 2162 |
| 140 | Ga0099796_10001310 | 3300010159 | Bacteria | 4928 |
| 141 | Ga0099796_10001504 | 3300010159 | Bacteria | 4726 |
| 142 | Ga0105239_10018881 | 3300010375 | Bacteria | 7618 |
| 143 | Ga0105246_10007398 | 3300011119 | Bacteria | 6729 |
| 144 | Ga0157373_10007743 | 3300013100 | Bacteria | 7985 |
| 145 | Ga0157371_10007984 | 3300013102 | Bacteria | 8485 |
| 146 | Ga0157369_10133261 | 3300013105 | Bacteria | 2632 |
| 147 | Ga0157374_10036661 | 3300013296 | Bacteria | 4493 |
| 148 | Ga0157374_10182428 | 3300013296 | Bacteria | 2051 |
| 149 | Ga0157378_10027143 | 3300013297 | Bacteria | 5052 |
| 150 | Ga0157378_10060656 | 3300013297 | Bacteria | 3375 |
| 151 | Ga0157378_10083137 | 3300013297 | Bacteria | 2896 |
| 152 | Ga0157378_10091382 | 3300013297 | Bacteria | 2767 |
| 153 | Ga0157378_10096655 | 3300013297 | Bacteria | 2692 |
| 154 | Ga0157378_10102112 | 3300013297 | Bacteria | 2619 |
| 155 | Ga0163162_10026803 | 3300013306 | Bacteria | 5698 |
| 156 | Ga0163162_10134366 | 3300013306 | Bacteria | 2584 |
| 157 | Ga0163162_10212037 | 3300013306 | Bacteria | 2067 |
| 158 | Ga0157372_10033333 | 3300013307 | Bacteria | 5656 |
| 159 | Ga0157372_10219318 | 3300013307 | Bacteria | 2205 |
| 160 | Ga0157375_10010011 | 3300013308 | Bacteria | 8336 |
| 161 | Ga0157375_10023874 | 3300013308 | Bacteria | 5649 |
| 162 | Ga0157375_10103632 | 3300013308 | Bacteria | 2933 |
| 163 | Ga0157377_10000510 | 3300014745 | Bacteria | 16489 |
| 164 | Ga0157379_10004099 | 3300014968 | Bacteria | 12435 |
| 165 | Ga0157376_10010978 | 3300014969 | Bacteria | 6654 |
| 166 | Ga0157376_10045777 | 3300014969 | Bacteria | 3605 |
| 167 | Ga0182007_10008225 | 3300015262 | Bacteria | 4298 |
| 168 | Ga0163161_10008846 | 3300017792 | Bacteria | 6963 |
| 169 | Ga0206352_10940153 | 3300020078 | Bacteria | 1912 |
| 170 | Ga0213876_10020083 | 3300021384 | Bacteria | 3530 |
| 171 | Ga0224712_10028393 | 3300022467 | Bacteria | 1999 |
| 172 | Ga0207697_10004645 | 3300025315 | Bacteria | 6517 |
| 173 | Ga0207697_10031841 | 3300025315 | Bacteria | 2158 |
| 174 | Ga0207682_10023566 | 3300025893 | Bacteria | 2432 |
| 175 | Ga0207692_10029157 | 3300025898 | Bacteria | 2619 |
| 176 | Ga0207710_10000118 | 3300025900 | Bacteria | 97453 |
| 177 | Ga0207688_10015865 | 3300025901 | Bacteria | 4087 |
| 178 | Ga0207680_10009348 | 3300025903 | Bacteria | 4859 |
| 179 | Ga0207680_10024779 | 3300025903 | Bacteria | 3298 |
| 180 | Ga0207699_10027104 | 3300025906 | Bacteria | 3168 |
| 181 | Ga0207645_10001234 | 3300025907 | Bacteria | 21056 |
| 182 | Ga0207645_10013051 | 3300025907 | Bacteria | 5614 |
| 183 | Ga0207643_10002519 | 3300025908 | Bacteria | 9907 |
| 184 | Ga0207684_10000006 | 3300025910 | Bacteria | 688605 |
| 185 | Ga0207684_10000028 | 3300025910 | Bacteria | 306450 |
| 186 | Ga0207684_10000040 | 3300025910 | Bacteria | 262703 |
| 187 | Ga0207684_10033282 | 3300025910 | Bacteria | 4383 |
| 188 | Ga0207707_10000973 | 3300025912 | Bacteria | 27532 |
| 189 | Ga0207695_10006973 | 3300025913 | Bacteria | 14504 |
| 190 | Ga0207695_10017905 | 3300025913 | Bacteria | 8207 |
| 191 | Ga0207695_10040662 | 3300025913 | Bacteria | 4982 |
| 192 | Ga0207671_10042615 | 3300025914 | Bacteria | 3359 |
| 193 | Ga0207693_10019679 | 3300025915 | Bacteria | 5368 |
| 194 | Ga0207693_10048395 | 3300025915 | Bacteria | 3338 |
| 195 | Ga0207662_10011109 | 3300025918 | Unclassified | 4981 |
| 196 | Ga0207657_10001839 | 3300025919 | Bacteria | 22917 |
| 197 | Ga0207646_10000116 | 3300025922 | Bacteria | 110396 |
| 198 | Ga0207646_10002363 | 3300025922 | Bacteria | 22298 |
| 199 | Ga0207646_10005442 | 3300025922 | Bacteria | 13391 |
| 200 | Ga0207646_10041714 | 3300025922 | Unclassified | 4124 |
| 201 | Ga0207646_10093818 | 3300025922 | Bacteria | 2688 |
| 202 | Ga0207646_10152800 | 3300025922 | Bacteria | 2082 |
| 203 | Ga0207650_10000150 | 3300025925 | Bacteria | 83380 |
| 204 | Ga0207650_10050085 | 3300025925 | Bacteria | 3087 |
| 205 | Ga0207650_10095056 | 3300025925 | Bacteria | 2284 |
| 206 | Ga0207659_10017310 | 3300025926 | Bacteria | 4707 |
| 207 | Ga0207659_10050791 | 3300025926 | Bacteria | 2947 |
| 208 | Ga0207700_10043049 | 3300025928 | Bacteria | 3314 |
| 209 | Ga0207700_10130492 | 3300025928 | Bacteria | 2051 |
| 210 | Ga0207644_10000598 | 3300025931 | Bacteria | 22999 |
| 211 | Ga0207644_10029993 | 3300025931 | Bacteria | 3777 |
| 212 | Ga0207644_10054531 | 3300025931 | Bacteria | 2879 |
| 213 | Ga0207706_10000790 | 3300025933 | Bacteria | 32752 |
| 214 | Ga0207706_10026332 | 3300025933 | Bacteria | 5205 |
| 215 | Ga0207686_10070906 | 3300025934 | Bacteria | 2240 |
| 216 | Ga0207670_10065218 | 3300025936 | Bacteria | 2498 |
| 217 | Ga0207669_10021917 | 3300025937 | Bacteria | 3383 |
| 218 | Ga0207704_10015184 | 3300025938 | Bacteria | 3916 |
| 219 | Ga0207704_10029478 | 3300025938 | Bacteria | 3061 |
| 220 | Ga0207665_10000312 | 3300025939 | Bacteria | 33656 |
| 221 | Ga0207665_10003990 | 3300025939 | Bacteria | 9862 |
| 222 | Ga0207691_10019964 | 3300025940 | Bacteria | 6339 |
| 223 | Ga0207691_10047591 | 3300025940 | Bacteria | 3935 |
| 224 | Ga0207661_10000422 | 3300025944 | Bacteria | 27313 |
| 225 | Ga0207667_10009676 | 3300025949 | Bacteria | 11338 |
| 226 | Ga0207651_10052972 | 3300025960 | Bacteria | 2770 |
| 227 | Ga0207658_10024449 | 3300025986 | Unclassified | 4227 |
| 228 | Ga0207658_10045330 | 3300025986 | Bacteria | 3205 |
| 229 | Ga0207677_10059541 | 3300026023 | Bacteria | 2634 |
