F428287

General Info

Members Datasets Scaffolds Average Seq Length
379 185 376 295

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100146652|Ga0070698_1001466522
Length 343
Sequence LCHSLVQPYLYSALTKFKRAFRHPDNYREVGGPKIKSAPGNHRGFNLKIMSLRQSLYGTGVALVTPFKSNGEVDLDALSKIIDFVINGGTEYIVTLGTTGETPALGKEEKIAIIRYTYEKVNNRVPVVVGIGGNSTPEVVKELETFPLDKATAILSASPYYNKPSQEGIFQHYKALAAASPKPILLYNVPGRTGRNMTAATTLRLANEVPNIGGIKEASGDMAQCMQILRDRPENFLVVSGDDALVLPQIACGMEGVISVAANAFPQQFTHMVRQCLKGDFKAAKSLNDVLIEAYDLMFAENNPAGVKAFMTELELLQNYLRLPMVPLSEGLYAQVQTFLKGK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
141 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
145 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
168 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
177 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
178 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
179 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
180 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
181 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
182 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
185 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.54
Nodule 0
Rhizoplane 0.53
Rhizosphere 85.49
Stem 0
Stem Tuber 0
Unclassified 8.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_5483801 2162886011 Bacteria 1145
2 JGI24740J21852_10009956 3300001979 Bacteria 3687
3 JGI25406J46586_10018717 3300003203 Bacteria 2841
4 rootH1_10030077 3300003316 Bacteria 2281
5 rootH1_10066443 3300003316 Bacteria 1322
6 rootH2_10009673 3300003320 Bacteria 54328
7 rootH2_10011544 3300003320 Bacteria 15987
8 rootH2_10163639 3300003320 Unclassified 1875
9 rootH2_10292035 3300003320 Bacteria 1394
10 rootH1_10006250 3300003323 Bacteria 22415
11 rootH1_10026687 3300003323 Bacteria 11109
12 rootH1_10083389 3300003323 Bacteria 1590
13 rootH1_10116719 3300003323 Bacteria 3726
14 rootH1_10152618 3300003323 Bacteria 3010
15 rootH1_10171050 3300003323 Bacteria 3319
16 JGI25160J50197_1019690 3300003354 Unclassified 2061
17 Ga0065712_10096572 3300005290 Bacteria 2171
18 Ga0070683_100006190 3300005329 Bacteria 10039
19 Ga0070683_100011657 3300005329 Bacteria 7611
20 Ga0070690_100083926 3300005330 Bacteria 2087
21 Ga0070670_100045712 3300005331 Bacteria 3765
22 Ga0070670_100099800 3300005331 Bacteria 2498
23 Ga0070677_10147202 3300005333 Bacteria 1092
24 Ga0068869_100003911 3300005334 Bacteria 9192
25 Ga0070666_10000051 3300005335 Bacteria 99740
26 Ga0070666_10010924 3300005335 Bacteria 5689
27 Ga0070666_10072706 3300005335 Bacteria 2342
28 Ga0070682_100002757 3300005337 Bacteria 9727
29 Ga0068868_100010578 3300005338 Bacteria 6687
30 Ga0068868_100248679 3300005338 Bacteria 1496
31 Ga0070660_100010871 3300005339 Bacteria 6442
32 Ga0070689_100205372 3300005340 Bacteria 1610
33 Ga0070661_100060093 3300005344 Bacteria 2789
34 Ga0070661_100255985 3300005344 Bacteria 1352
35 Ga0070675_100009535 3300005354 Bacteria 7552
36 Ga0070675_100039045 3300005354 Bacteria 3872
37 Ga0070675_100574627 3300005354 Bacteria 1021
38 Ga0070671_100006498 3300005355 Bacteria 9347
39 Ga0070671_100127187 3300005355 Bacteria 2146
40 Ga0070671_100157795 3300005355 Bacteria 1917
41 Ga0070674_100194533 3300005356 Bacteria 1562
42 Ga0070673_100040924 3300005364 Bacteria 3559
43 Ga0070673_100175404 3300005364 Bacteria 1832
44 Ga0070659_100004288 3300005366 Bacteria 10182
45 Ga0070667_100048411 3300005367 Unclassified 3578
46 Ga0070667_100348583 3300005367 Bacteria 1340
47 Ga0070663_100235182 3300005455 Bacteria 1444
48 Ga0070678_100037742 3300005456 Bacteria 3395
49 Ga0070678_100040099 3300005456 Bacteria 3311
50 Ga0070678_100216475 3300005456 Unclassified 1590
51 Ga0070678_100265187 3300005456 Bacteria 1446
52 Ga0070681_10029175 3300005458 Bacteria 5539
53 Ga0070681_10071962 3300005458 Bacteria 3422
54 Ga0068867_100007399 3300005459 Bacteria 7768
55 Ga0068867_100041921 3300005459 Bacteria 3345
56 Ga0070685_10238681 3300005466 Bacteria 1199
57 Ga0070698_100146652 3300005471 Bacteria 2309
58 Ga0070679_100099285 3300005530 Bacteria 2898
59 Ga0070684_100009306 3300005535 Bacteria 7734
60 Ga0070684_100044075 3300005535 Bacteria 3856
61 Ga0070684_100070750 3300005535 Bacteria 3071
62 Ga0070684_100130335 3300005535 Bacteria 2268
63 Ga0068853_100000862 3300005539 Bacteria 21166
64 Ga0068853_100020972 3300005539 Bacteria 5439
65 Ga0068853_100174155 3300005539 Bacteria 1948
66 Ga0068853_100274539 3300005539 Bacteria 1553
67 Ga0068853_100318855 3300005539 Bacteria 1440
68 Ga0070672_100048784 3300005543 Unclassified 3292
69 Ga0070672_100231851 3300005543 Bacteria 1551
70 Ga0070672_100242297 3300005543 Bacteria 1517
71 Ga0070665_100000001 3300005548 Bacteria 1083363
72 Ga0068855_100001333 3300005563 Bacteria 30579
73 Ga0068855_100033416 3300005563 Bacteria 6138
74 Ga0068855_100056686 3300005563 Bacteria 4596
75 Ga0068855_100120093 3300005563 Bacteria 3008
76 Ga0070664_100003626 3300005564 Bacteria 12441
77 Ga0070664_100039014 3300005564 Bacteria 4000
78 Ga0070664_100228687 3300005564 Bacteria 1667
79 Ga0068857_100052292 3300005577 Bacteria 3625
80 Ga0068857_100122568 3300005577 Bacteria 2342
81 Ga0068854_100061809 3300005578 Bacteria 2714
82 Ga0068854_100102957 3300005578 Bacteria 2143
83 Ga0068856_100026002 3300005614 Bacteria 5708
84 Ga0068856_100044663 3300005614 Bacteria 4362
85 Ga0068856_100089724 3300005614 Bacteria 3057
86 Ga0068852_100093867 3300005616 Bacteria 2690
87 Ga0068852_100102353 3300005616 Bacteria 2588