| 230 | Ga0207677_10066067 | 3300026023 | Bacteria | 2527 |
| 231 | Ga0207677_10100219 | 3300026023 | Bacteria | 2129 |
| 232 | Ga0207703_10001123 | 3300026035 | Bacteria | 25270 |
| 233 | Ga0207703_10001175 | 3300026035 | Bacteria | 24706 |
| 234 | Ga0207702_10105542 | 3300026078 | Bacteria | 2495 |
| 235 | Ga0207641_10000147 | 3300026088 | Bacteria | 99902 |
| 236 | Ga0207641_10000197 | 3300026088 | Bacteria | 81805 |
| 237 | Ga0207648_10001035 | 3300026089 | Bacteria | 31211 |
| 238 | Ga0207648_10002984 | 3300026089 | Bacteria | 17884 |
| 239 | Ga0207648_10016359 | 3300026089 | Bacteria | 6778 |
| 240 | Ga0207676_10005773 | 3300026095 | Bacteria | 8753 |
| 241 | Ga0207674_10000432 | 3300026116 | Bacteria | 54683 |
| 242 | Ga0207675_100014652 | 3300026118 | Bacteria | 7310 |
| 243 | Ga0207683_10000692 | 3300026121 | Bacteria | 30940 |
| 244 | Ga0207683_10062744 | 3300026121 | Bacteria | 3273 |
| 245 | Ga0207683_10091017 | 3300026121 | Bacteria | 2717 |
| 246 | Ga0207683_10142795 | 3300026121 | Bacteria | 2157 |
| 247 | Ga0268266_10002158 | 3300028379 | Bacteria | 21584 |
| 248 | Ga0268266_10022597 | 3300028379 | Bacteria | 5356 |
| 249 | Ga0268266_10023737 | 3300028379 | Bacteria | 5219 |
| 250 | Ga0268266_10037619 | 3300028379 | Bacteria | 4121 |
| 251 | Ga0268266_10053112 | 3300028379 | Bacteria | 3480 |
| 252 | Ga0268265_10084597 | 3300028380 | Bacteria | 2515 |
| 253 | Ga0268265_10172706 | 3300028380 | Bacteria | 1849 |
| 254 | Ga0268264_10000025 | 3300028381 | Bacteria | 468619 |
| 255 | Ga0268264_10085576 | 3300028381 | Bacteria | 2706 |
| 256 | Ga0268264_10105195 | 3300028381 | Bacteria | 2461 |
| 257 | Ga0265338_10022985 | 3300028800 | Bacteria | 6429 |
| 258 | Ga0307511_10000449 | 3300030521 | Bacteria | 44264 |
| 259 | Ga0265328_10027904 | 3300031239 | Bacteria | 2114 |
| 260 | Ga0265320_10003148 | 3300031240 | Bacteria | 11196 |
| 261 | Ga0265339_10050086 | 3300031249 | Bacteria | 2285 |
| 262 | Ga0265331_10014746 | 3300031250 | Bacteria | 4150 |
| 263 | Ga0265316_10007894 | 3300031344 | Bacteria | 9959 |
| 264 | Ga0265316_10019082 | 3300031344 | Bacteria | 5874 |
| 265 | Ga0307508_10017833 | 3300031616 | Bacteria | 6455 |
| 266 | Ga0265314_10013308 | 3300031711 | Bacteria | 6653 |
| 267 | Ga0265314_10069231 | 3300031711 | Bacteria | 2369 |
| 268 | Ga0307516_10000260 | 3300031730 | Bacteria | 67580 |
| 269 | Ga0307510_10000012 | 3300033180 | Bacteria | 345634 |
| 270 | Ga0307510_10010978 | 3300033180 | Bacteria | 10767 |
| 271 | Ga0373936_0017159 | 3300035113 | Bacteria | 2786 |
| 272 | Ga0373943_0023446 | 3300035170 | Unclassified | 2870 |
| 273 | Ga0373947_0049184 | 3300035725 | Unclassified | 2531 |
| 274 | Ga0373937_0014408 | 3300036401 | Bacteria | 6981 |
| 275 | Ga0373925_0002744 | 3300037068 | Bacteria | 13935 |
| 276 | Ga0373925_0107150 | 3300037068 | Unclassified | 2155 |
| 277 | Ga0395900_0046260 | 3300037418 | Bacteria | 4481 |
| 278 | Ga0395898_0069348 | 3300037466 | Unclassified | 3411 |
| 279 | Ga0436364_0352896 | 3300037853 | Bacteria | 22874 |
| 280 | Ga0436365_1386032 | 3300039437 | Bacteria | 6383 |
| 281 | Ga0436365_1466484 | 3300039437 | Bacteria | 15322 |
| 282 | Ga0436362_1263978 | 3300039453 | Bacteria | 3954 |
| 283 | Ga0439438_008970 | 3300041405 | Bacteria | 3269 |
| 284 | Ga0450902_000472 | 3300042137 | Bacteria | 5016 |
| 285 | Ga0466959_0008481 | 3300045049 | Bacteria | 7271 |
| 286 | Ga0466959_0032101 | 3300045049 | Bacteria | 3887 |
| 287 | Ga0466958_0047751 | 3300045836 | Bacteria | 2585 |
| 288 | Ga0495617_002651 | 3300046452 | Bacteria | 6972 |
| 289 | Ga0495617_005864 | 3300046452 | Bacteria | 4333 |
| 290 | Ga0495627_004466 | 3300046453 | Bacteria | 5851 |
| 291 | Ga0495627_010394 | 3300046453 | Bacteria | 3385 |
| 292 | Ga0495590_0001160 | 3300046457 | Bacteria | 11534 |
| 293 | Ga0495591_000207 | 3300046458 | Bacteria | 59959 |
| 294 | Ga0495591_009962 | 3300046458 | Bacteria | 3729 |
| 295 | Ga0495629_0010647 | 3300046459 | Bacteria | 6690 |
| 296 | Ga0495638_0003952 | 3300046460 | Bacteria | 11436 |
| 297 | Ga0495638_0006328 | 3300046460 | Bacteria | 8629 |
| 298 | Ga0495650_0003602 | 3300046471 | Bacteria | 11162 |
| 299 | Ga0495580_0008403 | 3300046472 | Bacteria | 8212 |
| 300 | Ga0495582_0011604 | 3300046473 | Bacteria | 4855 |
| 301 | Ga0495605_0008209 | 3300046474 | Bacteria | 5905 |
| 302 | Ga0495584_0020728 | 3300046491 | Bacteria | 3338 |
| 303 | Ga0495596_0000222 | 3300046500 | Bacteria | 38778 |
| 304 | Ga0495607_0001977 | 3300046501 | Bacteria | 17257 |
| 305 | Ga0495606_0012546 | 3300046507 | Bacteria | 6787 |
| 306 | Ga0495610_0005399 | 3300046512 | Bacteria | 9102 |
| 307 | Ga0495616_0009739 | 3300046513 | Bacteria | 5599 |
| 308 | Ga0495620_0020784 | 3300046515 | Bacteria | 3198 |
| 309 | Ga0495631_0003267 | 3300046518 | Bacteria | 8911 |
| 310 | Ga0495632_0001556 | 3300046519 | Bacteria | 18927 |
| 311 | Ga0495637_0000526 | 3300046520 | Bacteria | 27770 |
| 312 | Ga0495637_0012710 | 3300046520 | Bacteria | 4018 |
| 313 | Ga0495643_0009529 | 3300046522 | Bacteria | 6031 |
| 314 | Ga0495644_0000444 | 3300046523 | Bacteria | 18207 |
| 315 | Ga0495648_0015853 | 3300046524 | Bacteria | 5447 |
| 316 | Ga0495654_0001779 | 3300046530 | Bacteria | 14375 |
| 317 | Ga0495598_0009337 | 3300046537 | Bacteria | 2316 |
| 318 | Ga0495597_0006910 | 3300046542 | Bacteria | 5821 |
| 319 | Ga0495668_0001646 | 3300046616 | Bacteria | 20843 |
| 320 | Ga0495625_0004785 | 3300046660 | Bacteria | 12658 |
| 321 | Ga0495625_0059544 | 3300046660 | Bacteria | 2709 |
| 322 | Ga0495661_0009662 | 3300046665 | Bacteria | 6608 |
| 323 | Ga0495661_0077446 | 3300046665 | Bacteria | 1926 |
| 324 | Ga0495669_0009158 | 3300046684 | Unclassified | 4171 |
| 325 | Ga0495670_0023851 | 3300046691 | Bacteria | 3020 |
| 326 | Ga0495649_0021540 | 3300046694 | Bacteria | 3610 |
| 327 | Ga0495649_0027165 | 3300046694 | Bacteria | 3176 |
| 328 | Ga0495589_0003444 | 3300046794 | Bacteria | 8561 |
| 329 | Ga0495660_0033833 | 3300046810 | Bacteria | 2862 |
| 330 | Ga0495660_0052498 | 3300046810 | Bacteria | 2214 |
| 331 | Ga0495672_0003964 | 3300047320 | Bacteria | 12392 |
| 332 | Ga0495672_0017568 | 3300047320 | Bacteria | 4781 |
| 333 | Ga0495683_0002210 | 3300047323 | Bacteria | 11902 |
| 334 | Ga0495683_0005408 | 3300047323 | Bacteria | 7088 |
| 335 | Ga0495687_012734 | 3300047443 | Bacteria | 4432 |
| 336 | Ga0495681_0000985 | 3300047470 | Bacteria | 21803 |
| 337 | Ga0495681_0001937 | 3300047470 | Bacteria | 15147 |
| 338 | Ga0495681_0031281 | 3300047470 | Bacteria | 2696 |
| 339 | Ga0495686_0008702 | 3300047472 | Bacteria | 7410 |
| 340 | Ga0495686_0020599 | 3300047472 | Bacteria | 4395 |
| 341 | Ga0495626_0000595 | 3300048091 | Bacteria | 35439 |
| 342 | Ga0495626_0052346 | 3300048091 | Bacteria | 1882 |
| 343 | Ga0496107_0094191 | 3300048910 | Bacteria | 2191 |
| 344 | Ga0496108_0000051 | 3300048911 | Bacteria | 131546 |
| 345 | Ga0496109_0000105 | 3300048912 | Bacteria | 87116 |
| 346 | Ga0496109_0089548 | 3300048912 | Bacteria | 2845 |
| 347 | Ga0496110_0000941 | 3300048913 | Bacteria | 20418 |
| 348 | Ga0496112_0014151 | 3300048915 | Bacteria | 7390 |
| 349 | Ga0496112_0021630 | 3300048915 | Bacteria | 6118 |
| 350 | Ga0496112_0058111 | 3300048915 | Bacteria | 3809 |
| 351 | Ga0496113_0000254 | 3300048916 | Bacteria | 25129 |
| 352 | Ga0496114_0000008 | 3300048917 | Bacteria | 420692 |
| 353 | Ga0496115_0199622 | 3300048918 | Unclassified | 1652 |
| 354 | Ga0496117_0000110 | 3300048920 | Bacteria | 184627 |
| 355 | Ga0496118_0000014 | 3300048921 | Bacteria | 561628 |
| 356 | Ga0496119_0000203 | 3300048922 | Bacteria | 84250 |
| 357 | Ga0496119_0010792 | 3300048922 | Bacteria | 7646 |
| 358 | Ga0496120_0000018 | 3300048923 | Bacteria | 263952 |
| 359 | Ga0496121_0005145 | 3300048924 | Bacteria | 17009 |
| 360 | Ga0496121_0021747 | 3300048924 | Bacteria | 6267 |
| 361 | Ga0496125_0000362 | 3300048928 | Bacteria | 85671 |
| 362 | Ga0496125_0015867 | 3300048928 | Bacteria | 7257 |
| 363 | Ga0496126_0011815 | 3300048929 | Bacteria | 8985 |
| 364 | Ga0496126_0013935 | 3300048929 | Bacteria | 8155 |
| 365 | Ga0496126_0063432 | 3300048929 | Bacteria | 3312 |
| 366 | Ga0495678_002119 | 3300049459 | Bacteria | 14093 |
| 367 | Ga0501068_0008818 | 3300049584 | Bacteria | 5625 |
| 368 | Ga0501071_0019483 | 3300049587 | Bacteria | 4708 |
| 369 | Ga0501077_0024350 | 3300049593 | Bacteria | 3843 |
| 370 | Ga0501079_0000568 | 3300049741 | Bacteria | 24335 |
| 371 | Ga0501080_0014450 | 3300049742 | Bacteria | 7272 |
| 372 | Ga0501083_0012797 | 3300049744 | Bacteria | 5869 |
| 373 | nmdc:mga05p37_194900_c1 | 3300050507 | Bacteria | 2457 |
| 374 | nmdc:mga05p37_65507_c1 | 3300050507 | Bacteria | 4470 |
| 375 | nmdc:mga0rr50_15681_c1 | 3300050513 | Bacteria | 3802 |
| 376 | nmdc:mga0a205_170663_c1 | 3300050515 | Bacteria | 2071 |
| 377 | nmdc:mga0a205_34439_c1 | 3300050515 | Bacteria | 4858 |
| 378 | Ga0500577_0001331 | 3300053142 | Bacteria | 6321 |
| 379 | Ga0501084_0023493 | 3300054114 | Bacteria | 5144 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048918 | Ga0496115_0199622 | Ga0496115_0199622_15_1565 | 477 |
| 2 | 3300041405 | Ga0439438_008970 | Ga0439438_008970_1382_2860 | 485 |
| 3 | 3300042137 | Ga0450902_000472 | Ga0450902_000472_2905_4383 | 485 |
| 4 | 3300046460 | Ga0495638_0006328 | Ga0495638_0006328_2947_4425 | 485 |
| 5 | 3300046522 | Ga0495643_0009529 | Ga0495643_0009529_3394_4872 | 485 |
| 6 | 3300046542 | Ga0495597_0006910 | Ga0495597_0006910_396_1874 | 485 |
| 7 | 3300046665 | Ga0495661_0077446 | Ga0495661_0077446_11_1489 | 485 |
| 8 | 3300046694 | Ga0495649_0021540 | Ga0495649_0021540_751_2229 | 485 |
| 9 | 3300046810 | Ga0495660_0052498 | Ga0495660_0052498_634_2112 | 485 |
| 10 | 3300047320 | Ga0495672_0017568 | Ga0495672_0017568_168_1646 | 485 |
| 11 | 3300047472 | Ga0495686_0008702 | Ga0495686_0008702_751_2229 | 485 |
| 12 | 3300048091 | Ga0495626_0052346 | Ga0495626_0052346_20_1498 | 485 |
| 13 | 3300049459 | Ga0495678_002119 | Ga0495678_002119_9676_11154 | 485 |
| 14 | 3300005288 | Ga0065714_10002938 | Ga0065714_100029384 | 489 |
| 15 | 3300006058 | Ga0075432_10005125 | Ga0075432_100051255 | 489 |
| 16 | 3300046452 | Ga0495617_002651 | Ga0495617_002651_2346_3848 | 489 |
| 17 | 3300046452 | Ga0495617_005864 | Ga0495617_005864_1702_3192 | 489 |
| 18 | 3300046453 | Ga0495627_004466 | Ga0495627_004466_4257_5759 | 489 |
| 19 | 3300046453 | Ga0495627_010394 | Ga0495627_010394_1364_2854 | 489 |
| 20 | 3300046457 | Ga0495590_0001160 | Ga0495590_0001160_6623_8113 | 489 |
| 21 | 3300046458 | Ga0495591_000207 | Ga0495591_000207_22585_24075 | 489 |
| 22 | 3300046458 | Ga0495591_009962 | Ga0495591_009962_1954_3456 | 489 |
| 23 | 3300046460 | Ga0495638_0003952 | Ga0495638_0003952_3569_5059 | 489 |
| 24 | 3300046471 | Ga0495650_0003602 | Ga0495650_0003602_3295_4785 | 489 |
| 25 | 3300046474 | Ga0495605_0008209 | Ga0495605_0008209_2845_4347 | 489 |
| 26 | 3300046491 | Ga0495584_0020728 | Ga0495584_0020728_186_1676 | 489 |