88 Ga0068852_100105428 3300005616 Bacteria 2554
89 Ga0068852_100181146 3300005616 Bacteria 1981
90 Ga0068852_100221885 3300005616 Bacteria 1798
91 Ga0068852_100505316 3300005616 Bacteria 1204
92 Ga0068859_100000023 3300005617 Bacteria 221914
93 Ga0068859_100001090 3300005617 Bacteria 27692
94 Ga0068864_100105170 3300005618 Bacteria 2508
95 Ga0068864_100109347 3300005618 Bacteria 2461
96 Ga0068864_100221370 3300005618 Bacteria 1746
97 Ga0068864_100269909 3300005618 Bacteria 1585
98 Ga0068851_10039662 3300005834 Unclassified 2365
99 Ga0068851_10148657 3300005834 Bacteria 1279
100 Ga0068851_10204813 3300005834 Bacteria 1103
101 Ga0068870_10094113 3300005840 Bacteria 1681
102 Ga0068863_100008810 3300005841 Bacteria 9851
103 Ga0068863_100350862 3300005841 Bacteria 1437
104 Ga0068858_100039977 3300005842 Unclassified 4349
105 Ga0068860_100000097 3300005843 Bacteria 146573
106 Ga0068860_100017799 3300005843 Bacteria 6923
107 Ga0068860_100151644 3300005843 Bacteria 2232
108 Ga0081539_10000893 3300005985 Bacteria 57031
109 Ga0075366_10047260 3300006195 Bacteria 2551
110 Ga0097621_100000224 3300006237 Bacteria 37801
111 Ga0097621_100010422 3300006237 Bacteria 6804
112 Ga0097621_100015371 3300006237 Bacteria 5757
113 Ga0097621_100098814 3300006237 Bacteria 2452
114 Ga0097621_100365608 3300006237 Bacteria 1286
115 Ga0075370_10067601 3300006353 Bacteria 2040
116 Ga0068871_100000949 3300006358 Bacteria 19369
117 Ga0068871_100027174 3300006358 Bacteria 4472
118 Ga0068871_100034685 3300006358 Bacteria 4005
119 Ga0068871_100268662 3300006358 Bacteria 1489
120 Ga0068865_100105007 3300006881 Bacteria 2075
121 Ga0097620_100000023 3300006931 Bacteria 221914
122 Ga0097620_100001090 3300006931 Bacteria 27692
123 Ga0105240_10000208 3300009093 Bacteria 118950
124 Ga0105240_10001904 3300009093 Bacteria 34640
125 Ga0105240_10003887 3300009093 Bacteria 23076
126 Ga0105240_10063236 3300009093 Bacteria 4604
127 Ga0105240_10068793 3300009093 Bacteria 4385
128 Ga0105240_10142997 3300009093 Bacteria 2858
129 Ga0111539_10538006 3300009094 Bacteria 1361
130 Ga0105245_10179425 3300009098 Bacteria 2022
131 Ga0114129_10014118 3300009147 Bacteria 11377
132 Ga0105241_10000149 3300009174 Bacteria 50078
133 Ga0105242_10270983 3300009176 Bacteria 1538
134 Ga0105237_10001017 3300009545 Bacteria 37740
135 Ga0105237_10002490 3300009545 Bacteria 22826
136 Ga0105237_10003181 3300009545 Bacteria 19693
137 Ga0105237_10013107 3300009545 Bacteria 8702
138 Ga0105237_10062999 3300009545 Unclassified 3706
139 Ga0105237_10226240 3300009545 Bacteria 1871
140 Ga0105237_10235665 3300009545 Bacteria 1831
141 Ga0105238_10086837 3300009551 Bacteria 3115
142 Ga0105238_10119098 3300009551 Bacteria 2620
143 Ga0105249_10040349 3300009553 Bacteria 4240
144 Ga0105239_10000436 3300010375 Bacteria 61031
145 Ga0105239_10024007 3300010375 Bacteria 6716
146 Ga0105239_10038167 3300010375 Bacteria 5264
147 Ga0105239_10046834 3300010375 Bacteria 4738
148 Ga0105239_10091008 3300010375 Bacteria 3366
149 Ga0105239_10128102 3300010375 Bacteria 2822
150 Ga0105239_10425250 3300010375 Unclassified 1505
151 Ga0157373_10001117 3300013100 Bacteria 20595
152 Ga0157373_10224607 3300013100 Bacteria 1325
153 Ga0157371_10023195 3300013102 Bacteria 4537
154 Ga0157370_10007050 3300013104 Bacteria 12268
155 Ga0157370_10127449 3300013104 Bacteria 2376
156 Ga0157369_10003748 3300013105 Bacteria 18059
157 Ga0157369_10082189 3300013105 Bacteria 3447
158 Ga0157369_10100633 3300013105 Bacteria 3081
159 Ga0157369_10253160 3300013105 Bacteria 1838
160 Ga0157374_10000001 3300013296 Bacteria 1077351
161 Ga0157374_10010111 3300013296 Bacteria 8103
162 Ga0157374_10131393 3300013296 Bacteria 2423
163 Ga0157374_10149783 3300013296 Bacteria 2268
164 Ga0157374_10190308 3300013296 Bacteria 2007
165 Ga0157378_10011188 3300013297 Bacteria 7850
166 Ga0157378_10014671 3300013297 Bacteria 6862
167 Ga0157378_10018627 3300013297 Bacteria 6104
168 Ga0157378_10037967 3300013297 Bacteria 4268
169 Ga0157378_10067327 3300013297 Bacteria 3209
170 Ga0157378_10668195 3300013297 Unclassified 1056
171 Ga0163162_10000161 3300013306 Bacteria 62198
172 Ga0163162_10002183 3300013306 Bacteria 18347
173 Ga0163162_10006168 3300013306 Bacteria 11613
174 Ga0163162_10013253 3300013306 Bacteria 8052
175 Ga0163162_10014326 3300013306 Bacteria 7747
176 Ga0163162_10323479 3300013306 Bacteria 1675
177 Ga0163162_10325041 3300013306 Bacteria 1671
178 Ga0157372_10000595 3300013307 Bacteria 39419
179 Ga0157372_10075797 3300013307 Bacteria 3796
180 Ga0157372_10215184 3300013307 Bacteria 2227
181 Ga0157372_10223345 3300013307 Bacteria 2183
182 Ga0157372_10326599 3300013307 Bacteria 1786
183 Ga0157372_10351316 3300013307 Unclassified 1718
184 Ga0157372_10438954 3300013307 Bacteria 1522
185 Ga0157375_10008904 3300013308 Bacteria 8784
186 Ga0157375_10028423 3300013308 Bacteria 5241
187 Ga0157375_10068335 3300013308 Bacteria 3555
188 Ga0157375_10196750 3300013308 Unclassified 2171
189 Ga0163163_10004599 3300014325 Bacteria 11782
190 Ga0163163_10062217 3300014325 Unclassified 3698
191 Ga0157380_10013873 3300014326 Bacteria 5885
192 Ga0157377_10147494 3300014745 Bacteria 1452
193 Ga0157379_10089706 3300014968 Bacteria 2758
194 Ga0157379_10264758 3300014968 Bacteria 1563
195 Ga0157376_10004691 3300014969 Bacteria 9526
196 Ga0157376_10027137 3300014969 Bacteria 4535
197 Ga0157376_10029184 3300014969 Bacteria 4392
198 Ga0163161_10003964 3300017792 Bacteria 10379
199 Ga0163161_10312134 3300017792 Unclassified 1241
200 Ga0213876_10030088 3300021384 Bacteria 2862