| 27 | 3300046500 | Ga0495596_0000222 | Ga0495596_0000222_14801_16291 | 489 |
| 28 | 3300046501 | Ga0495607_0001977 | Ga0495607_0001977_10081_11583 | 489 |
| 29 | 3300046507 | Ga0495606_0012546 | Ga0495606_0012546_4883_6373 | 489 |
| 30 | 3300046512 | Ga0495610_0005399 | Ga0495610_0005399_5832_7322 | 489 |
| 31 | 3300046513 | Ga0495616_0009739 | Ga0495616_0009739_237_1739 | 489 |
| 32 | 3300046515 | Ga0495620_0020784 | Ga0495620_0020784_135_1625 | 489 |
| 33 | 3300046518 | Ga0495631_0003267 | Ga0495631_0003267_3830_5320 | 489 |
| 34 | 3300046519 | Ga0495632_0001556 | Ga0495632_0001556_10737_12227 | 489 |
| 35 | 3300046520 | Ga0495637_0000526 | Ga0495637_0000526_11499_12989 | 489 |
| 36 | 3300046520 | Ga0495637_0012710 | Ga0495637_0012710_1878_3380 | 489 |
| 37 | 3300046523 | Ga0495644_0000444 | Ga0495644_0000444_12561_14063 | 489 |
| 38 | 3300046524 | Ga0495648_0015853 | Ga0495648_0015853_2039_3529 | 489 |
| 39 | 3300046530 | Ga0495654_0001779 | Ga0495654_0001779_6679_8169 | 489 |
| 40 | 3300046616 | Ga0495668_0001646 | Ga0495668_0001646_14133_15623 | 489 |
| 41 | 3300046660 | Ga0495625_0004785 | Ga0495625_0004785_5624_7114 | 489 |
| 42 | 3300046660 | Ga0495625_0059544 | Ga0495625_0059544_683_2185 | 489 |
| 43 | 3300046665 | Ga0495661_0009662 | Ga0495661_0009662_3849_5339 | 489 |
| 44 | 3300046691 | Ga0495670_0023851 | Ga0495670_0023851_205_1707 | 489 |
| 45 | 3300046694 | Ga0495649_0027165 | Ga0495649_0027165_936_2426 | 489 |
| 46 | 3300046794 | Ga0495589_0003444 | Ga0495589_0003444_6657_8147 | 489 |
| 47 | 3300046810 | Ga0495660_0033833 | Ga0495660_0033833_770_2260 | 489 |
| 48 | 3300047320 | Ga0495672_0003964 | Ga0495672_0003964_10394_11935 | 489 |
| 49 | 3300047323 | Ga0495683_0002210 | Ga0495683_0002210_3278_4819 | 489 |
| 50 | 3300047323 | Ga0495683_0005408 | Ga0495683_0005408_2046_3536 | 489 |
| 51 | 3300047470 | Ga0495681_0000985 | Ga0495681_0000985_13613_15103 | 489 |
| 52 | 3300047470 | Ga0495681_0001937 | Ga0495681_0001937_11841_13343 | 489 |
| 53 | 3300047470 | Ga0495681_0031281 | Ga0495681_0031281_748_2250 | 489 |
| 54 | 3300047472 | Ga0495686_0020599 | Ga0495686_0020599_2068_3558 | 489 |
| 55 | 3300048091 | Ga0495626_0000595 | Ga0495626_0000595_19786_21276 | 489 |
| 56 | 3300046459 | Ga0495629_0010647 | Ga0495629_0010647_4786_6486 | 491 |
| 57 | 3300053142 | Ga0500577_0001331 | Ga0500577_0001331_3501_5072 | 504 |
| 58 | 3300039437 | Ga0436365_1386032 | Ga0436365_1386032_1123_2793 | 514 |
| 59 | 3300005518 | Ga0070699_100000496 | Ga0070699_1000004967 | 526 |
| 60 | 3300025922 | Ga0207646_10152800 | Ga0207646_101528001 | 529 |
| 61 | 3300005367 | Ga0070667_100144240 | Ga0070667_1001442401 | 530 |
| 62 | 3300025986 | Ga0207658_10045330 | Ga0207658_100453302 | 530 |
| 63 | 3300048917 | Ga0496114_0000008 | Ga0496114_0000008_205787_207478 | 530 |
| 64 | 3300005445 | Ga0070708_100005176 | Ga0070708_1000051766 | 533 |
| 65 | 3300005467 | Ga0070706_100000084 | Ga0070706_10000008444 | 533 |
| 66 | 3300005468 | Ga0070707_100016015 | Ga0070707_1000160155 | 533 |
| 67 | 3300005471 | Ga0070698_100073435 | Ga0070698_1000734353 | 533 |
| 68 | 3300006028 | Ga0070717_10002711 | Ga0070717_100027117 | 533 |
| 69 | 3300025910 | Ga0207684_10000040 | Ga0207684_10000040221 | 533 |
| 70 | 3300005468 | Ga0070707_100011410 | Ga0070707_10001141011 | 536 |
| 71 | 3300005518 | Ga0070699_100033902 | Ga0070699_1000339022 | 536 |
| 72 | 3300005536 | Ga0070697_100000246 | Ga0070697_10000024629 | 536 |
| 73 | 3300025922 | Ga0207646_10002363 | Ga0207646_1000236323 | 536 |
| 74 | 3300009093 | Ga0105240_10112468 | Ga0105240_101124682 | 539 |
| 75 | 3300005289 | Ga0065704_10006929 | Ga0065704_100069292 | 541 |
| 76 | 3300031616 | Ga0307508_10017833 | Ga0307508_100178334 | 541 |
| 77 | 3300005467 | Ga0070706_100036522 | Ga0070706_1000365223 | 542 |
| 78 | 3300005518 | Ga0070699_100032053 | Ga0070699_1000320533 | 542 |
| 79 | 3300025910 | Ga0207684_10000006 | Ga0207684_10000006677 | 542 |
| 80 | 3300025922 | Ga0207646_10000116 | Ga0207646_1000011610 | 542 |
| 81 | 3300006173 | Ga0070716_100039995 | Ga0070716_1000399952 | 543 |
| 82 | 3300005841 | Ga0068863_100001383 | Ga0068863_10000138316 | 544 |
| 83 | 3300009092 | Ga0105250_10020647 | Ga0105250_100206472 | 544 |
| 84 | 3300009101 | Ga0105247_10000304 | Ga0105247_1000030426 | 544 |
| 85 | 3300014968 | Ga0157379_10004099 | Ga0157379_100040996 | 544 |
| 86 | 3300025900 | Ga0207710_10000118 | Ga0207710_1000011854 | 544 |
| 87 | 3300025931 | Ga0207644_10000598 | Ga0207644_1000059814 | 544 |
| 88 | 3300048924 | Ga0496121_0005145 | Ga0496121_0005145_8784_10535 | 544 |
| 89 | 3300049584 | Ga0501068_0008818 | Ga0501068_0008818_1189_2919 | 546 |
| 90 | 3300049587 | Ga0501071_0019483 | Ga0501071_0019483_957_2687 | 546 |
| 91 | 3300049593 | Ga0501077_0024350 | Ga0501077_0024350_442_2172 | 546 |
| 92 | 3300049741 | Ga0501079_0000568 | Ga0501079_0000568_19211_20941 | 546 |
| 93 | 3300049742 | Ga0501080_0014450 | Ga0501080_0014450_1188_2918 | 546 |
| 94 | 3300049744 | Ga0501083_0012797 | Ga0501083_0012797_3441_5171 | 546 |
| 95 | 3300054114 | Ga0501084_0023493 | Ga0501084_0023493_1622_3352 | 546 |
| 96 | 3300031344 | Ga0265316_10007894 | Ga0265316_100078942 | 547 |
| 97 | 3300031711 | Ga0265314_10013308 | Ga0265314_100133082 | 547 |
| 98 | 3300005335 | Ga0070666_10043453 | Ga0070666_100434532 | 548 |
| 99 | 3300005338 | Ga0068868_100123372 | Ga0068868_1001233721 | 548 |
| 100 | 3300005445 | Ga0070708_100000569 | Ga0070708_10000056924 | 548 |
| 101 | 3300005459 | Ga0068867_100041938 | Ga0068867_1000419383 | 548 |
| 102 | 3300005617 | Ga0068859_100000528 | Ga0068859_10000052821 | 548 |
| 103 | 3300006358 | Ga0068871_100052497 | Ga0068871_1000524972 | 548 |
| 104 | 3300006881 | Ga0068865_100001494 | Ga0068865_10000149412 | 548 |
| 105 | 3300006931 | Ga0097620_100000528 | Ga0097620_10000052821 | 548 |
| 106 | 3300009176 | Ga0105242_10001003 | Ga0105242_100010037 | 548 |
| 107 | 3300014969 | Ga0157376_10045777 | Ga0157376_100457772 | 548 |
| 108 | 3300025934 | Ga0207686_10070906 | Ga0207686_100709061 | 548 |
| 109 | 3300026023 | Ga0207677_10100219 | Ga0207677_101002191 | 548 |
| 110 | 3300026035 | Ga0207703_10001175 | Ga0207703_100011751 | 548 |
| 111 | 3300028380 | Ga0268265_10172706 | Ga0268265_101727061 | 548 |
| 112 | 3300025939 | Ga0207665_10003990 | Ga0207665_100039904 | 549 |
| 113 | 3300005445 | Ga0070708_100063479 | Ga0070708_1000634792 | 550 |
| 114 | 3300005467 | Ga0070706_100074398 | Ga0070706_1000743982 | 550 |
| 115 | 3300005468 | Ga0070707_100038569 | Ga0070707_1000385694 | 550 |
| 116 | 3300025922 | Ga0207646_10041714 | Ga0207646_100417142 | 550 |
| 117 | 3300013297 | Ga0157378_10102112 | Ga0157378_101021122 | 551 |
| 118 | 3300028381 | Ga0268264_10085576 | Ga0268264_100855762 | 551 |
| 119 | 3300035170 | Ga0373943_0023446 | Ga0373943_0023446_973_2742 | 552 |
| 120 | 3300037068 | Ga0373925_0107150 | Ga0373925_0107150_286_2055 | 552 |
| 121 | 3300005468 | Ga0070707_100027194 | Ga0070707_1000271945 | 553 |
| 122 | 3300006173 | Ga0070716_100010341 | Ga0070716_1000103413 | 553 |
| 123 | 3300007788 | Ga0099795_10012271 | Ga0099795_100122711 | 553 |
| 124 | 3300025922 | Ga0207646_10093818 | Ga0207646_100938181 | 553 |
| 125 | 3300007265 | Ga0099794_10027526 | Ga0099794_100275262 | 554 |
| 126 | 3300005436 | Ga0070713_100075836 | Ga0070713_1000758362 | 557 |
| 127 | 3300005468 | Ga0070707_100082998 | Ga0070707_1000829981 | 557 |
| 128 | 3300035725 | Ga0373947_0049184 | Ga0373947_0049184_496_2277 | 557 |
| 129 | 3300037068 | Ga0373925_0002744 | Ga0373925_0002744_6899_8680 | 557 |
| 130 | 3300005467 | Ga0070706_100110216 | Ga0070706_1001102161 | 558 |
| 131 | 3300005471 | Ga0070698_100181691 | Ga0070698_1001816911 | 558 |
| 132 | 3300005536 | Ga0070697_100037369 | Ga0070697_1000373693 | 558 |
| 133 | 3300025907 | Ga0207645_10013051 | Ga0207645_100130512 | 558 |
| 134 | 3300031249 | Ga0265339_10050086 | Ga0265339_100500861 | 558 |
| 135 | 3300005467 | Ga0070706_100031923 | Ga0070706_1000319232 | 559 |
| 136 | 3300005468 | Ga0070707_100000921 | Ga0070707_10000092114 | 559 |
| 137 | 3300025939 | Ga0207665_10000312 | Ga0207665_1000031216 | 560 |
| 138 | 3300005328 | Ga0070676_10011260 | Ga0070676_100112602 | 561 |
| 139 | 3300005337 | Ga0070682_100044845 | Ga0070682_1000448452 | 561 |
| 140 | 3300005340 | Ga0070689_100013949 | Ga0070689_1000139492 | 561 |
| 141 | 3300005343 | Ga0070687_100030825 | Ga0070687_1000308252 | 561 |
| 142 | 3300005347 | Ga0070668_100006773 | Ga0070668_1000067733 | 561 |
| 143 | 3300005353 | Ga0070669_100012981 | Ga0070669_1000129813 | 561 |
| 144 | 3300005356 | Ga0070674_100031235 | Ga0070674_1000312352 | 561 |
| 145 | 3300005365 | Ga0070688_100003908 | Ga0070688_1000039083 | 561 |
| 146 | 3300005366 | Ga0070659_100000527 | Ga0070659_10000052723 | 561 |
| 147 | 3300005459 | Ga0068867_100009755 | Ga0068867_1000097553 | 561 |
| 148 | 3300005535 | Ga0070684_100006345 | Ga0070684_1000063453 | 561 |
| 149 | 3300005543 | Ga0070672_100019102 | Ga0070672_1000191025 | 561 |
| 150 | 3300005543 | Ga0070672_100064271 | Ga0070672_1000642712 | 561 |
| 151 | 3300005544 | Ga0070686_100008506 | Ga0070686_1000085062 | 561 |
| 152 | 3300005563 | Ga0068855_100073543 | Ga0068855_1000735434 | 561 |
| 153 | 3300005577 | Ga0068857_100000556 | Ga0068857_10000055616 | 561 |
| 154 | 3300005578 | Ga0068854_100007304 | Ga0068854_1000073043 | 561 |
| 155 | 3300005614 | Ga0068856_100064531 | Ga0068856_1000645312 | 561 |
| 156 | 3300005615 | Ga0070702_100010816 | Ga0070702_1000108162 | 561 |
| 157 | 3300005616 | Ga0068852_100092895 | Ga0068852_1000928952 | 561 |
| 158 | 3300005617 | Ga0068859_100151264 | Ga0068859_1001512641 | 561 |
| 159 | 3300005618 | Ga0068864_100092615 | Ga0068864_1000926152 | 561 |
| 160 | 3300005719 | Ga0068861_100084655 | Ga0068861_1000846552 | 561 |
| 161 | 3300005834 | Ga0068851_10015519 | Ga0068851_100155191 | 561 |
| 162 | 3300005840 | Ga0068870_10005121 | Ga0068870_100051212 | 561 |
| 163 | 3300005842 | Ga0068858_100004958 | Ga0068858_1000049585 | 561 |
| 164 | 3300006237 | Ga0097621_100027840 | Ga0097621_1000278404 | 561 |
| 165 | 3300006881 | Ga0068865_100004875 | Ga0068865_1000048753 | 561 |
| 166 | 3300006931 | Ga0097620_100151261 | Ga0097620_1001512611 | 561 |
| 167 | 3300009098 | Ga0105245_10079643 | Ga0105245_100796432 | 561 |
| 168 | 3300009553 | Ga0105249_10162030 | Ga0105249_101620301 | 561 |
| 169 | 3300010375 | Ga0105239_10018881 | Ga0105239_100188813 | 561 |
| 170 | 3300011119 | Ga0105246_10007398 | Ga0105246_100073982 | 561 |
| 171 | 3300013100 | Ga0157373_10007743 | Ga0157373_100077433 | 561 |
| 172 | 3300013102 | Ga0157371_10007984 | Ga0157371_100079844 | 561 |
| 173 | 3300013297 | Ga0157378_10091382 | Ga0157378_100913822 | 561 |
| 174 | 3300013307 | Ga0157372_10033333 | Ga0157372_100333332 | 561 |
| 175 | 3300013308 | Ga0157375_10023874 | Ga0157375_100238746 | 561 |
| 176 | 3300014745 | Ga0157377_10000510 | Ga0157377_1000051014 | 561 |