201 Ga0207426_1000189 3300025302 Bacteria 153457
202 Ga0207656_10020256 3300025321 Bacteria 2642
203 Ga0207656_10024010 3300025321 Unclassified 2461
204 Ga0207680_10000053 3300025903 Bacteria 55149
205 Ga0207680_10014833 3300025903 Bacteria 4048
206 Ga0207680_10054944 3300025903 Bacteria 2398
207 Ga0207647_10004651 3300025904 Bacteria 10169
208 Ga0207647_10104362 3300025904 Bacteria 1680
209 Ga0207647_10190283 3300025904 Bacteria 1189
210 Ga0207705_10171707 3300025909 Bacteria 1633
211 Ga0207707_10022898 3300025912 Bacteria 5464
212 Ga0207695_10000076 3300025913 Bacteria 307969
213 Ga0207695_10000084 3300025913 Bacteria 282392
214 Ga0207695_10000090 3300025913 Bacteria 272143
215 Ga0207695_10000257 3300025913 Bacteria 134853
216 Ga0207695_10002714 3300025913 Bacteria 25834
217 Ga0207695_10007357 3300025913 Bacteria 14048
218 Ga0207671_10001353 3300025914 Bacteria 28612
219 Ga0207671_10003092 3300025914 Bacteria 16963
220 Ga0207671_10020465 3300025914 Bacteria 5035
221 Ga0207671_10032225 3300025914 Bacteria 3902
222 Ga0207671_10033064 3300025914 Bacteria 3849
223 Ga0207671_10040735 3300025914 Bacteria 3437
224 Ga0207671_10101819 3300025914 Bacteria 2177
225 Ga0207660_10108983 3300025917 Bacteria 2081
226 Ga0207657_10001494 3300025919 Bacteria 25019
227 Ga0207649_10071041 3300025920 Bacteria 2222
228 Ga0207649_10362236 3300025920 Bacteria 1076
229 Ga0207681_10226249 3300025923 Bacteria 1450
230 Ga0207650_10047355 3300025925 Unclassified 3168
231 Ga0207650_10132137 3300025925 Bacteria 1954
232 Ga0207659_10121334 3300025926 Bacteria 2003
233 Ga0207644_10043341 3300025931 Bacteria 3193
234 Ga0207644_10056915 3300025931 Bacteria 2822
235 Ga0207644_10076675 3300025931 Bacteria 2460
236 Ga0207644_10282168 3300025931 Bacteria 1334
237 Ga0207706_10006153 3300025933 Bacteria 11146
238 Ga0207670_10144436 3300025936 Bacteria 1758
239 Ga0207669_10151040 3300025937 Bacteria 1627
240 Ga0207704_10058062 3300025938 Bacteria 2381
241 Ga0207691_10068545 3300025940 Unclassified 3205
242 Ga0207691_10231772 3300025940 Bacteria 1599
243 Ga0207691_10388811 3300025940 Bacteria 1190
244 Ga0207689_10003009 3300025942 Bacteria 15544
245 Ga0207661_10016699 3300025944 Bacteria 5418
246 Ga0207661_10054907 3300025944 Bacteria 3192
247 Ga0207679_10013083 3300025945 Bacteria 5432
248 Ga0207679_10135816 3300025945 Bacteria 1980
249 Ga0207667_10000911 3300025949 Bacteria 37650
250 Ga0207667_10029268 3300025949 Bacteria 5974
251 Ga0207667_10035976 3300025949 Bacteria 5310
252 Ga0207667_10209367 3300025949 Unclassified 1999
253 Ga0207651_10021947 3300025960 Bacteria 3892
254 Ga0207651_10164037 3300025960 Bacteria 1745
255 Ga0207651_10164154 3300025960 Bacteria 1745
256 Ga0207651_10488085 3300025960 Bacteria 1063
257 Ga0207668_10269968 3300025972 Bacteria 1390
258 Ga0207640_10035618 3300025981 Bacteria 3116
259 Ga0207658_10047033 3300025986 Bacteria 3155
260 Ga0207658_10434181 3300025986 Bacteria 1160
261 Ga0207677_10027793 3300026023 Bacteria 3569
262 Ga0207639_10006147 3300026041 Bacteria 8151
263 Ga0207639_10015187 3300026041 Bacteria 5427
264 Ga0207639_10027360 3300026041 Bacteria 4155
265 Ga0207639_10063766 3300026041 Unclassified 2855
266 Ga0207702_10079696 3300026078 Bacteria 2839
267 Ga0207702_10106670 3300026078 Bacteria 2483
268 Ga0207702_10234350 3300026078 Unclassified 1717
269 Ga0207641_10000202 3300026088 Bacteria 79668
270 Ga0207641_10007365 3300026088 Bacteria 9163
271 Ga0207641_10517825 3300026088 Bacteria 1160
272 Ga0207648_10077258 3300026089 Bacteria 2902
273 Ga0207648_10324983 3300026089 Bacteria 1383
274 Ga0207676_10367233 3300026095 Bacteria 1336
275 Ga0207674_10044961 3300026116 Bacteria 4546
276 Ga0207674_10081181 3300026116 Bacteria 3244
277 Ga0207683_10022620 3300026121 Bacteria 5398
278 Ga0207683_10311581 3300026121 Bacteria 1441
279 Ga0207683_10542958 3300026121 Bacteria 1074
280 Ga0207683_10551893 3300026121 Unclassified 1065
281 Ga0207698_10037620 3300026142 Bacteria 3566
282 Ga0207698_10312775 3300026142 Unclassified 1467
283 Ga0207698_10375427 3300026142 Bacteria 1351
284 Ga0268266_10000038 3300028379 Bacteria 325729
285 Ga0268264_10000525 3300028381 Bacteria 48553
286 Ga0268264_10006805 3300028381 Bacteria 9603
287 Ga0307517_10039167 3300028786 Bacteria 5217
288 Ga0307517_10198040 3300028786 Unclassified 1261
289 Ga0307515_10000002 3300028794 Bacteria 1231751
290 Ga0307515_10000076 3300028794 Bacteria 228736
291 Ga0307511_10001429 3300030521 Bacteria 25196
292 Ga0265327_10000245 3300031251 Bacteria 108670
293 Ga0265327_10068468 3300031251 Bacteria 1785
294 Ga0307513_10093409 3300031456 Bacteria 3058
295 Ga0307509_10058624 3300031507 Bacteria 4076
296 Ga0307509_10084770 3300031507 Bacteria 3263
297 Ga0307509_10184280 3300031507 Bacteria 1948
298 Ga0307509_10189587 3300031507 Bacteria 1909
299 Ga0307508_10002012 3300031616 Bacteria 22143
300 Ga0307508_10108242 3300031616 Bacteria 2379
301 Ga0307516_10003848 3300031730 Bacteria 18983
302 Ga0307414_10007878 3300032004 Bacteria 6010
303 Ga0307510_10071891 3300033180 Bacteria 3440
304 Ga0307510_10264132 3300033180 Bacteria 1201
305 Ga0373931_0191827 3300035691 Unclassified 1216
306 Ga0373935_0123084 3300035692 Bacteria 1735
307 Ga0373927_0099965 3300035695 Bacteria 1886
308 Ga0373925_0216048 3300037068 Bacteria 1529
309 Ga0436365_0142833 3300039437 Unclassified 2324
310 Ga0436365_1081651 3300039437 Bacteria 12424
311 Ga0439436_0041398 3300041404 Bacteria 1318
312 Ga0439439_0014095 3300041406 Bacteria 1943