| 177 | 3300017792 | Ga0163161_10008846 | Ga0163161_100088464 | 561 |
| 178 | 3300025893 | Ga0207682_10023566 | Ga0207682_100235663 | 561 |
| 179 | 3300025903 | Ga0207680_10024779 | Ga0207680_100247792 | 561 |
| 180 | 3300025907 | Ga0207645_10001234 | Ga0207645_1000123418 | 561 |
| 181 | 3300025908 | Ga0207643_10002519 | Ga0207643_100025192 | 561 |
| 182 | 3300025918 | Ga0207662_10011109 | Ga0207662_100111094 | 561 |
| 183 | 3300025919 | Ga0207657_10001839 | Ga0207657_100018392 | 561 |
| 184 | 3300025925 | Ga0207650_10000150 | Ga0207650_1000015020 | 561 |
| 185 | 3300025931 | Ga0207644_10054531 | Ga0207644_100545313 | 561 |
| 186 | 3300025933 | Ga0207706_10000790 | Ga0207706_100007902 | 561 |
| 187 | 3300025938 | Ga0207704_10029478 | Ga0207704_100294782 | 561 |
| 188 | 3300025940 | Ga0207691_10019964 | Ga0207691_100199644 | 561 |
| 189 | 3300025944 | Ga0207661_10000422 | Ga0207661_100004221 | 561 |
| 190 | 3300025986 | Ga0207658_10024449 | Ga0207658_100244492 | 561 |
| 191 | 3300026023 | Ga0207677_10059541 | Ga0207677_100595413 | 561 |
| 192 | 3300026078 | Ga0207702_10105542 | Ga0207702_101055422 | 561 |
| 193 | 3300026088 | Ga0207641_10000147 | Ga0207641_1000014775 | 561 |
| 194 | 3300026089 | Ga0207648_10001035 | Ga0207648_1000103527 | 561 |
| 195 | 3300026089 | Ga0207648_10002984 | Ga0207648_1000298413 | 561 |
| 196 | 3300026095 | Ga0207676_10005773 | Ga0207676_100057733 | 561 |
| 197 | 3300026116 | Ga0207674_10000432 | Ga0207674_1000043218 | 561 |
| 198 | 3300026118 | Ga0207675_100014652 | Ga0207675_1000146525 | 561 |
| 199 | 3300026121 | Ga0207683_10000692 | Ga0207683_100006923 | 561 |
| 200 | 3300026121 | Ga0207683_10091017 | Ga0207683_100910172 | 561 |
| 201 | 3300028379 | Ga0268266_10023737 | Ga0268266_100237373 | 561 |
| 202 | 3300028381 | Ga0268264_10105195 | Ga0268264_101051953 | 561 |
| 203 | 3300031730 | Ga0307516_10000260 | Ga0307516_100002606 | 561 |
| 204 | 3300048910 | Ga0496107_0094191 | Ga0496107_0094191_256_2079 | 561 |
| 205 | 3300048911 | Ga0496108_0000051 | Ga0496108_0000051_87831_89654 | 561 |
| 206 | 3300048912 | Ga0496109_0000105 | Ga0496109_0000105_35161_36984 | 561 |
| 207 | 3300048913 | Ga0496110_0000941 | Ga0496110_0000941_1093_2916 | 561 |
| 208 | 3300048915 | Ga0496112_0014151 | Ga0496112_0014151_4502_6304 | 561 |
| 209 | 3300048916 | Ga0496113_0000254 | Ga0496113_0000254_13430_15253 | 561 |
| 210 | 3300005518 | Ga0070699_100064704 | Ga0070699_1000647042 | 562 |
| 211 | 3300015262 | Ga0182007_10008225 | Ga0182007_100082251 | 562 |
| 212 | 3300031239 | Ga0265328_10027904 | Ga0265328_100279041 | 562 |
| 213 | 3300031240 | Ga0265320_10003148 | Ga0265320_100031485 | 562 |
| 214 | 3300031250 | Ga0265331_10014746 | Ga0265331_100147461 | 562 |
| 215 | 3300031344 | Ga0265316_10019082 | Ga0265316_100190821 | 562 |
| 216 | 3300031711 | Ga0265314_10069231 | Ga0265314_100692311 | 562 |
| 217 | 3300009093 | Ga0105240_10179048 | Ga0105240_101790481 | 563 |
| 218 | 3300028800 | Ga0265338_10022985 | Ga0265338_100229858 | 563 |
| 219 | 3300035113 | Ga0373936_0017159 | Ga0373936_0017159_59_1795 | 563 |
| 220 | 3300047443 | Ga0495687_012734 | Ga0495687_012734_1163_2998 | 563 |
| 221 | 3300048929 | Ga0496126_0011815 | Ga0496126_0011815_4015_5748 | 563 |
| 222 | 3300005331 | Ga0070670_100171758 | Ga0070670_1001717581 | 564 |
| 223 | 3300005335 | Ga0070666_10093277 | Ga0070666_100932772 | 564 |
| 224 | 3300005338 | Ga0068868_100062376 | Ga0068868_1000623763 | 564 |
| 225 | 3300005340 | Ga0070689_100024132 | Ga0070689_1000241323 | 564 |
| 226 | 3300005347 | Ga0070668_100018538 | Ga0070668_1000185385 | 564 |
| 227 | 3300005353 | Ga0070669_100007746 | Ga0070669_1000077463 | 564 |
| 228 | 3300005354 | Ga0070675_100022069 | Ga0070675_1000220693 | 564 |
| 229 | 3300005356 | Ga0070674_100010070 | Ga0070674_1000100701 | 564 |
| 230 | 3300005364 | Ga0070673_100014084 | Ga0070673_1000140842 | 564 |
| 231 | 3300005365 | Ga0070688_100005607 | Ga0070688_1000056072 | 564 |
| 232 | 3300005367 | Ga0070667_100082805 | Ga0070667_1000828052 | 564 |
| 233 | 3300005456 | Ga0070678_100047303 | Ga0070678_1000473032 | 564 |
| 234 | 3300005459 | Ga0068867_100025139 | Ga0068867_1000251393 | 564 |
| 235 | 3300005468 | Ga0070707_100020926 | Ga0070707_1000209262 | 564 |
| 236 | 3300005536 | Ga0070697_100007344 | Ga0070697_1000073445 | 564 |
| 237 | 3300005548 | Ga0070665_100115224 | Ga0070665_1001152241 | 564 |
| 238 | 3300006881 | Ga0068865_100046178 | Ga0068865_1000461783 | 564 |
| 239 | 3300007265 | Ga0099794_10004737 | Ga0099794_100047373 | 564 |
| 240 | 3300009093 | Ga0105240_10131063 | Ga0105240_101310632 | 564 |
| 241 | 3300013296 | Ga0157374_10036661 | Ga0157374_100366612 | 564 |
| 242 | 3300013297 | Ga0157378_10027143 | Ga0157378_100271433 | 564 |
| 243 | 3300013306 | Ga0163162_10026803 | Ga0163162_100268033 | 564 |
| 244 | 3300013308 | Ga0157375_10103632 | Ga0157375_101036321 | 564 |
| 245 | 3300025315 | Ga0207697_10004645 | Ga0207697_100046453 | 564 |
| 246 | 3300025901 | Ga0207688_10015865 | Ga0207688_100158651 | 564 |
| 247 | 3300025913 | Ga0207695_10040662 | Ga0207695_100406622 | 564 |
| 248 | 3300025926 | Ga0207659_10050791 | Ga0207659_100507912 | 564 |
| 249 | 3300025936 | Ga0207670_10065218 | Ga0207670_100652181 | 564 |
| 250 | 3300025937 | Ga0207669_10021917 | Ga0207669_100219172 | 564 |
| 251 | 3300025938 | Ga0207704_10015184 | Ga0207704_100151841 | 564 |
| 252 | 3300025940 | Ga0207691_10047591 | Ga0207691_100475912 | 564 |
| 253 | 3300026023 | Ga0207677_10066067 | Ga0207677_100660671 | 564 |
| 254 | 3300026089 | Ga0207648_10016359 | Ga0207648_100163594 | 564 |
| 255 | 3300026121 | Ga0207683_10062744 | Ga0207683_100627442 | 564 |
| 256 | 3300028379 | Ga0268266_10022597 | Ga0268266_100225972 | 564 |
| 257 | 3300028380 | Ga0268265_10084597 | Ga0268265_100845972 | 564 |
| 258 | 3300030521 | Ga0307511_10000449 | Ga0307511_100004494 | 564 |
| 259 | 3300048912 | Ga0496109_0089548 | Ga0496109_0089548_228_1997 | 564 |
| 260 | 3300048915 | Ga0496112_0058111 | Ga0496112_0058111_197_1966 | 564 |
| 261 | 3300006175 | Ga0070712_100012681 | Ga0070712_1000126814 | 565 |
| 262 | 3300010159 | Ga0099796_10001504 | Ga0099796_100015043 | 565 |
| 263 | 3300025910 | Ga0207684_10033282 | Ga0207684_100332821 | 565 |
| 264 | 3300013297 | Ga0157378_10096655 | Ga0157378_100966551 | 566 |
| 265 | 3300025915 | Ga0207693_10019679 | Ga0207693_100196794 | 566 |
| 266 | 3300026121 | Ga0207683_10142795 | Ga0207683_101427951 | 566 |
| 267 | 3300037853 | Ga0436364_0352896 | Ga0436364_0352896_10304_12085 | 566 |
| 268 | 3300039437 | Ga0436365_1466484 | Ga0436365_1466484_2322_4103 | 566 |
| 269 | 3300039453 | Ga0436362_1263978 | Ga0436362_1263978_2132_3913 | 566 |
| 270 | 3300009093 | Ga0105240_10002073 | Ga0105240_1000207325 | 567 |
| 271 | 3300005467 | Ga0070706_100059306 | Ga0070706_1000593062 | 568 |
| 272 | 3300005468 | Ga0070707_100107192 | Ga0070707_1001071922 | 568 |
| 273 | 3300005468 | Ga0070707_100121309 | Ga0070707_1001213091 | 568 |
| 274 | 3300005536 | Ga0070697_100005201 | Ga0070697_10000520110 | 568 |
| 275 | 3300006028 | Ga0070717_10029770 | Ga0070717_100297703 | 568 |
| 276 | 3300006175 | Ga0070712_100043992 | Ga0070712_1000439922 | 568 |
| 277 | 3300007076 | Ga0075435_100121102 | Ga0075435_1001211022 | 568 |
| 278 | 3300010159 | Ga0099796_10001310 | Ga0099796_100013102 | 568 |
| 279 | 3300013296 | Ga0157374_10182428 | Ga0157374_101824282 | 568 |
| 280 | 3300013297 | Ga0157378_10083137 | Ga0157378_100831372 | 568 |
| 281 | 3300025915 | Ga0207693_10048395 | Ga0207693_100483952 | 568 |
| 282 | 3300025922 | Ga0207646_10005442 | Ga0207646_1000544212 | 568 |
| 283 | 3300046472 | Ga0495580_0008403 | Ga0495580_0008403_6216_8045 | 568 |
| 284 | 3300046537 | Ga0495598_0009337 | Ga0495598_0009337_327_2084 | 568 |
| 285 | 3300046684 | Ga0495669_0009158 | Ga0495669_0009158_382_2139 | 568 |
| 286 | 3300006028 | Ga0070717_10033330 | Ga0070717_100333302 | 569 |
| 287 | 3300009147 | Ga0114129_10005859 | Ga0114129_100058596 | 569 |
| 288 | 3300050507 | nmdc:mga05p37_65507_c1 | nmdc:mga05p37_65507_c1_2184_4037 | 569 |
| 289 | 3300050515 | nmdc:mga0a205_34439_c1 | nmdc:mga0a205_34439_c1_799_2652 | 569 |
| 290 | 3300005329 | Ga0070683_100090305 | Ga0070683_1000903052 | 570 |
| 291 | 3300005436 | Ga0070713_100056722 | Ga0070713_1000567223 | 570 |
| 292 | 3300005445 | Ga0070708_100010647 | Ga0070708_1000106475 | 570 |
| 293 | 3300005458 | Ga0070681_10053755 | Ga0070681_100537552 | 570 |
| 294 | 3300005548 | Ga0070665_100002500 | Ga0070665_1000025005 | 570 |
| 295 | 3300005614 | Ga0068856_100107886 | Ga0068856_1001078862 | 570 |
| 296 | 3300006358 | Ga0068871_100148221 | Ga0068871_1001482211 | 570 |
| 297 | 3300013105 | Ga0157369_10133261 | Ga0157369_101332612 | 570 |
| 298 | 3300013297 | Ga0157378_10060656 | Ga0157378_100606564 | 570 |
| 299 | 3300013306 | Ga0163162_10134366 | Ga0163162_101343662 | 570 |
| 300 | 3300013307 | Ga0157372_10219318 | Ga0157372_102193181 | 570 |
| 301 | 3300014969 | Ga0157376_10010978 | Ga0157376_100109786 | 570 |
| 302 | 3300020078 | Ga0206352_10940153 | Ga0206352_109401531 | 570 |
| 303 | 3300021384 | Ga0213876_10020083 | Ga0213876_100200832 | 570 |
| 304 | 3300022467 | Ga0224712_10028393 | Ga0224712_100283931 | 570 |
| 305 | 3300028379 | Ga0268266_10037619 | Ga0268266_100376192 | 570 |
| 306 | 3300036401 | Ga0373937_0014408 | Ga0373937_0014408_3521_5278 | 570 |
| 307 | 3300046473 | Ga0495582_0011604 | Ga0495582_0011604_1633_3390 | 570 |
| 308 | 3300005563 | Ga0068855_100002522 | Ga0068855_10000252212 | 571 |
| 309 | 3300025913 | Ga0207695_10006973 | Ga0207695_100069735 | 571 |
| 310 | 3300025949 | Ga0207667_10009676 | Ga0207667_100096763 | 571 |
| 311 | 3300045049 | Ga0466959_0008481 | Ga0466959_0008481_5503_7260 | 571 |
| 312 | 3300048915 | Ga0496112_0021630 | Ga0496112_0021630_276_2042 | 571 |
| 313 | 3300005293 | Ga0065715_10090294 | Ga0065715_100902949 | 572 |
| 314 | 3300005331 | Ga0070670_100050504 | Ga0070670_1000505042 | 572 |
| 315 | 3300005364 | Ga0070673_100013569 | Ga0070673_1000135692 | 572 |
| 316 | 3300005436 | Ga0070713_100128751 | Ga0070713_1001287511 | 572 |
| 317 | 3300005543 | Ga0070672_100055257 | Ga0070672_1000552572 | 572 |
| 318 | 3300005548 | Ga0070665_100011357 | Ga0070665_1000113577 | 572 |
| 319 | 3300013308 | Ga0157375_10010011 | Ga0157375_100100112 | 572 |
| 320 | 3300025315 | Ga0207697_10031841 | Ga0207697_100318412 | 572 |
| 321 | 3300025925 | Ga0207650_10095056 | Ga0207650_100950561 | 572 |
| 322 | 3300025926 | Ga0207659_10017310 | Ga0207659_100173102 | 572 |
| 323 | 3300025928 | Ga0207700_10043049 | Ga0207700_100430492 | 572 |
| 324 | 3300025933 | Ga0207706_10026332 | Ga0207706_100263322 | 572 |
| 325 | 3300025960 | Ga0207651_10052972 | Ga0207651_100529722 | 572 |
| 326 | 3300028379 | Ga0268266_10053112 | Ga0268266_100531122 | 572 |
| 327 | 3300050507 | nmdc:mga05p37_194900_c1 | nmdc:mga05p37_194900_c1_175_1977 | 572 |
| 328 | 3300050515 | nmdc:mga0a205_170663_c1 | nmdc:mga0a205_170663_c1_35_1837 | 572 |