313 Ga0451802_0124700 3300041460 Bacteria 1431
314 Ga0439449_0003119 3300042007 Bacteria 6454
315 Ga0439457_000062 3300042014 Bacteria 23176
316 Ga0439462_0002057 3300042015 Bacteria 4617
317 Ga0466969_0000772 3300044656 Bacteria 17435
318 Ga0466969_0042179 3300044656 Bacteria 2280
319 Ga0466972_0000055 3300044658 Bacteria 111338
320 Ga0466972_0000897 3300044658 Bacteria 14302
321 Ga0466972_0012675 3300044658 Bacteria 4235
322 Ga0466965_0110691 3300044683 Bacteria 1411
323 Ga0466966_0000080 3300044684 Bacteria 60746
324 Ga0466970_0024270 3300044765 Bacteria 3170
325 Ga0466970_0094103 3300044765 Unclassified 1628
326 Ga0466957_0002949 3300044842 Bacteria 9223
327 Ga0466957_0012231 3300044842 Bacteria 4968
328 Ga0466957_0184453 3300044842 Unclassified 1364
329 Ga0466959_0000009 3300045049 Bacteria 176964
330 Ga0466959_0051659 3300045049 Bacteria 3014
331 Ga0466958_0075077 3300045836 Bacteria 2073
332 Ga0495638_0000003 3300046460 Bacteria 888792
333 Ga0495638_0021426 3300046460 Bacteria 4260
334 Ga0495638_0041874 3300046460 Bacteria 2895
335 Ga0495638_0124145 3300046460 Bacteria 1523
336 Ga0495606_0004940 3300046507 Bacteria 13040
337 Ga0495648_0011249 3300046524 Bacteria 6756
338 Ga0495622_0096363 3300046557 Bacteria 1358
339 Ga0495668_0000521 3300046616 Bacteria 47898
340 Ga0495668_0010666 3300046616 Bacteria 5553
341 Ga0495611_0000828 3300046648 Bacteria 17074
342 Ga0495611_0011673 3300046648 Bacteria 3727
343 Ga0495687_000001 3300047443 Bacteria 1215582
344 Ga0495686_0000004 3300047472 Bacteria 869019
345 Ga0496101_0270199 3300048904 Bacteria 1327
346 Ga0501037_0056250 3300049573 Bacteria 2874
347 Ga0501043_0157196 3300049579 Bacteria 1778
348 Ga0501047_0030619 3300049581 Bacteria 5187
349 Ga0501047_0180841 3300049581 Bacteria 1975
350 Ga0501048_0083566 3300049582 Bacteria 2252
351 Ga0501219_000291 3300049703 Bacteria 8885
352 Ga0501225_0024879 3300049705 Bacteria 1648
353 Ga0501035_0135363 3300049822 Bacteria 2146
354 Ga0501044_0070002 3300049823 Bacteria 3570
355 Ga0501284_00098 3300050005 Bacteria 18256
356 nmdc:mga0k408_40713_c1 3300050493 Bacteria 2674
357 nmdc:mga05p37_13803_c1 3300050507 Bacteria 9679
358 nmdc:mga05p37_72139_c1 3300050507 Bacteria 4248
359 nmdc:mga06r32_60578_c1 3300050510 Bacteria 3643
360 nmdc:mga08y16_50116_c1 3300050511 Bacteria 4369
361 Ga0500578_0000218 3300053086 Bacteria 71049
362 Ga0500578_0083274 3300053086 Bacteria 2033
363 Ga0500646_0013116 3300053090 Bacteria 2145
364 Ga0500646_0019375 3300053090 Bacteria 1800
365 Ga0500583_0000325 3300053092 Bacteria 16030
366 Ga0500583_0001274 3300053092 Bacteria 7200
367 Ga0500557_001627 3300053105 Bacteria 3771
368 Ga0500577_0077296 3300053142 Bacteria 1320
369 Ga0500588_0008063 3300053146 Bacteria 2447
370 Ga0500603_008993 3300053150 Bacteria 2230
371 Ga0500616_0000007 3300053153 Bacteria 836875
372 Ga0500616_0022897 3300053153 Bacteria 3486
373 Ga0500622_0001882 3300053156 Bacteria 15851
374 Ga0500622_0013853 3300053156 Bacteria 4343
375 Ga0500622_0049659 3300053156 Bacteria 2163
376 Ga0500627_0003294 3300053158 Bacteria 4975

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005834 Ga0068851_10039662 Ga0068851_100396623 275
2 3300006195 Ga0075366_10047260 Ga0075366_100472602 281
3 3300006353 Ga0075370_10067601 Ga0075370_100676012 281
4 3300025914 Ga0207671_10001353 Ga0207671_1000135323 281
5 3300031456 Ga0307513_10093409 Ga0307513_100934092 281
6 3300031507 Ga0307509_10058624 Ga0307509_100586242 281
7 3300031507 Ga0307509_10189587 Ga0307509_101895871 281
8 3300031616 Ga0307508_10108242 Ga0307508_101082422 281
9 3300013307 Ga0157372_10000595 Ga0157372_1000059532 282
10 3300025903 Ga0207680_10054944 Ga0207680_100549441 282
11 3300025914 Ga0207671_10040735 Ga0207671_100407352 282
12 3300025949 Ga0207667_10209367 Ga0207667_102093671 282
13 3300044683 Ga0466965_0110691 Ga0466965_0110691_407_1258 283
14 3300005355 Ga0070671_100006498 Ga0070671_1000064987 284
15 3300005367 Ga0070667_100048411 Ga0070667_1000484111 284
16 3300005456 Ga0070678_100037742 Ga0070678_1000377422 284
17 3300006237 Ga0097621_100000224 Ga0097621_1000002248 284
18 3300006358 Ga0068871_100000949 Ga0068871_1000009497 284
19 3300013297 Ga0157378_10011188 Ga0157378_100111883 284
20 3300013308 Ga0157375_10028423 Ga0157375_100284235 284
21 3300014968 Ga0157379_10089706 Ga0157379_100897062 284
22 3300014969 Ga0157376_10029184 Ga0157376_100291843 284
23 3300017792 Ga0163161_10003964 Ga0163161_100039647 284
24 3300025931 Ga0207644_10056915 Ga0207644_100569152 284
25 3300025986 Ga0207658_10047033 Ga0207658_100470334 284
26 3300048904 Ga0496101_0270199 Ga0496101_0270199_56_937 284
27 3300003323 rootH1_10026687 rootH1_100266876 285
28 3300053158 Ga0500627_0003294 Ga0500627_0003294_2967_3824 285
29 iso_pu_bacteria 2881955468 2881956693 285
30 3300035691 Ga0373931_0191827 Ga0373931_0191827_22_891 289
31 3300035692 Ga0373935_0123084 Ga0373935_0123084_281_1150 289
32 iso_pu_bacteria 2738541278 2738731110 290
33 iso_pu_bacteria 2818991444 2819586844 290
34 3300003323 rootH1_10083389 rootH1_100833891 291
35 3300005617 Ga0068859_100001090 Ga0068859_1000010907 291
36 3300006931 Ga0097620_100001090 Ga0097620_1000010907 291
37 3300031251 Ga0265327_10000245 Ga0265327_1000024510 291
38 3300046460 Ga0495638_0000003 Ga0495638_0000003_251020_251895 291
39 3300046557 Ga0495622_0096363 Ga0495622_0096363_80_958 291
40 3300053090 Ga0500646_0013116 Ga0500646_0013116_565_1443 291
41 3300053105 Ga0500557_001627 Ga0500557_001627_1167_2042 291
42 3300053153 Ga0500616_0000007 Ga0500616_0000007_534390_535265 291
43 3300053156 Ga0500622_0049659 Ga0500622_0049659_821_1696 291
44 3300005331 Ga0070670_100045712 Ga0070670_1000457122 292
45 3300005456 Ga0070678_100040099 Ga0070678_1000400992 292
46 3300005466 Ga0070685_10238681 Ga0070685_102386811 292
47 3300005539 Ga0068853_100020972 Ga0068853_1000209724 292
48 3300025923 Ga0207681_10226249 Ga0207681_102262491 292
49 3300025940 Ga0207691_10388811 Ga0207691_103888111 292
50 3300025960 Ga0207651_10164154 Ga0207651_101641542 292
51 3300026041 Ga0207639_10015187 Ga0207639_100151874 292
52 3300026095 Ga0207676_10367233 Ga0207676_103672332 292
53 3300026121 Ga0207683_10022620 Ga0207683_100226203 292
54 3300028794 Ga0307515_10000002 Ga0307515_10000002207 292
55 3300032004 Ga0307414_10007878 Ga0307414_100078786 292
56 3300039437 Ga0436365_0142833 Ga0436365_0142833_498_1376 292
57 3300003320 rootH2_10009673 rootH2_1000967354 293
58 3300003320 rootH2_10011544 rootH2_100115447 293
59 3300005334 Ga0068869_100003911 Ga0068869_1000039116 293
60 3300005335 Ga0070666_10000051 Ga0070666_1000005177 293
61 3300005340 Ga0070689_100205372 Ga0070689_1002053721 293
62 3300005355 Ga0070671_100127187 Ga0070671_1001271871 293
63 3300005455 Ga0070663_100235182 Ga0070663_1002351821 293
64 3300005459 Ga0068867_100041921 Ga0068867_1000419215 293
65 3300005535 Ga0070684_100130335 Ga0070684_1001303352 293
66 3300005543 Ga0070672_100048784 Ga0070672_1000487842 293
67 3300005563 Ga0068855_100056686 Ga0068855_1000566865 293
68 3300005564 Ga0070664_100228687 Ga0070664_1002286872 293
69 3300005577 Ga0068857_100052292 Ga0068857_1000522924 293
70 3300005578 Ga0068854_100061809 Ga0068854_1000618094 293
71 3300005614 Ga0068856_100044663 Ga0068856_1000446637 293
72 3300005616 Ga0068852_100093867 Ga0068852_1000938672 293
73 3300005616 Ga0068852_100105428 Ga0068852_1001054283 293
74 3300005617 Ga0068859_100000023 Ga0068859_100000023169 293
75 3300005618 Ga0068864_100105170 Ga0068864_1001051702 293
76 3300005618 Ga0068864_100221370 Ga0068864_1002213702 293
77 3300005618 Ga0068864_100269909 Ga0068864_1002699092 293
78 3300005834 Ga0068851_10148657 Ga0068851_101486572 293
79 3300005841 Ga0068863_100008810 Ga0068863_1000088107 293
80 3300005841 Ga0068863_100350862 Ga0068863_1003508621 293
81 3300005842 Ga0068858_100039977 Ga0068858_1000399772 293
82 3300006237 Ga0097621_100015371 Ga0097621_1000153712 293
83 3300006237 Ga0097621_100098814 Ga0097621_1000988142 293
84 3300006358 Ga0068871_100034685 Ga0068871_1000346852 293
85 3300006358 Ga0068871_100268662 Ga0068871_1002686622 293
86 3300006881 Ga0068865_100105007 Ga0068865_1001050072 293
87 3300006931 Ga0097620_100000023 Ga0097620_100000023169 293
88 3300009093 Ga0105240_10142997 Ga0105240_101429972 293
89 3300009094 Ga0111539_10538006 Ga0111539_105380061 293
90 3300009098 Ga0105245_10179425 Ga0105245_101794252 293
91 3300009174 Ga0105241_10000149 Ga0105241_1000014915 293
92 3300009176 Ga0105242_10270983 Ga0105242_102709832 293
93 3300009545 Ga0105237_10002490 Ga0105237_100024904 293
94 3300009545 Ga0105237_10013107 Ga0105237_100131077 293
95 3300009553 Ga0105249_10040349 Ga0105249_100403495 293
96 3300010375 Ga0105239_10000436 Ga0105239_1000043664 293
97 3300013104 Ga0157370_10007050 Ga0157370_1000705012 293
98 3300013105 Ga0157369_10082189 Ga0157369_100821892 293
99 3300013105 Ga0157369_10253160 Ga0157369_102531602 293
100 3300013296 Ga0157374_10000001 Ga0157374_10000001423 293
101 3300013296 Ga0157374_10131393 Ga0157374_101313932 293
102 3300013296 Ga0157374_10149783 Ga0157374_101497832 293
103 3300013296 Ga0157374_10190308 Ga0157374_101903082 293
104 3300013297 Ga0157378_10018627 Ga0157378_100186273 293
105 3300013297 Ga0157378_10037967 Ga0157378_100379672 293
106 3300013297 Ga0157378_10067327 Ga0157378_100673272 293
107 3300013297 Ga0157378_10668195 Ga0157378_106681951 293
108 3300013306 Ga0163162_10000161 Ga0163162_1000016144 293
109 3300013306 Ga0163162_10006168 Ga0163162_100061685 293
110 3300013306 Ga0163162_10323479 Ga0163162_103234792 293
111 3300013306 Ga0163162_10325041 Ga0163162_103250412 293
112 3300013307 Ga0157372_10223345 Ga0157372_102233452 293
113 3300013308 Ga0157375_10008904 Ga0157375_100089043 293
114 3300013308 Ga0157375_10068335 Ga0157375_100683354 293
115 3300013308 Ga0157375_10196750 Ga0157375_101967502 293
116 3300014326 Ga0157380_10013873 Ga0157380_100138732 293
117 3300014968 Ga0157379_10264758 Ga0157379_102647582 293
118 3300014969 Ga0157376_10004691 Ga0157376_100046912 293
119 3300014969 Ga0157376_10027137 Ga0157376_100271372 293
120 3300017792 Ga0163161_10312134 Ga0163161_103121341 293
121 3300021384 Ga0213876_10030088 Ga0213876_100300883 293
122 3300025321 Ga0207656_10024010 Ga0207656_100240102 293
123 3300025903 Ga0207680_10000053 Ga0207680_1000005339 293
124 3300025904 Ga0207647_10004651 Ga0207647_100046517 293
125 3300025904 Ga0207647_10190283 Ga0207647_101902832 293
126 3300025914 Ga0207671_10003092 Ga0207671_100030922 293
127 3300025931 Ga0207644_10043341 Ga0207644_100433412 293
128 3300025936 Ga0207670_10144436 Ga0207670_101444361 293
129 3300025937 Ga0207669_10151040 Ga0207669_101510402 293
130 3300025940 Ga0207691_10068545 Ga0207691_100685452 293
131 3300025942 Ga0207689_10003009 Ga0207689_100030094 293
132 3300025960 Ga0207651_10164037 Ga0207651_101640372 293
133 3300025972 Ga0207668_10269968 Ga0207668_102699682 293
134 3300026023 Ga0207677_10027793 Ga0207677_100277932 293
135 3300026041 Ga0207639_10063766 Ga0207639_100637661 293
136 3300026078 Ga0207702_10234350 Ga0207702_102343502 293
137 3300026088 Ga0207641_10000202 Ga0207641_1000020229 293
138 3300026088 Ga0207641_10007365 Ga0207641_100073652 293
139 3300026089 Ga0207648_10077258 Ga0207648_100772581 293
140 3300026089 Ga0207648_10324983 Ga0207648_103249832 293
141 3300026116 Ga0207674_10044961 Ga0207674_100449613 293
142 3300026121 Ga0207683_10551893 Ga0207683_105518931 293
143 3300028794 Ga0307515_10000076 Ga0307515_10000076179 293
144 3300030521 Ga0307511_10001429 Ga0307511_1000142914 293
145 3300031251 Ga0265327_10068468 Ga0265327_100684682 293
146 3300031507 Ga0307509_10184280 Ga0307509_101842802 293
147 3300039437 Ga0436365_1081651 Ga0436365_1081651_11023_11904 293
148 3300044656 Ga0466969_0042179 Ga0466969_0042179_1265_2146 293
149 3300044842 Ga0466957_0184453 Ga0466957_0184453_200_1081 293
150 3300045049 Ga0466959_0051659 Ga0466959_0051659_2040_2921 293
151 3300045836 Ga0466958_0075077 Ga0466958_0075077_875_1756 293
152 3300046460 Ga0495638_0021426 Ga0495638_0021426_1608_2489 293
153 3300046616 Ga0495668_0010666 Ga0495668_0010666_192_1073 293
154 3300047472 Ga0495686_0000004 Ga0495686_0000004_211592_212473 293
155 3300049573 Ga0501037_0056250 Ga0501037_0056250_1039_1923 293
156 3300049703 Ga0501219_000291 Ga0501219_000291_1483_2364 293
157 3300050005 Ga0501284_00098 Ga0501284_00098_10663_11544 293
158 3300053153 Ga0500616_0022897 Ga0500616_0022897_1907_2788 293
159 3300001979 JGI24740J21852_10009956 JGI24740J21852_100099563 294
160 3300003316 rootH1_10066443 rootH1_100664432 294
161 3300003320 rootH2_10163639 rootH2_101636391 294
162 3300003320 rootH2_10292035 rootH2_102920352 294
163 3300003323 rootH1_10006250 rootH1_1000625014 294
164 3300003323 rootH1_10116719 rootH1_101167193 294
165 3300003323 rootH1_10171050 rootH1_101710503 294
166 3300003354 JGI25160J50197_1019690 JGI25160J50197_10196902 294
167 3300005329 Ga0070683_100006190 Ga0070683_1000061909 294
168 3300005333 Ga0070677_10147202 Ga0070677_101472022 294
169 3300005354 Ga0070675_100574627 Ga0070675_1005746271 294
170 3300005356 Ga0070674_100194533 Ga0070674_1001945332 294
171 3300005456 Ga0070678_100265187 Ga0070678_1002651871 294
172 3300005459 Ga0068867_100007399 Ga0068867_1000073995 294
173 3300005471 Ga0070698_100146652 Ga0070698_1001466522 294
174 3300005535 Ga0070684_100009306 Ga0070684_1000093064 294
175 3300005539 Ga0068853_100000862 Ga0068853_10000086213 294
176 3300005539 Ga0068853_100174155 Ga0068853_1001741552 294
177 3300005543 Ga0070672_100231851 Ga0070672_1002318512 294
178 3300005563 Ga0068855_100001333 Ga0068855_1000013333 294
179 3300005616 Ga0068852_100102353 Ga0068852_1001023532 294
180 3300005616 Ga0068852_100221885 Ga0068852_1002218852 294
181 3300005616 Ga0068852_100505316 Ga0068852_1005053161 294
182 3300005840 Ga0068870_10094113 Ga0068870_100941133 294
183 3300005843 Ga0068860_100151644 Ga0068860_1001516442 294
184 3300006237 Ga0097621_100365608 Ga0097621_1003656082 294
185 3300009093 Ga0105240_10000208 Ga0105240_1000020883 294
186 3300009093 Ga0105240_10001904 Ga0105240_1000190432 294
187 3300009093 Ga0105240_10068793 Ga0105240_100687932 294
188 3300009545 Ga0105237_10001017 Ga0105237_1000101724 294
189 3300009545 Ga0105237_10003181 Ga0105237_100031818 294
190 3300009545 Ga0105237_10226240 Ga0105237_102262402 294
191 3300009551 Ga0105238_10119098 Ga0105238_101190982 294
192 3300010375 Ga0105239_10024007 Ga0105239_100240074 294
193 3300010375 Ga0105239_10046834 Ga0105239_100468342 294
194 3300010375 Ga0105239_10128102 Ga0105239_101281022 294
195 3300010375 Ga0105239_10425250 Ga0105239_104252501 294
196 3300013100 Ga0157373_10224607 Ga0157373_102246072 294
197 3300013105 Ga0157369_10100633 Ga0157369_101006332 294
198 3300013306 Ga0163162_10013253 Ga0163162_100132534 294
199 3300013306 Ga0163162_10014326 Ga0163162_100143268 294
200 3300013307 Ga0157372_10075797 Ga0157372_100757972 294
201 3300014325 Ga0163163_10062217 Ga0163163_100622172 294
202 3300025302 Ga0207426_1000189 Ga0207426_100018955 294
203 3300025904 Ga0207647_10104362 Ga0207647_101043622 294
204 3300025909 Ga0207705_10171707 Ga0207705_101717072 294
205 3300025913 Ga0207695_10000076 Ga0207695_100000763 294
206 3300025913 Ga0207695_10000084 Ga0207695_100000843 294
207 3300025913 Ga0207695_10000090 Ga0207695_100000903 294
208 3300025913 Ga0207695_10000257 Ga0207695_100002572 294
209 3300025914 Ga0207671_10032225 Ga0207671_100322253 294
210 3300025938 Ga0207704_10058062 Ga0207704_100580621 294
211 3300025940 Ga0207691_10231772 Ga0207691_102317722 294
212 3300025944 Ga0207661_10016699 Ga0207661_100166993 294
213 3300025949 Ga0207667_10000911 Ga0207667_100009118 294
214 3300026041 Ga0207639_10006147 Ga0207639_100061473 294
215 3300026121 Ga0207683_10542958 Ga0207683_105429581 294
216 3300026142 Ga0207698_10312775 Ga0207698_103127752 294
217 3300028786 Ga0307517_10198040 Ga0307517_101980402 294
218 3300031507 Ga0307509_10084770 Ga0307509_100847703 294
219 3300031616 Ga0307508_10002012 Ga0307508_100020125 294
220 3300031730 Ga0307516_10003848 Ga0307516_100038485 294
221 3300033180 Ga0307510_10071891 Ga0307510_100718912 294
222 3300035695 Ga0373927_0099965 Ga0373927_0099965_510_1394 294
223 3300037068 Ga0373925_0216048 Ga0373925_0216048_78_962 294
224 3300041404 Ga0439436_0041398 Ga0439436_0041398_368_1252 294
225 3300041406 Ga0439439_0014095 Ga0439439_0014095_170_1054 294
226 3300041460 Ga0451802_0124700 Ga0451802_0124700_201_1085 294
227 3300042007 Ga0439449_0003119 Ga0439449_0003119_604_1488 294
228 3300042014 Ga0439457_000062 Ga0439457_000062_2521_3405 294
229 3300042015 Ga0439462_0002057 Ga0439462_0002057_1688_2572 294
230 3300044658 Ga0466972_0000055 Ga0466972_0000055_91035_91919 294
231 3300044658 Ga0466972_0000897 Ga0466972_0000897_11120_12004 294
232 3300044658 Ga0466972_0012675 Ga0466972_0012675_2604_3488 294
233 3300044765 Ga0466970_0024270 Ga0466970_0024270_2093_2977 294
234 3300044765 Ga0466970_0094103 Ga0466970_0094103_78_962 294
235 3300044842 Ga0466957_0012231 Ga0466957_0012231_2254_3138 294
236 3300046460 Ga0495638_0124145 Ga0495638_0124145_322_1206 294
237 3300046507 Ga0495606_0004940 Ga0495606_0004940_2297_3181 294
238 3300046648 Ga0495611_0000828 Ga0495611_0000828_14677_15561 294
239 3300049581 Ga0501047_0180841 Ga0501047_0180841_825_1709 294
240 3300049822 Ga0501035_0135363 Ga0501035_0135363_202_1086 294
241 3300050493 nmdc:mga0k408_40713_c1 nmdc:mga0k408_40713_c1_1084_1968 294
242 3300053086 Ga0500578_0000218 Ga0500578_0000218_57242_58126 294
243 3300053086 Ga0500578_0083274 Ga0500578_0083274_417_1301 294
244 3300053090 Ga0500646_0019375 Ga0500646_0019375_718_1602 294
245 3300053092 Ga0500583_0000325 Ga0500583_0000325_10344_11228 294
246 3300053142 Ga0500577_0077296 Ga0500577_0077296_115_999 294
247 3300053146 Ga0500588_0008063 Ga0500588_0008063_1338_2222 294
248 3300053150 Ga0500603_008993 Ga0500603_008993_343_1227 294
249 3300053156 Ga0500622_0013853 Ga0500622_0013853_519_1403 294
250 3300003316 rootH1_10030077 rootH1_100300772 295
251 3300005331 Ga0070670_100099800 Ga0070670_1000998002 295
252 3300005335 Ga0070666_10072706 Ga0070666_100727063 295
253 3300005338 Ga0068868_100248679 Ga0068868_1002486792 295
254 3300005344 Ga0070661_100060093 Ga0070661_1000600931 295
255 3300005364 Ga0070673_100175404 Ga0070673_1001754042 295
256 3300005458 Ga0070681_10029175 Ga0070681_100291753 295
257 3300005535 Ga0070684_100070750 Ga0070684_1000707503 295
258 3300005539 Ga0068853_100274539 Ga0068853_1002745392 295
259 3300005543 Ga0070672_100242297 Ga0070672_1002422972 295
260 3300005548 Ga0070665_100000001 Ga0070665_100000001446 295
261 3300005564 Ga0070664_100003626 Ga0070664_1000036262 295
262 3300005614 Ga0068856_100089724 Ga0068856_1000897244 295
263 3300005834 Ga0068851_10204813 Ga0068851_102048132 295
264 3300005843 Ga0068860_100000097 Ga0068860_10000009719 295
265 3300005843 Ga0068860_100017799 Ga0068860_1000177995 295
266 3300009093 Ga0105240_10063236 Ga0105240_100632364 295
267 3300009147 Ga0114129_10014118 Ga0114129_1001411810 295
268 3300009545 Ga0105237_10062999 Ga0105237_100629994 295
269 3300009545 Ga0105237_10235665 Ga0105237_102356652 295
270 3300009551 Ga0105238_10086837 Ga0105238_100868373 295
271 3300010375 Ga0105239_10038167 Ga0105239_100381673 295
272 3300013102 Ga0157371_10023195 Ga0157371_100231953 295
273 3300013306 Ga0163162_10002183 Ga0163162_1000218310 295
274 3300013307 Ga0157372_10326599 Ga0157372_103265992 295
275 3300013307 Ga0157372_10351316 Ga0157372_103513162 295
276 3300014325 Ga0163163_10004599 Ga0163163_1000459912 295
277 3300025912 Ga0207707_10022898 Ga0207707_100228982 295
278 3300025913 Ga0207695_10002714 Ga0207695_100027142 295
279 3300025914 Ga0207671_10020465 Ga0207671_100204653 295
280 3300025914 Ga0207671_10033064 Ga0207671_100330644 295
281 3300025914 Ga0207671_10101819 Ga0207671_101018192 295
282 3300025920 Ga0207649_10071041 Ga0207649_100710412 295
283 3300025925 Ga0207650_10047355 Ga0207650_100473553 295
284 3300025925 Ga0207650_10132137 Ga0207650_101321372 295
285 3300025931 Ga0207644_10282168 Ga0207644_102821682 295
286 3300025945 Ga0207679_10135816 Ga0207679_101358162 295
287 3300025949 Ga0207667_10029268 Ga0207667_100292681 295
288 3300025960 Ga0207651_10488085 Ga0207651_104880852 295
289 3300026078 Ga0207702_10079696 Ga0207702_100796964 295
290 3300026142 Ga0207698_10375427 Ga0207698_103754272 295
291 3300028379 Ga0268266_10000038 Ga0268266_10000038193 295
292 3300028381 Ga0268264_10000525 Ga0268264_1000052519 295
293 3300028381 Ga0268264_10006805 Ga0268264_100068057 295
294 3300033180 Ga0307510_10264132 Ga0307510_102641321 295
295 3300044842 Ga0466957_0002949 Ga0466957_0002949_4527_5414 295
296 3300046460 Ga0495638_0041874 Ga0495638_0041874_917_1804 295
297 3300046524 Ga0495648_0011249 Ga0495648_0011249_5167_6054 295
298 3300046648 Ga0495611_0011673 Ga0495611_0011673_541_1428 295
299 3300047443 Ga0495687_000001 Ga0495687_000001_676129_677016 295
300 3300049579 Ga0501043_0157196 Ga0501043_0157196_63_950 295
301 3300049581 Ga0501047_0030619 Ga0501047_0030619_4271_5158 295
302 3300049582 Ga0501048_0083566 Ga0501048_0083566_184_1071 295
303 3300049823 Ga0501044_0070002 Ga0501044_0070002_364_1251 295
304 3300050507 nmdc:mga05p37_13803_c1 nmdc:mga05p37_13803_c1_610_1497 295
305 3300053092 Ga0500583_0001274 Ga0500583_0001274_1333_2220 295
306 3300053156 Ga0500622_0001882 Ga0500622_0001882_1329_2216 295
307 3300003323 rootH1_10152618 rootH1_101526184 296
308 3300010375 Ga0105239_10091008 Ga0105239_100910083 296
309 3300028786 Ga0307517_10039167 Ga0307517_100391674 296
310 3300044656 Ga0466969_0000772 Ga0466969_0000772_12797_13717 296
311 3300044684 Ga0466966_0000080 Ga0466966_0000080_13243_14163 296
312 3300045049 Ga0466959_0000009 Ga0466959_0000009_102844_103764 296
313 3300046616 Ga0495668_0000521 Ga0495668_0000521_5026_5919 297
314 3300005563 Ga0068855_100033416 Ga0068855_1000334164 298
315 3300009093 Ga0105240_10003887 Ga0105240_100038875 298
316 3300025913 Ga0207695_10007357 Ga0207695_100073577 298
317 3300049705 Ga0501225_0024879 Ga0501225_0024879_433_1329 298
318 3300003203 JGI25406J46586_10018717 JGI25406J46586_100187172 301
319 3300005985 Ga0081539_10000893 Ga0081539_1000089354 301
320 3300005329 Ga0070683_100011657 Ga0070683_1000116579 302
321 3300005330 Ga0070690_100083926 Ga0070690_1000839261 302
322 3300005335 Ga0070666_10010924 Ga0070666_100109243 302
323 3300005337 Ga0070682_100002757 Ga0070682_1000027575 302
324 3300005338 Ga0068868_100010578 Ga0068868_1000105786 302
325 3300005339 Ga0070660_100010871 Ga0070660_1000108716 302
326 3300005344 Ga0070661_100255985 Ga0070661_1002559852 302
327 3300005354 Ga0070675_100039045 Ga0070675_1000390453 302
328 3300005355 Ga0070671_100157795 Ga0070671_1001577952 302
329 3300005364 Ga0070673_100040924 Ga0070673_1000409243 302
330 3300005366 Ga0070659_100004288 Ga0070659_10000428811 302
331 3300005367 Ga0070667_100348583 Ga0070667_1003485832 302
332 3300005456 Ga0070678_100216475 Ga0070678_1002164752 302
333 3300005458 Ga0070681_10071962 Ga0070681_100719621 302
334 3300005530 Ga0070679_100099285 Ga0070679_1000992852 302
335 3300005535 Ga0070684_100044075 Ga0070684_1000440753 302
336 3300005539 Ga0068853_100318855 Ga0068853_1003188552 302
337 3300005563 Ga0068855_100120093 Ga0068855_1001200932 302
338 3300005564 Ga0070664_100039014 Ga0070664_1000390144 302
339 3300005577 Ga0068857_100122568 Ga0068857_1001225681 302
340 3300005578 Ga0068854_100102957 Ga0068854_1001029572 302
341 3300005614 Ga0068856_100026002 Ga0068856_1000260027 302
342 3300005616 Ga0068852_100181146 Ga0068852_1001811462 302
343 3300005618 Ga0068864_100109347 Ga0068864_1001093472 302
344 3300006237 Ga0097621_100010422 Ga0097621_1000104222 302
345 3300006358 Ga0068871_100027174 Ga0068871_1000271742 302
346 3300013100 Ga0157373_10001117 Ga0157373_1000111716 302
347 3300013104 Ga0157370_10127449 Ga0157370_101274491 302
348 3300013105 Ga0157369_10003748 Ga0157369_1000374816 302
349 3300013296 Ga0157374_10010111 Ga0157374_100101115 302
350 3300013297 Ga0157378_10014671 Ga0157378_100146711 302
351 3300013307 Ga0157372_10215184 Ga0157372_102151842 302
352 3300013307 Ga0157372_10438954 Ga0157372_104389542 302
353 3300014745 Ga0157377_10147494 Ga0157377_101474942 302
354 3300025321 Ga0207656_10020256 Ga0207656_100202562 302
355 3300025903 Ga0207680_10014833 Ga0207680_100148335 302
356 3300025917 Ga0207660_10108983 Ga0207660_101089832 302
357 3300025919 Ga0207657_10001494 Ga0207657_1000149416 302
358 3300025920 Ga0207649_10362236 Ga0207649_103622361 302
359 3300025926 Ga0207659_10121334 Ga0207659_101213342 302
360 3300025931 Ga0207644_10076675 Ga0207644_100766753 302
361 3300025933 Ga0207706_10006153 Ga0207706_100061532 302
362 3300025944 Ga0207661_10054907 Ga0207661_100549072 302
363 3300025945 Ga0207679_10013083 Ga0207679_100130833 302
364 3300025949 Ga0207667_10035976 Ga0207667_100359762 302
365 3300025960 Ga0207651_10021947 Ga0207651_100219472 302
366 3300025981 Ga0207640_10035618 Ga0207640_100356182 302
367 3300025986 Ga0207658_10434181 Ga0207658_104341811 302
368 3300026041 Ga0207639_10027360 Ga0207639_100273605 302
369 3300026078 Ga0207702_10106670 Ga0207702_101066703 302
370 3300026088 Ga0207641_10517825 Ga0207641_105178251 302
371 3300026116 Ga0207674_10081181 Ga0207674_100811814 302
372 3300026121 Ga0207683_10311581 Ga0207683_103115812 302
373 3300026142 Ga0207698_10037620 Ga0207698_100376202 302
374 2162886011 MRS1b_contig_5483801 MRS1b_0939.00000980 307
375 3300005290 Ga0065712_10096572 Ga0065712_100965722 307
376 3300005354 Ga0070675_100009535 Ga0070675_1000095356 307
377 3300050507 nmdc:mga05p37_72139_c1 nmdc:mga05p37_72139_c1_1806_2732 307
378 3300050510 nmdc:mga06r32_60578_c1 nmdc:mga06r32_60578_c1_48_974 307
379 3300050511 nmdc:mga08y16_50116_c1 nmdc:mga08y16_50116_c1_484_1413 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

55

343

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mqh-assembly1.cif.gz_A crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei 0.9629 7 292
3flu-assembly1.cif.gz_B crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis 0.9627 7 292
3noe-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa 0.9624 7 292
3qze-assembly2.cif.gz_D crystal structure of dapa (pa1010) at 1.6 a resolution 0.961 7 292
6p90-assembly1.cif.gz_B crystal structure of padhdps2-h56q mutant 0.9603 7 292
ID Description Score Start End Superfamily
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9595 7 293 3.20.20.70
6nvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9586 4 292 3.20.20.70
3pb2D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9545 3 294 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9528 8 299 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9507 8 295 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4Q3V431-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 0.9804 3 236 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-E4M8I6-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9788 3 293 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-L1P4I3-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9788 7 290 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A3XRN1-F1-model_v4 Putative dihydrodipicolinate synthase 0.9784 191 293 GO:0005829
GO:0008840
AF-A0A838TPX4-F1-model_v4 N-acetylneuraminate lyase (EC 4.1.3.3) 0.9783 1 120 GO:0005829
GO:0008747
GO:0019262

Feature Viewer

pLDDT pTM Quality
92.57 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map