| 329 | 3300005467 | Ga0070706_100000210 | Ga0070706_1000002103 | 573 |
| 330 | 3300025910 | Ga0207684_10000028 | Ga0207684_1000002878 | 573 |
| 331 | 3300037418 | Ga0395900_0046260 | Ga0395900_0046260_217_2070 | 574 |
| 332 | 3300037466 | Ga0395898_0069348 | Ga0395898_0069348_1382_3235 | 574 |
| 333 | 3300005458 | Ga0070681_10000508 | Ga0070681_1000050827 | 580 |
| 334 | 3300005518 | Ga0070699_100047532 | Ga0070699_1000475321 | 580 |
| 335 | 3300005545 | Ga0070695_100002610 | Ga0070695_1000026103 | 580 |
| 336 | 3300006028 | Ga0070717_10008639 | Ga0070717_100086393 | 580 |
| 337 | 3300007076 | Ga0075435_100039700 | Ga0075435_1000397002 | 580 |
| 338 | 3300025898 | Ga0207692_10029157 | Ga0207692_100291571 | 580 |
| 339 | 3300025906 | Ga0207699_10027104 | Ga0207699_100271043 | 580 |
| 340 | 3300025912 | Ga0207707_10000973 | Ga0207707_100009736 | 580 |
| 341 | 3300025928 | Ga0207700_10130492 | Ga0207700_101304921 | 580 |
| 342 | 3300050513 | nmdc:mga0rr50_15681_c1 | nmdc:mga0rr50_15681_c1_754_2550 | 580 |
| 343 | 3300003323 | rootH1_10015747 | rootH1_100157478 | 586 |
| 344 | 3300005367 | Ga0070667_100057190 | Ga0070667_1000571903 | 586 |
| 345 | 3300005548 | Ga0070665_100005755 | Ga0070665_1000057555 | 586 |
| 346 | 3300005614 | Ga0068856_100025155 | Ga0068856_1000251552 | 586 |
| 347 | 3300005617 | Ga0068859_100010970 | Ga0068859_1000109702 | 586 |
| 348 | 3300005842 | Ga0068858_100022963 | Ga0068858_1000229632 | 586 |
| 349 | 3300005843 | Ga0068860_100000566 | Ga0068860_10000056627 | 586 |
| 350 | 3300005844 | Ga0068862_100071086 | Ga0068862_1000710863 | 586 |
| 351 | 3300006931 | Ga0097620_100010970 | Ga0097620_1000109705 | 586 |
| 352 | 3300009093 | Ga0105240_10015909 | Ga0105240_100159099 | 586 |
| 353 | 3300009545 | Ga0105237_10094783 | Ga0105237_100947831 | 586 |
| 354 | 3300009551 | Ga0105238_10046293 | Ga0105238_100462934 | 586 |
| 355 | 3300009551 | Ga0105238_10102061 | Ga0105238_101020612 | 586 |
| 356 | 3300013306 | Ga0163162_10212037 | Ga0163162_102120371 | 586 |
| 357 | 3300025903 | Ga0207680_10009348 | Ga0207680_100093482 | 586 |
| 358 | 3300025913 | Ga0207695_10017905 | Ga0207695_100179059 | 586 |
| 359 | 3300025914 | Ga0207671_10042615 | Ga0207671_100426153 | 586 |
| 360 | 3300025925 | Ga0207650_10050085 | Ga0207650_100500853 | 586 |
| 361 | 3300025931 | Ga0207644_10029993 | Ga0207644_100299931 | 586 |
| 362 | 3300026035 | Ga0207703_10001123 | Ga0207703_1000112311 | 586 |
| 363 | 3300026088 | Ga0207641_10000197 | Ga0207641_1000019742 | 586 |
| 364 | 3300028379 | Ga0268266_10002158 | Ga0268266_100021589 | 586 |
| 365 | 3300028381 | Ga0268264_10000025 | Ga0268264_10000025216 | 586 |
| 366 | 3300033180 | Ga0307510_10000012 | Ga0307510_10000012213 | 586 |
| 367 | 3300033180 | Ga0307510_10010978 | Ga0307510_100109782 | 586 |
| 368 | 3300045049 | Ga0466959_0032101 | Ga0466959_0032101_1326_3137 | 586 |
| 369 | 3300045836 | Ga0466958_0047751 | Ga0466958_0047751_677_2488 | 586 |
| 370 | 3300048920 | Ga0496117_0000110 | Ga0496117_0000110_90742_92505 | 586 |
| 371 | 3300048921 | Ga0496118_0000014 | Ga0496118_0000014_511217_512980 | 586 |
| 372 | 3300048922 | Ga0496119_0000203 | Ga0496119_0000203_49034_50827 | 586 |
| 373 | 3300048922 | Ga0496119_0010792 | Ga0496119_0010792_2198_3961 | 586 |
| 374 | 3300048923 | Ga0496120_0000018 | Ga0496120_0000018_155384_157177 | 586 |
| 375 | 3300048924 | Ga0496121_0021747 | Ga0496121_0021747_3070_4833 | 586 |
| 376 | 3300048928 | Ga0496125_0000362 | Ga0496125_0000362_5690_7450 | 586 |
| 377 | 3300048928 | Ga0496125_0015867 | Ga0496125_0015867_5037_6800 | 586 |
| 378 | 3300048929 | Ga0496126_0013935 | Ga0496126_0013935_3296_5059 | 586 |
| 379 | 3300048929 | Ga0496126_0063432 | Ga0496126_0063432_447_2207 | 586 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ac3-assembly1.cif.gz_A | crystal structure of pam12a | 0.9466 | 31 | 554 |
| 1m21-assembly2.cif.gz_B | crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin | 0.9453 | 32 | 554 |
| 1m21-assembly2.cif.gz_B | crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin | 0.9377 | 32 | 554 |
| 5ac3-assembly1.cif.gz_A | crystal structure of pam12a | 0.9353 | 31 | 554 |
| 1m22-assembly2.cif.gz_B | x-ray structure of native peptide amidase from stenotrophomonas maltophilia at 1.4 a | 0.9241 | 31 | 556 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1m22A00 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.9241 | 31 | 556 | 3.90.1300.10 |
| 1m22A00 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.9167 | 31 | 556 | 3.90.1300.10 |
| 5ewqB00 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.9146 | 34 | 555 | 3.90.1300.10 |
| af_A0A0P0WV09_96_533_3.90.1300.10 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.9016 | 101 | 555 | 3.90.1300.10 |
| af_A0A1P8B760_22_510_3.90.1300.10 | Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain | 0.8901 | 20 | 549 | 3.90.1300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3U0X7-F1-model_v4 | Amidase (EC 3.5.1.4) | 0.9745 | 103 | 258 |
GO:0004040
|
| AF-A0A836VI75-F1-model_v4 | Amidase (EC 3.5.1.4) | 0.9667 | 47 | 202 |
GO:0016787
|
| AF-A0A2P7PDQ9-F1-model_v4 | deleted | 0.963 | 81 | 206 |
|
| AF-A0A7K0JYU9-F1-model_v4 | deleted | 0.9577 | 45 | 289 |
|
| AF-A0A3B0TLU1-F1-model_v4 | Aspartyl-tRNA(Asn) amidotransferase subunit A @ Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.6, EC 6.3.5.7) | 0.9552 | 37 | 271 |
GO:0016740
GO:0050566 GO:0050567 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar