F428287
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 379 | 185 | 376 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100146652|Ga0070698_1001466522 |
| Length | 343 |
| Sequence | LCHSLVQPYLYSALTKFKRAFRHPDNYREVGGPKIKSAPGNHRGFNLKIMSLRQSLYGTGVALVTPFKSNGEVDLDALSKIIDFVINGGTEYIVTLGTTGETPALGKEEKIAIIRYTYEKVNNRVPVVVGIGGNSTPEVVKELETFPLDKATAILSASPYYNKPSQEGIFQHYKALAAASPKPILLYNVPGRTGRNMTAATTLRLANEVPNIGGIKEASGDMAQCMQILRDRPENFLVVSGDDALVLPQIACGMEGVISVAANAFPQQFTHMVRQCLKGDFKAAKSLNDVLIEAYDLMFAENNPAGVKAFMTELELLQNYLRLPMVPLSEGLYAQVQTFLKGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 4 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 86 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 126 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 127 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 128 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 129 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 130 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 131 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 132 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 135 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 136 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 140 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 141 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 142 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 143 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 144 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 145 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 146 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 147 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 148 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 151 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 168 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 169 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 172 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 173 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 177 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 178 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 179 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 180 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 181 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 182 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 183 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 184 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 185 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0 |
| Isolates | 0.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.54 |
| Nodule | 0 |
| Rhizoplane | 0.53 |
| Rhizosphere | 85.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_5483801 | 2162886011 | Bacteria | 1145 |
| 2 | JGI24740J21852_10009956 | 3300001979 | Bacteria | 3687 |
| 3 | JGI25406J46586_10018717 | 3300003203 | Bacteria | 2841 |
| 4 | rootH1_10030077 | 3300003316 | Bacteria | 2281 |
| 5 | rootH1_10066443 | 3300003316 | Bacteria | 1322 |
| 6 | rootH2_10009673 | 3300003320 | Bacteria | 54328 |
| 7 | rootH2_10011544 | 3300003320 | Bacteria | 15987 |
| 8 | rootH2_10163639 | 3300003320 | Unclassified | 1875 |
| 9 | rootH2_10292035 | 3300003320 | Bacteria | 1394 |
| 10 | rootH1_10006250 | 3300003323 | Bacteria | 22415 |
| 11 | rootH1_10026687 | 3300003323 | Bacteria | 11109 |
| 12 | rootH1_10083389 | 3300003323 | Bacteria | 1590 |
| 13 | rootH1_10116719 | 3300003323 | Bacteria | 3726 |
| 14 | rootH1_10152618 | 3300003323 | Bacteria | 3010 |
| 15 | rootH1_10171050 | 3300003323 | Bacteria | 3319 |
| 16 | JGI25160J50197_1019690 | 3300003354 | Unclassified | 2061 |
| 17 | Ga0065712_10096572 | 3300005290 | Bacteria | 2171 |
| 18 | Ga0070683_100006190 | 3300005329 | Bacteria | 10039 |
| 19 | Ga0070683_100011657 | 3300005329 | Bacteria | 7611 |
| 20 | Ga0070690_100083926 | 3300005330 | Bacteria | 2087 |
| 21 | Ga0070670_100045712 | 3300005331 | Bacteria | 3765 |
| 22 | Ga0070670_100099800 | 3300005331 | Bacteria | 2498 |
| 23 | Ga0070677_10147202 | 3300005333 | Bacteria | 1092 |
| 24 | Ga0068869_100003911 | 3300005334 | Bacteria | 9192 |
| 25 | Ga0070666_10000051 | 3300005335 | Bacteria | 99740 |
| 26 | Ga0070666_10010924 | 3300005335 | Bacteria | 5689 |
| 27 | Ga0070666_10072706 | 3300005335 | Bacteria | 2342 |
| 28 | Ga0070682_100002757 | 3300005337 | Bacteria | 9727 |
| 29 | Ga0068868_100010578 | 3300005338 | Bacteria | 6687 |
| 30 | Ga0068868_100248679 | 3300005338 | Bacteria | 1496 |
| 31 | Ga0070660_100010871 | 3300005339 | Bacteria | 6442 |
| 32 | Ga0070689_100205372 | 3300005340 | Bacteria | 1610 |
| 33 | Ga0070661_100060093 | 3300005344 | Bacteria | 2789 |
| 34 | Ga0070661_100255985 | 3300005344 | Bacteria | 1352 |
| 35 | Ga0070675_100009535 | 3300005354 | Bacteria | 7552 |
| 36 | Ga0070675_100039045 | 3300005354 | Bacteria | 3872 |
| 37 | Ga0070675_100574627 | 3300005354 | Bacteria | 1021 |
| 38 | Ga0070671_100006498 | 3300005355 | Bacteria | 9347 |
| 39 | Ga0070671_100127187 | 3300005355 | Bacteria | 2146 |
| 40 | Ga0070671_100157795 | 3300005355 | Bacteria | 1917 |
| 41 | Ga0070674_100194533 | 3300005356 | Bacteria | 1562 |
| 42 | Ga0070673_100040924 | 3300005364 | Bacteria | 3559 |
| 43 | Ga0070673_100175404 | 3300005364 | Bacteria | 1832 |
| 44 | Ga0070659_100004288 | 3300005366 | Bacteria | 10182 |
| 45 | Ga0070667_100048411 | 3300005367 | Unclassified | 3578 |
| 46 | Ga0070667_100348583 | 3300005367 | Bacteria | 1340 |
| 47 | Ga0070663_100235182 | 3300005455 | Bacteria | 1444 |
| 48 | Ga0070678_100037742 | 3300005456 | Bacteria | 3395 |
| 49 | Ga0070678_100040099 | 3300005456 | Bacteria | 3311 |
| 50 | Ga0070678_100216475 | 3300005456 | Unclassified | 1590 |
| 51 | Ga0070678_100265187 | 3300005456 | Bacteria | 1446 |
| 52 | Ga0070681_10029175 | 3300005458 | Bacteria | 5539 |
| 53 | Ga0070681_10071962 | 3300005458 | Bacteria | 3422 |
| 54 | Ga0068867_100007399 | 3300005459 | Bacteria | 7768 |
| 55 | Ga0068867_100041921 | 3300005459 | Bacteria | 3345 |
| 56 | Ga0070685_10238681 | 3300005466 | Bacteria | 1199 |
| 57 | Ga0070698_100146652 | 3300005471 | Bacteria | 2309 |
| 58 | Ga0070679_100099285 | 3300005530 | Bacteria | 2898 |
| 59 | Ga0070684_100009306 | 3300005535 | Bacteria | 7734 |
| 60 | Ga0070684_100044075 | 3300005535 | Bacteria | 3856 |
| 61 | Ga0070684_100070750 | 3300005535 | Bacteria | 3071 |
| 62 | Ga0070684_100130335 | 3300005535 | Bacteria | 2268 |
| 63 | Ga0068853_100000862 | 3300005539 | Bacteria | 21166 |
| 64 | Ga0068853_100020972 | 3300005539 | Bacteria | 5439 |
| 65 | Ga0068853_100174155 | 3300005539 | Bacteria | 1948 |
| 66 | Ga0068853_100274539 | 3300005539 | Bacteria | 1553 |
| 67 | Ga0068853_100318855 | 3300005539 | Bacteria | 1440 |
| 68 | Ga0070672_100048784 | 3300005543 | Unclassified | 3292 |
| 69 | Ga0070672_100231851 | 3300005543 | Bacteria | 1551 |
| 70 | Ga0070672_100242297 | 3300005543 | Bacteria | 1517 |
| 71 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 72 | Ga0068855_100001333 | 3300005563 | Bacteria | 30579 |
| 73 | Ga0068855_100033416 | 3300005563 | Bacteria | 6138 |
| 74 | Ga0068855_100056686 | 3300005563 | Bacteria | 4596 |
| 75 | Ga0068855_100120093 | 3300005563 | Bacteria | 3008 |
| 76 | Ga0070664_100003626 | 3300005564 | Bacteria | 12441 |
| 77 | Ga0070664_100039014 | 3300005564 | Bacteria | 4000 |
| 78 | Ga0070664_100228687 | 3300005564 | Bacteria | 1667 |
| 79 | Ga0068857_100052292 | 3300005577 | Bacteria | 3625 |
| 80 | Ga0068857_100122568 | 3300005577 | Bacteria | 2342 |
| 81 | Ga0068854_100061809 | 3300005578 | Bacteria | 2714 |
| 82 | Ga0068854_100102957 | 3300005578 | Bacteria | 2143 |
| 83 | Ga0068856_100026002 | 3300005614 | Bacteria | 5708 |
| 84 | Ga0068856_100044663 | 3300005614 | Bacteria | 4362 |
| 85 | Ga0068856_100089724 | 3300005614 | Bacteria | 3057 |
| 86 | Ga0068852_100093867 | 3300005616 | Bacteria | 2690 |
| 87 | Ga0068852_100102353 | 3300005616 | Bacteria | 2588 |
| 88 | Ga0068852_100105428 | 3300005616 | Bacteria | 2554 |
| 89 | Ga0068852_100181146 | 3300005616 | Bacteria | 1981 |
| 90 | Ga0068852_100221885 | 3300005616 | Bacteria | 1798 |
| 91 | Ga0068852_100505316 | 3300005616 | Bacteria | 1204 |
| 92 | Ga0068859_100000023 | 3300005617 | Bacteria | 221914 |
| 93 | Ga0068859_100001090 | 3300005617 | Bacteria | 27692 |
| 94 | Ga0068864_100105170 | 3300005618 | Bacteria | 2508 |
| 95 | Ga0068864_100109347 | 3300005618 | Bacteria | 2461 |
| 96 | Ga0068864_100221370 | 3300005618 | Bacteria | 1746 |
| 97 | Ga0068864_100269909 | 3300005618 | Bacteria | 1585 |
| 98 | Ga0068851_10039662 | 3300005834 | Unclassified | 2365 |
| 99 | Ga0068851_10148657 | 3300005834 | Bacteria | 1279 |
| 100 | Ga0068851_10204813 | 3300005834 | Bacteria | 1103 |
| 101 | Ga0068870_10094113 | 3300005840 | Bacteria | 1681 |
| 102 | Ga0068863_100008810 | 3300005841 | Bacteria | 9851 |
| 103 | Ga0068863_100350862 | 3300005841 | Bacteria | 1437 |
| 104 | Ga0068858_100039977 | 3300005842 | Unclassified | 4349 |
| 105 | Ga0068860_100000097 | 3300005843 | Bacteria | 146573 |
| 106 | Ga0068860_100017799 | 3300005843 | Bacteria | 6923 |
| 107 | Ga0068860_100151644 | 3300005843 | Bacteria | 2232 |
| 108 | Ga0081539_10000893 | 3300005985 | Bacteria | 57031 |
| 109 | Ga0075366_10047260 | 3300006195 | Bacteria | 2551 |
| 110 | Ga0097621_100000224 | 3300006237 | Bacteria | 37801 |
| 111 | Ga0097621_100010422 | 3300006237 | Bacteria | 6804 |
| 112 | Ga0097621_100015371 | 3300006237 | Bacteria | 5757 |
| 113 | Ga0097621_100098814 | 3300006237 | Bacteria | 2452 |
| 114 | Ga0097621_100365608 | 3300006237 | Bacteria | 1286 |
| 115 | Ga0075370_10067601 | 3300006353 | Bacteria | 2040 |
| 116 | Ga0068871_100000949 | 3300006358 | Bacteria | 19369 |
| 117 | Ga0068871_100027174 | 3300006358 | Bacteria | 4472 |
| 118 | Ga0068871_100034685 | 3300006358 | Bacteria | 4005 |
| 119 | Ga0068871_100268662 | 3300006358 | Bacteria | 1489 |
| 120 | Ga0068865_100105007 | 3300006881 | Bacteria | 2075 |
| 121 | Ga0097620_100000023 | 3300006931 | Bacteria | 221914 |
| 122 | Ga0097620_100001090 | 3300006931 | Bacteria | 27692 |
| 123 | Ga0105240_10000208 | 3300009093 | Bacteria | 118950 |
| 124 | Ga0105240_10001904 | 3300009093 | Bacteria | 34640 |
| 125 | Ga0105240_10003887 | 3300009093 | Bacteria | 23076 |
| 126 | Ga0105240_10063236 | 3300009093 | Bacteria | 4604 |
| 127 | Ga0105240_10068793 | 3300009093 | Bacteria | 4385 |
| 128 | Ga0105240_10142997 | 3300009093 | Bacteria | 2858 |
| 129 | Ga0111539_10538006 | 3300009094 | Bacteria | 1361 |
| 130 | Ga0105245_10179425 | 3300009098 | Bacteria | 2022 |
| 131 | Ga0114129_10014118 | 3300009147 | Bacteria | 11377 |
| 132 | Ga0105241_10000149 | 3300009174 | Bacteria | 50078 |
| 133 | Ga0105242_10270983 | 3300009176 | Bacteria | 1538 |
| 134 | Ga0105237_10001017 | 3300009545 | Bacteria | 37740 |
| 135 | Ga0105237_10002490 | 3300009545 | Bacteria | 22826 |
| 136 | Ga0105237_10003181 | 3300009545 | Bacteria | 19693 |
| 137 | Ga0105237_10013107 | 3300009545 | Bacteria | 8702 |
| 138 | Ga0105237_10062999 | 3300009545 | Unclassified | 3706 |
| 139 | Ga0105237_10226240 | 3300009545 | Bacteria | 1871 |
| 140 | Ga0105237_10235665 | 3300009545 | Bacteria | 1831 |
| 141 | Ga0105238_10086837 | 3300009551 | Bacteria | 3115 |
| 142 | Ga0105238_10119098 | 3300009551 | Bacteria | 2620 |
| 143 | Ga0105249_10040349 | 3300009553 | Bacteria | 4240 |
| 144 | Ga0105239_10000436 | 3300010375 | Bacteria | 61031 |
| 145 | Ga0105239_10024007 | 3300010375 | Bacteria | 6716 |
| 146 | Ga0105239_10038167 | 3300010375 | Bacteria | 5264 |
| 147 | Ga0105239_10046834 | 3300010375 | Bacteria | 4738 |
| 148 | Ga0105239_10091008 | 3300010375 | Bacteria | 3366 |
| 149 | Ga0105239_10128102 | 3300010375 | Bacteria | 2822 |
| 150 | Ga0105239_10425250 | 3300010375 | Unclassified | 1505 |
| 151 | Ga0157373_10001117 | 3300013100 | Bacteria | 20595 |
| 152 | Ga0157373_10224607 | 3300013100 | Bacteria | 1325 |
| 153 | Ga0157371_10023195 | 3300013102 | Bacteria | 4537 |
| 154 | Ga0157370_10007050 | 3300013104 | Bacteria | 12268 |
| 155 | Ga0157370_10127449 | 3300013104 | Bacteria | 2376 |
| 156 | Ga0157369_10003748 | 3300013105 | Bacteria | 18059 |
| 157 | Ga0157369_10082189 | 3300013105 | Bacteria | 3447 |
| 158 | Ga0157369_10100633 | 3300013105 | Bacteria | 3081 |
| 159 | Ga0157369_10253160 | 3300013105 | Bacteria | 1838 |
| 160 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 161 | Ga0157374_10010111 | 3300013296 | Bacteria | 8103 |
| 162 | Ga0157374_10131393 | 3300013296 | Bacteria | 2423 |
| 163 | Ga0157374_10149783 | 3300013296 | Bacteria | 2268 |
| 164 | Ga0157374_10190308 | 3300013296 | Bacteria | 2007 |
| 165 | Ga0157378_10011188 | 3300013297 | Bacteria | 7850 |
| 166 | Ga0157378_10014671 | 3300013297 | Bacteria | 6862 |
| 167 | Ga0157378_10018627 | 3300013297 | Bacteria | 6104 |
| 168 | Ga0157378_10037967 | 3300013297 | Bacteria | 4268 |
| 169 | Ga0157378_10067327 | 3300013297 | Bacteria | 3209 |
| 170 | Ga0157378_10668195 | 3300013297 | Unclassified | 1056 |
| 171 | Ga0163162_10000161 | 3300013306 | Bacteria | 62198 |
| 172 | Ga0163162_10002183 | 3300013306 | Bacteria | 18347 |
| 173 | Ga0163162_10006168 | 3300013306 | Bacteria | 11613 |
| 174 | Ga0163162_10013253 | 3300013306 | Bacteria | 8052 |
| 175 | Ga0163162_10014326 | 3300013306 | Bacteria | 7747 |
| 176 | Ga0163162_10323479 | 3300013306 | Bacteria | 1675 |
| 177 | Ga0163162_10325041 | 3300013306 | Bacteria | 1671 |
| 178 | Ga0157372_10000595 | 3300013307 | Bacteria | 39419 |
| 179 | Ga0157372_10075797 | 3300013307 | Bacteria | 3796 |
| 180 | Ga0157372_10215184 | 3300013307 | Bacteria | 2227 |
| 181 | Ga0157372_10223345 | 3300013307 | Bacteria | 2183 |
| 182 | Ga0157372_10326599 | 3300013307 | Bacteria | 1786 |
| 183 | Ga0157372_10351316 | 3300013307 | Unclassified | 1718 |
| 184 | Ga0157372_10438954 | 3300013307 | Bacteria | 1522 |
| 185 | Ga0157375_10008904 | 3300013308 | Bacteria | 8784 |
| 186 | Ga0157375_10028423 | 3300013308 | Bacteria | 5241 |
| 187 | Ga0157375_10068335 | 3300013308 | Bacteria | 3555 |
| 188 | Ga0157375_10196750 | 3300013308 | Unclassified | 2171 |
| 189 | Ga0163163_10004599 | 3300014325 | Bacteria | 11782 |
| 190 | Ga0163163_10062217 | 3300014325 | Unclassified | 3698 |
| 191 | Ga0157380_10013873 | 3300014326 | Bacteria | 5885 |
| 192 | Ga0157377_10147494 | 3300014745 | Bacteria | 1452 |
| 193 | Ga0157379_10089706 | 3300014968 | Bacteria | 2758 |
| 194 | Ga0157379_10264758 | 3300014968 | Bacteria | 1563 |
| 195 | Ga0157376_10004691 | 3300014969 | Bacteria | 9526 |
| 196 | Ga0157376_10027137 | 3300014969 | Bacteria | 4535 |
| 197 | Ga0157376_10029184 | 3300014969 | Bacteria | 4392 |
| 198 | Ga0163161_10003964 | 3300017792 | Bacteria | 10379 |
| 199 | Ga0163161_10312134 | 3300017792 | Unclassified | 1241 |
| 200 | Ga0213876_10030088 | 3300021384 | Bacteria | 2862 |
| 201 | Ga0207426_1000189 | 3300025302 | Bacteria | 153457 |
| 202 | Ga0207656_10020256 | 3300025321 | Bacteria | 2642 |
| 203 | Ga0207656_10024010 | 3300025321 | Unclassified | 2461 |
| 204 | Ga0207680_10000053 | 3300025903 | Bacteria | 55149 |
| 205 | Ga0207680_10014833 | 3300025903 | Bacteria | 4048 |
| 206 | Ga0207680_10054944 | 3300025903 | Bacteria | 2398 |
| 207 | Ga0207647_10004651 | 3300025904 | Bacteria | 10169 |
| 208 | Ga0207647_10104362 | 3300025904 | Bacteria | 1680 |
| 209 | Ga0207647_10190283 | 3300025904 | Bacteria | 1189 |
| 210 | Ga0207705_10171707 | 3300025909 | Bacteria | 1633 |
| 211 | Ga0207707_10022898 | 3300025912 | Bacteria | 5464 |
| 212 | Ga0207695_10000076 | 3300025913 | Bacteria | 307969 |
| 213 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 214 | Ga0207695_10000090 | 3300025913 | Bacteria | 272143 |
| 215 | Ga0207695_10000257 | 3300025913 | Bacteria | 134853 |
| 216 | Ga0207695_10002714 | 3300025913 | Bacteria | 25834 |
| 217 | Ga0207695_10007357 | 3300025913 | Bacteria | 14048 |
| 218 | Ga0207671_10001353 | 3300025914 | Bacteria | 28612 |
| 219 | Ga0207671_10003092 | 3300025914 | Bacteria | 16963 |
| 220 | Ga0207671_10020465 | 3300025914 | Bacteria | 5035 |
| 221 | Ga0207671_10032225 | 3300025914 | Bacteria | 3902 |
| 222 | Ga0207671_10033064 | 3300025914 | Bacteria | 3849 |
| 223 | Ga0207671_10040735 | 3300025914 | Bacteria | 3437 |
| 224 | Ga0207671_10101819 | 3300025914 | Bacteria | 2177 |
| 225 | Ga0207660_10108983 | 3300025917 | Bacteria | 2081 |
| 226 | Ga0207657_10001494 | 3300025919 | Bacteria | 25019 |
| 227 | Ga0207649_10071041 | 3300025920 | Bacteria | 2222 |
| 228 | Ga0207649_10362236 | 3300025920 | Bacteria | 1076 |
| 229 | Ga0207681_10226249 | 3300025923 | Bacteria | 1450 |
| 230 | Ga0207650_10047355 | 3300025925 | Unclassified | 3168 |
| 231 | Ga0207650_10132137 | 3300025925 | Bacteria | 1954 |
| 232 | Ga0207659_10121334 | 3300025926 | Bacteria | 2003 |
| 233 | Ga0207644_10043341 | 3300025931 | Bacteria | 3193 |
| 234 | Ga0207644_10056915 | 3300025931 | Bacteria | 2822 |
| 235 | Ga0207644_10076675 | 3300025931 | Bacteria | 2460 |
| 236 | Ga0207644_10282168 | 3300025931 | Bacteria | 1334 |
| 237 | Ga0207706_10006153 | 3300025933 | Bacteria | 11146 |
| 238 | Ga0207670_10144436 | 3300025936 | Bacteria | 1758 |
| 239 | Ga0207669_10151040 | 3300025937 | Bacteria | 1627 |
| 240 | Ga0207704_10058062 | 3300025938 | Bacteria | 2381 |
| 241 | Ga0207691_10068545 | 3300025940 | Unclassified | 3205 |
| 242 | Ga0207691_10231772 | 3300025940 | Bacteria | 1599 |
| 243 | Ga0207691_10388811 | 3300025940 | Bacteria | 1190 |
| 244 | Ga0207689_10003009 | 3300025942 | Bacteria | 15544 |
| 245 | Ga0207661_10016699 | 3300025944 | Bacteria | 5418 |
| 246 | Ga0207661_10054907 | 3300025944 | Bacteria | 3192 |
| 247 | Ga0207679_10013083 | 3300025945 | Bacteria | 5432 |
| 248 | Ga0207679_10135816 | 3300025945 | Bacteria | 1980 |
| 249 | Ga0207667_10000911 | 3300025949 | Bacteria | 37650 |
| 250 | Ga0207667_10029268 | 3300025949 | Bacteria | 5974 |
| 251 | Ga0207667_10035976 | 3300025949 | Bacteria | 5310 |
| 252 | Ga0207667_10209367 | 3300025949 | Unclassified | 1999 |
| 253 | Ga0207651_10021947 | 3300025960 | Bacteria | 3892 |
| 254 | Ga0207651_10164037 | 3300025960 | Bacteria | 1745 |
| 255 | Ga0207651_10164154 | 3300025960 | Bacteria | 1745 |
| 256 | Ga0207651_10488085 | 3300025960 | Bacteria | 1063 |
| 257 | Ga0207668_10269968 | 3300025972 | Bacteria | 1390 |
| 258 | Ga0207640_10035618 | 3300025981 | Bacteria | 3116 |
| 259 | Ga0207658_10047033 | 3300025986 | Bacteria | 3155 |
| 260 | Ga0207658_10434181 | 3300025986 | Bacteria | 1160 |
| 261 | Ga0207677_10027793 | 3300026023 | Bacteria | 3569 |
| 262 | Ga0207639_10006147 | 3300026041 | Bacteria | 8151 |
| 263 | Ga0207639_10015187 | 3300026041 | Bacteria | 5427 |
| 264 | Ga0207639_10027360 | 3300026041 | Bacteria | 4155 |
| 265 | Ga0207639_10063766 | 3300026041 | Unclassified | 2855 |
| 266 | Ga0207702_10079696 | 3300026078 | Bacteria | 2839 |
| 267 | Ga0207702_10106670 | 3300026078 | Bacteria | 2483 |
| 268 | Ga0207702_10234350 | 3300026078 | Unclassified | 1717 |
| 269 | Ga0207641_10000202 | 3300026088 | Bacteria | 79668 |
| 270 | Ga0207641_10007365 | 3300026088 | Bacteria | 9163 |
| 271 | Ga0207641_10517825 | 3300026088 | Bacteria | 1160 |
| 272 | Ga0207648_10077258 | 3300026089 | Bacteria | 2902 |
| 273 | Ga0207648_10324983 | 3300026089 | Bacteria | 1383 |
| 274 | Ga0207676_10367233 | 3300026095 | Bacteria | 1336 |
| 275 | Ga0207674_10044961 | 3300026116 | Bacteria | 4546 |
| 276 | Ga0207674_10081181 | 3300026116 | Bacteria | 3244 |
| 277 | Ga0207683_10022620 | 3300026121 | Bacteria | 5398 |
| 278 | Ga0207683_10311581 | 3300026121 | Bacteria | 1441 |
| 279 | Ga0207683_10542958 | 3300026121 | Bacteria | 1074 |
| 280 | Ga0207683_10551893 | 3300026121 | Unclassified | 1065 |
| 281 | Ga0207698_10037620 | 3300026142 | Bacteria | 3566 |
| 282 | Ga0207698_10312775 | 3300026142 | Unclassified | 1467 |
| 283 | Ga0207698_10375427 | 3300026142 | Bacteria | 1351 |
| 284 | Ga0268266_10000038 | 3300028379 | Bacteria | 325729 |
| 285 | Ga0268264_10000525 | 3300028381 | Bacteria | 48553 |
| 286 | Ga0268264_10006805 | 3300028381 | Bacteria | 9603 |
| 287 | Ga0307517_10039167 | 3300028786 | Bacteria | 5217 |
| 288 | Ga0307517_10198040 | 3300028786 | Unclassified | 1261 |
| 289 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 290 | Ga0307515_10000076 | 3300028794 | Bacteria | 228736 |
| 291 | Ga0307511_10001429 | 3300030521 | Bacteria | 25196 |
| 292 | Ga0265327_10000245 | 3300031251 | Bacteria | 108670 |
| 293 | Ga0265327_10068468 | 3300031251 | Bacteria | 1785 |
| 294 | Ga0307513_10093409 | 3300031456 | Bacteria | 3058 |
| 295 | Ga0307509_10058624 | 3300031507 | Bacteria | 4076 |
| 296 | Ga0307509_10084770 | 3300031507 | Bacteria | 3263 |
| 297 | Ga0307509_10184280 | 3300031507 | Bacteria | 1948 |
| 298 | Ga0307509_10189587 | 3300031507 | Bacteria | 1909 |
| 299 | Ga0307508_10002012 | 3300031616 | Bacteria | 22143 |
| 300 | Ga0307508_10108242 | 3300031616 | Bacteria | 2379 |
| 301 | Ga0307516_10003848 | 3300031730 | Bacteria | 18983 |
| 302 | Ga0307414_10007878 | 3300032004 | Bacteria | 6010 |
| 303 | Ga0307510_10071891 | 3300033180 | Bacteria | 3440 |
| 304 | Ga0307510_10264132 | 3300033180 | Bacteria | 1201 |
| 305 | Ga0373931_0191827 | 3300035691 | Unclassified | 1216 |
| 306 | Ga0373935_0123084 | 3300035692 | Bacteria | 1735 |
| 307 | Ga0373927_0099965 | 3300035695 | Bacteria | 1886 |
| 308 | Ga0373925_0216048 | 3300037068 | Bacteria | 1529 |
| 309 | Ga0436365_0142833 | 3300039437 | Unclassified | 2324 |
| 310 | Ga0436365_1081651 | 3300039437 | Bacteria | 12424 |
| 311 | Ga0439436_0041398 | 3300041404 | Bacteria | 1318 |
| 312 | Ga0439439_0014095 | 3300041406 | Bacteria | 1943 |
| 313 | Ga0451802_0124700 | 3300041460 | Bacteria | 1431 |
| 314 | Ga0439449_0003119 | 3300042007 | Bacteria | 6454 |
| 315 | Ga0439457_000062 | 3300042014 | Bacteria | 23176 |
| 316 | Ga0439462_0002057 | 3300042015 | Bacteria | 4617 |
| 317 | Ga0466969_0000772 | 3300044656 | Bacteria | 17435 |
| 318 | Ga0466969_0042179 | 3300044656 | Bacteria | 2280 |
| 319 | Ga0466972_0000055 | 3300044658 | Bacteria | 111338 |
| 320 | Ga0466972_0000897 | 3300044658 | Bacteria | 14302 |
| 321 | Ga0466972_0012675 | 3300044658 | Bacteria | 4235 |
| 322 | Ga0466965_0110691 | 3300044683 | Bacteria | 1411 |
| 323 | Ga0466966_0000080 | 3300044684 | Bacteria | 60746 |
| 324 | Ga0466970_0024270 | 3300044765 | Bacteria | 3170 |
| 325 | Ga0466970_0094103 | 3300044765 | Unclassified | 1628 |
| 326 | Ga0466957_0002949 | 3300044842 | Bacteria | 9223 |
| 327 | Ga0466957_0012231 | 3300044842 | Bacteria | 4968 |
| 328 | Ga0466957_0184453 | 3300044842 | Unclassified | 1364 |
| 329 | Ga0466959_0000009 | 3300045049 | Bacteria | 176964 |
| 330 | Ga0466959_0051659 | 3300045049 | Bacteria | 3014 |
| 331 | Ga0466958_0075077 | 3300045836 | Bacteria | 2073 |
| 332 | Ga0495638_0000003 | 3300046460 | Bacteria | 888792 |
| 333 | Ga0495638_0021426 | 3300046460 | Bacteria | 4260 |
| 334 | Ga0495638_0041874 | 3300046460 | Bacteria | 2895 |
| 335 | Ga0495638_0124145 | 3300046460 | Bacteria | 1523 |
| 336 | Ga0495606_0004940 | 3300046507 | Bacteria | 13040 |
| 337 | Ga0495648_0011249 | 3300046524 | Bacteria | 6756 |
| 338 | Ga0495622_0096363 | 3300046557 | Bacteria | 1358 |
| 339 | Ga0495668_0000521 | 3300046616 | Bacteria | 47898 |
| 340 | Ga0495668_0010666 | 3300046616 | Bacteria | 5553 |
| 341 | Ga0495611_0000828 | 3300046648 | Bacteria | 17074 |
| 342 | Ga0495611_0011673 | 3300046648 | Bacteria | 3727 |
| 343 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 344 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 345 | Ga0496101_0270199 | 3300048904 | Bacteria | 1327 |
| 346 | Ga0501037_0056250 | 3300049573 | Bacteria | 2874 |
| 347 | Ga0501043_0157196 | 3300049579 | Bacteria | 1778 |
| 348 | Ga0501047_0030619 | 3300049581 | Bacteria | 5187 |
| 349 | Ga0501047_0180841 | 3300049581 | Bacteria | 1975 |
| 350 | Ga0501048_0083566 | 3300049582 | Bacteria | 2252 |
| 351 | Ga0501219_000291 | 3300049703 | Bacteria | 8885 |
| 352 | Ga0501225_0024879 | 3300049705 | Bacteria | 1648 |
| 353 | Ga0501035_0135363 | 3300049822 | Bacteria | 2146 |
| 354 | Ga0501044_0070002 | 3300049823 | Bacteria | 3570 |
| 355 | Ga0501284_00098 | 3300050005 | Bacteria | 18256 |
| 356 | nmdc:mga0k408_40713_c1 | 3300050493 | Bacteria | 2674 |
| 357 | nmdc:mga05p37_13803_c1 | 3300050507 | Bacteria | 9679 |
| 358 | nmdc:mga05p37_72139_c1 | 3300050507 | Bacteria | 4248 |
| 359 | nmdc:mga06r32_60578_c1 | 3300050510 | Bacteria | 3643 |
| 360 | nmdc:mga08y16_50116_c1 | 3300050511 | Bacteria | 4369 |
| 361 | Ga0500578_0000218 | 3300053086 | Bacteria | 71049 |
| 362 | Ga0500578_0083274 | 3300053086 | Bacteria | 2033 |
| 363 | Ga0500646_0013116 | 3300053090 | Bacteria | 2145 |
| 364 | Ga0500646_0019375 | 3300053090 | Bacteria | 1800 |
| 365 | Ga0500583_0000325 | 3300053092 | Bacteria | 16030 |
| 366 | Ga0500583_0001274 | 3300053092 | Bacteria | 7200 |
| 367 | Ga0500557_001627 | 3300053105 | Bacteria | 3771 |
| 368 | Ga0500577_0077296 | 3300053142 | Bacteria | 1320 |
| 369 | Ga0500588_0008063 | 3300053146 | Bacteria | 2447 |
| 370 | Ga0500603_008993 | 3300053150 | Bacteria | 2230 |
| 371 | Ga0500616_0000007 | 3300053153 | Bacteria | 836875 |
| 372 | Ga0500616_0022897 | 3300053153 | Bacteria | 3486 |
| 373 | Ga0500622_0001882 | 3300053156 | Bacteria | 15851 |
| 374 | Ga0500622_0013853 | 3300053156 | Bacteria | 4343 |
| 375 | Ga0500622_0049659 | 3300053156 | Bacteria | 2163 |
| 376 | Ga0500627_0003294 | 3300053158 | Bacteria | 4975 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005834 | Ga0068851_10039662 | Ga0068851_100396623 | 275 |
| 2 | 3300006195 | Ga0075366_10047260 | Ga0075366_100472602 | 281 |
| 3 | 3300006353 | Ga0075370_10067601 | Ga0075370_100676012 | 281 |
| 4 | 3300025914 | Ga0207671_10001353 | Ga0207671_1000135323 | 281 |
| 5 | 3300031456 | Ga0307513_10093409 | Ga0307513_100934092 | 281 |
| 6 | 3300031507 | Ga0307509_10058624 | Ga0307509_100586242 | 281 |
| 7 | 3300031507 | Ga0307509_10189587 | Ga0307509_101895871 | 281 |
| 8 | 3300031616 | Ga0307508_10108242 | Ga0307508_101082422 | 281 |
| 9 | 3300013307 | Ga0157372_10000595 | Ga0157372_1000059532 | 282 |
| 10 | 3300025903 | Ga0207680_10054944 | Ga0207680_100549441 | 282 |
| 11 | 3300025914 | Ga0207671_10040735 | Ga0207671_100407352 | 282 |
| 12 | 3300025949 | Ga0207667_10209367 | Ga0207667_102093671 | 282 |
| 13 | 3300044683 | Ga0466965_0110691 | Ga0466965_0110691_407_1258 | 283 |
| 14 | 3300005355 | Ga0070671_100006498 | Ga0070671_1000064987 | 284 |
| 15 | 3300005367 | Ga0070667_100048411 | Ga0070667_1000484111 | 284 |
| 16 | 3300005456 | Ga0070678_100037742 | Ga0070678_1000377422 | 284 |
| 17 | 3300006237 | Ga0097621_100000224 | Ga0097621_1000002248 | 284 |
| 18 | 3300006358 | Ga0068871_100000949 | Ga0068871_1000009497 | 284 |
| 19 | 3300013297 | Ga0157378_10011188 | Ga0157378_100111883 | 284 |
| 20 | 3300013308 | Ga0157375_10028423 | Ga0157375_100284235 | 284 |
| 21 | 3300014968 | Ga0157379_10089706 | Ga0157379_100897062 | 284 |
| 22 | 3300014969 | Ga0157376_10029184 | Ga0157376_100291843 | 284 |
| 23 | 3300017792 | Ga0163161_10003964 | Ga0163161_100039647 | 284 |
| 24 | 3300025931 | Ga0207644_10056915 | Ga0207644_100569152 | 284 |
| 25 | 3300025986 | Ga0207658_10047033 | Ga0207658_100470334 | 284 |
| 26 | 3300048904 | Ga0496101_0270199 | Ga0496101_0270199_56_937 | 284 |
| 27 | 3300003323 | rootH1_10026687 | rootH1_100266876 | 285 |
| 28 | 3300053158 | Ga0500627_0003294 | Ga0500627_0003294_2967_3824 | 285 |
| 29 | iso_pu_bacteria | 2881955468 | 2881956693 | 285 |
| 30 | 3300035691 | Ga0373931_0191827 | Ga0373931_0191827_22_891 | 289 |
| 31 | 3300035692 | Ga0373935_0123084 | Ga0373935_0123084_281_1150 | 289 |
| 32 | iso_pu_bacteria | 2738541278 | 2738731110 | 290 |
| 33 | iso_pu_bacteria | 2818991444 | 2819586844 | 290 |
| 34 | 3300003323 | rootH1_10083389 | rootH1_100833891 | 291 |
| 35 | 3300005617 | Ga0068859_100001090 | Ga0068859_1000010907 | 291 |
| 36 | 3300006931 | Ga0097620_100001090 | Ga0097620_1000010907 | 291 |
| 37 | 3300031251 | Ga0265327_10000245 | Ga0265327_1000024510 | 291 |
| 38 | 3300046460 | Ga0495638_0000003 | Ga0495638_0000003_251020_251895 | 291 |
| 39 | 3300046557 | Ga0495622_0096363 | Ga0495622_0096363_80_958 | 291 |
| 40 | 3300053090 | Ga0500646_0013116 | Ga0500646_0013116_565_1443 | 291 |
| 41 | 3300053105 | Ga0500557_001627 | Ga0500557_001627_1167_2042 | 291 |
| 42 | 3300053153 | Ga0500616_0000007 | Ga0500616_0000007_534390_535265 | 291 |
| 43 | 3300053156 | Ga0500622_0049659 | Ga0500622_0049659_821_1696 | 291 |
| 44 | 3300005331 | Ga0070670_100045712 | Ga0070670_1000457122 | 292 |
| 45 | 3300005456 | Ga0070678_100040099 | Ga0070678_1000400992 | 292 |
| 46 | 3300005466 | Ga0070685_10238681 | Ga0070685_102386811 | 292 |
| 47 | 3300005539 | Ga0068853_100020972 | Ga0068853_1000209724 | 292 |
| 48 | 3300025923 | Ga0207681_10226249 | Ga0207681_102262491 | 292 |
| 49 | 3300025940 | Ga0207691_10388811 | Ga0207691_103888111 | 292 |
| 50 | 3300025960 | Ga0207651_10164154 | Ga0207651_101641542 | 292 |
| 51 | 3300026041 | Ga0207639_10015187 | Ga0207639_100151874 | 292 |
| 52 | 3300026095 | Ga0207676_10367233 | Ga0207676_103672332 | 292 |
| 53 | 3300026121 | Ga0207683_10022620 | Ga0207683_100226203 | 292 |
| 54 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002207 | 292 |
| 55 | 3300032004 | Ga0307414_10007878 | Ga0307414_100078786 | 292 |
| 56 | 3300039437 | Ga0436365_0142833 | Ga0436365_0142833_498_1376 | 292 |
| 57 | 3300003320 | rootH2_10009673 | rootH2_1000967354 | 293 |
| 58 | 3300003320 | rootH2_10011544 | rootH2_100115447 | 293 |
| 59 | 3300005334 | Ga0068869_100003911 | Ga0068869_1000039116 | 293 |
| 60 | 3300005335 | Ga0070666_10000051 | Ga0070666_1000005177 | 293 |
| 61 | 3300005340 | Ga0070689_100205372 | Ga0070689_1002053721 | 293 |
| 62 | 3300005355 | Ga0070671_100127187 | Ga0070671_1001271871 | 293 |
| 63 | 3300005455 | Ga0070663_100235182 | Ga0070663_1002351821 | 293 |
| 64 | 3300005459 | Ga0068867_100041921 | Ga0068867_1000419215 | 293 |
| 65 | 3300005535 | Ga0070684_100130335 | Ga0070684_1001303352 | 293 |
| 66 | 3300005543 | Ga0070672_100048784 | Ga0070672_1000487842 | 293 |
| 67 | 3300005563 | Ga0068855_100056686 | Ga0068855_1000566865 | 293 |
| 68 | 3300005564 | Ga0070664_100228687 | Ga0070664_1002286872 | 293 |
| 69 | 3300005577 | Ga0068857_100052292 | Ga0068857_1000522924 | 293 |
| 70 | 3300005578 | Ga0068854_100061809 | Ga0068854_1000618094 | 293 |
| 71 | 3300005614 | Ga0068856_100044663 | Ga0068856_1000446637 | 293 |
| 72 | 3300005616 | Ga0068852_100093867 | Ga0068852_1000938672 | 293 |
| 73 | 3300005616 | Ga0068852_100105428 | Ga0068852_1001054283 | 293 |
| 74 | 3300005617 | Ga0068859_100000023 | Ga0068859_100000023169 | 293 |
| 75 | 3300005618 | Ga0068864_100105170 | Ga0068864_1001051702 | 293 |
| 76 | 3300005618 | Ga0068864_100221370 | Ga0068864_1002213702 | 293 |
| 77 | 3300005618 | Ga0068864_100269909 | Ga0068864_1002699092 | 293 |
| 78 | 3300005834 | Ga0068851_10148657 | Ga0068851_101486572 | 293 |
| 79 | 3300005841 | Ga0068863_100008810 | Ga0068863_1000088107 | 293 |
| 80 | 3300005841 | Ga0068863_100350862 | Ga0068863_1003508621 | 293 |
| 81 | 3300005842 | Ga0068858_100039977 | Ga0068858_1000399772 | 293 |
| 82 | 3300006237 | Ga0097621_100015371 | Ga0097621_1000153712 | 293 |
| 83 | 3300006237 | Ga0097621_100098814 | Ga0097621_1000988142 | 293 |
| 84 | 3300006358 | Ga0068871_100034685 | Ga0068871_1000346852 | 293 |
| 85 | 3300006358 | Ga0068871_100268662 | Ga0068871_1002686622 | 293 |
| 86 | 3300006881 | Ga0068865_100105007 | Ga0068865_1001050072 | 293 |
| 87 | 3300006931 | Ga0097620_100000023 | Ga0097620_100000023169 | 293 |
| 88 | 3300009093 | Ga0105240_10142997 | Ga0105240_101429972 | 293 |
| 89 | 3300009094 | Ga0111539_10538006 | Ga0111539_105380061 | 293 |
| 90 | 3300009098 | Ga0105245_10179425 | Ga0105245_101794252 | 293 |
| 91 | 3300009174 | Ga0105241_10000149 | Ga0105241_1000014915 | 293 |
| 92 | 3300009176 | Ga0105242_10270983 | Ga0105242_102709832 | 293 |
| 93 | 3300009545 | Ga0105237_10002490 | Ga0105237_100024904 | 293 |
| 94 | 3300009545 | Ga0105237_10013107 | Ga0105237_100131077 | 293 |
| 95 | 3300009553 | Ga0105249_10040349 | Ga0105249_100403495 | 293 |
| 96 | 3300010375 | Ga0105239_10000436 | Ga0105239_1000043664 | 293 |
| 97 | 3300013104 | Ga0157370_10007050 | Ga0157370_1000705012 | 293 |
| 98 | 3300013105 | Ga0157369_10082189 | Ga0157369_100821892 | 293 |
| 99 | 3300013105 | Ga0157369_10253160 | Ga0157369_102531602 | 293 |
| 100 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001423 | 293 |
| 101 | 3300013296 | Ga0157374_10131393 | Ga0157374_101313932 | 293 |
| 102 | 3300013296 | Ga0157374_10149783 | Ga0157374_101497832 | 293 |
| 103 | 3300013296 | Ga0157374_10190308 | Ga0157374_101903082 | 293 |
| 104 | 3300013297 | Ga0157378_10018627 | Ga0157378_100186273 | 293 |
| 105 | 3300013297 | Ga0157378_10037967 | Ga0157378_100379672 | 293 |
| 106 | 3300013297 | Ga0157378_10067327 | Ga0157378_100673272 | 293 |
| 107 | 3300013297 | Ga0157378_10668195 | Ga0157378_106681951 | 293 |
| 108 | 3300013306 | Ga0163162_10000161 | Ga0163162_1000016144 | 293 |
| 109 | 3300013306 | Ga0163162_10006168 | Ga0163162_100061685 | 293 |
| 110 | 3300013306 | Ga0163162_10323479 | Ga0163162_103234792 | 293 |
| 111 | 3300013306 | Ga0163162_10325041 | Ga0163162_103250412 | 293 |
| 112 | 3300013307 | Ga0157372_10223345 | Ga0157372_102233452 | 293 |
| 113 | 3300013308 | Ga0157375_10008904 | Ga0157375_100089043 | 293 |
| 114 | 3300013308 | Ga0157375_10068335 | Ga0157375_100683354 | 293 |
| 115 | 3300013308 | Ga0157375_10196750 | Ga0157375_101967502 | 293 |
| 116 | 3300014326 | Ga0157380_10013873 | Ga0157380_100138732 | 293 |
| 117 | 3300014968 | Ga0157379_10264758 | Ga0157379_102647582 | 293 |
| 118 | 3300014969 | Ga0157376_10004691 | Ga0157376_100046912 | 293 |
| 119 | 3300014969 | Ga0157376_10027137 | Ga0157376_100271372 | 293 |
| 120 | 3300017792 | Ga0163161_10312134 | Ga0163161_103121341 | 293 |
| 121 | 3300021384 | Ga0213876_10030088 | Ga0213876_100300883 | 293 |
| 122 | 3300025321 | Ga0207656_10024010 | Ga0207656_100240102 | 293 |
| 123 | 3300025903 | Ga0207680_10000053 | Ga0207680_1000005339 | 293 |
| 124 | 3300025904 | Ga0207647_10004651 | Ga0207647_100046517 | 293 |
| 125 | 3300025904 | Ga0207647_10190283 | Ga0207647_101902832 | 293 |
| 126 | 3300025914 | Ga0207671_10003092 | Ga0207671_100030922 | 293 |
| 127 | 3300025931 | Ga0207644_10043341 | Ga0207644_100433412 | 293 |
| 128 | 3300025936 | Ga0207670_10144436 | Ga0207670_101444361 | 293 |
| 129 | 3300025937 | Ga0207669_10151040 | Ga0207669_101510402 | 293 |
| 130 | 3300025940 | Ga0207691_10068545 | Ga0207691_100685452 | 293 |
| 131 | 3300025942 | Ga0207689_10003009 | Ga0207689_100030094 | 293 |
| 132 | 3300025960 | Ga0207651_10164037 | Ga0207651_101640372 | 293 |
| 133 | 3300025972 | Ga0207668_10269968 | Ga0207668_102699682 | 293 |
| 134 | 3300026023 | Ga0207677_10027793 | Ga0207677_100277932 | 293 |
| 135 | 3300026041 | Ga0207639_10063766 | Ga0207639_100637661 | 293 |
| 136 | 3300026078 | Ga0207702_10234350 | Ga0207702_102343502 | 293 |
| 137 | 3300026088 | Ga0207641_10000202 | Ga0207641_1000020229 | 293 |
| 138 | 3300026088 | Ga0207641_10007365 | Ga0207641_100073652 | 293 |
| 139 | 3300026089 | Ga0207648_10077258 | Ga0207648_100772581 | 293 |
| 140 | 3300026089 | Ga0207648_10324983 | Ga0207648_103249832 | 293 |
| 141 | 3300026116 | Ga0207674_10044961 | Ga0207674_100449613 | 293 |
| 142 | 3300026121 | Ga0207683_10551893 | Ga0207683_105518931 | 293 |
| 143 | 3300028794 | Ga0307515_10000076 | Ga0307515_10000076179 | 293 |
| 144 | 3300030521 | Ga0307511_10001429 | Ga0307511_1000142914 | 293 |
| 145 | 3300031251 | Ga0265327_10068468 | Ga0265327_100684682 | 293 |
| 146 | 3300031507 | Ga0307509_10184280 | Ga0307509_101842802 | 293 |
| 147 | 3300039437 | Ga0436365_1081651 | Ga0436365_1081651_11023_11904 | 293 |
| 148 | 3300044656 | Ga0466969_0042179 | Ga0466969_0042179_1265_2146 | 293 |
| 149 | 3300044842 | Ga0466957_0184453 | Ga0466957_0184453_200_1081 | 293 |
| 150 | 3300045049 | Ga0466959_0051659 | Ga0466959_0051659_2040_2921 | 293 |
| 151 | 3300045836 | Ga0466958_0075077 | Ga0466958_0075077_875_1756 | 293 |
| 152 | 3300046460 | Ga0495638_0021426 | Ga0495638_0021426_1608_2489 | 293 |
| 153 | 3300046616 | Ga0495668_0010666 | Ga0495668_0010666_192_1073 | 293 |
| 154 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_211592_212473 | 293 |
| 155 | 3300049573 | Ga0501037_0056250 | Ga0501037_0056250_1039_1923 | 293 |
| 156 | 3300049703 | Ga0501219_000291 | Ga0501219_000291_1483_2364 | 293 |
| 157 | 3300050005 | Ga0501284_00098 | Ga0501284_00098_10663_11544 | 293 |
| 158 | 3300053153 | Ga0500616_0022897 | Ga0500616_0022897_1907_2788 | 293 |
| 159 | 3300001979 | JGI24740J21852_10009956 | JGI24740J21852_100099563 | 294 |
| 160 | 3300003316 | rootH1_10066443 | rootH1_100664432 | 294 |
| 161 | 3300003320 | rootH2_10163639 | rootH2_101636391 | 294 |
| 162 | 3300003320 | rootH2_10292035 | rootH2_102920352 | 294 |
| 163 | 3300003323 | rootH1_10006250 | rootH1_1000625014 | 294 |
| 164 | 3300003323 | rootH1_10116719 | rootH1_101167193 | 294 |
| 165 | 3300003323 | rootH1_10171050 | rootH1_101710503 | 294 |
| 166 | 3300003354 | JGI25160J50197_1019690 | JGI25160J50197_10196902 | 294 |
| 167 | 3300005329 | Ga0070683_100006190 | Ga0070683_1000061909 | 294 |
| 168 | 3300005333 | Ga0070677_10147202 | Ga0070677_101472022 | 294 |
| 169 | 3300005354 | Ga0070675_100574627 | Ga0070675_1005746271 | 294 |
| 170 | 3300005356 | Ga0070674_100194533 | Ga0070674_1001945332 | 294 |
| 171 | 3300005456 | Ga0070678_100265187 | Ga0070678_1002651871 | 294 |
| 172 | 3300005459 | Ga0068867_100007399 | Ga0068867_1000073995 | 294 |
| 173 | 3300005471 | Ga0070698_100146652 | Ga0070698_1001466522 | 294 |
| 174 | 3300005535 | Ga0070684_100009306 | Ga0070684_1000093064 | 294 |
| 175 | 3300005539 | Ga0068853_100000862 | Ga0068853_10000086213 | 294 |
| 176 | 3300005539 | Ga0068853_100174155 | Ga0068853_1001741552 | 294 |
| 177 | 3300005543 | Ga0070672_100231851 | Ga0070672_1002318512 | 294 |
| 178 | 3300005563 | Ga0068855_100001333 | Ga0068855_1000013333 | 294 |
| 179 | 3300005616 | Ga0068852_100102353 | Ga0068852_1001023532 | 294 |
| 180 | 3300005616 | Ga0068852_100221885 | Ga0068852_1002218852 | 294 |
| 181 | 3300005616 | Ga0068852_100505316 | Ga0068852_1005053161 | 294 |
| 182 | 3300005840 | Ga0068870_10094113 | Ga0068870_100941133 | 294 |
| 183 | 3300005843 | Ga0068860_100151644 | Ga0068860_1001516442 | 294 |
| 184 | 3300006237 | Ga0097621_100365608 | Ga0097621_1003656082 | 294 |
| 185 | 3300009093 | Ga0105240_10000208 | Ga0105240_1000020883 | 294 |
| 186 | 3300009093 | Ga0105240_10001904 | Ga0105240_1000190432 | 294 |
| 187 | 3300009093 | Ga0105240_10068793 | Ga0105240_100687932 | 294 |
| 188 | 3300009545 | Ga0105237_10001017 | Ga0105237_1000101724 | 294 |
| 189 | 3300009545 | Ga0105237_10003181 | Ga0105237_100031818 | 294 |
| 190 | 3300009545 | Ga0105237_10226240 | Ga0105237_102262402 | 294 |
| 191 | 3300009551 | Ga0105238_10119098 | Ga0105238_101190982 | 294 |
| 192 | 3300010375 | Ga0105239_10024007 | Ga0105239_100240074 | 294 |
| 193 | 3300010375 | Ga0105239_10046834 | Ga0105239_100468342 | 294 |
| 194 | 3300010375 | Ga0105239_10128102 | Ga0105239_101281022 | 294 |
| 195 | 3300010375 | Ga0105239_10425250 | Ga0105239_104252501 | 294 |
| 196 | 3300013100 | Ga0157373_10224607 | Ga0157373_102246072 | 294 |
| 197 | 3300013105 | Ga0157369_10100633 | Ga0157369_101006332 | 294 |
| 198 | 3300013306 | Ga0163162_10013253 | Ga0163162_100132534 | 294 |
| 199 | 3300013306 | Ga0163162_10014326 | Ga0163162_100143268 | 294 |
| 200 | 3300013307 | Ga0157372_10075797 | Ga0157372_100757972 | 294 |
| 201 | 3300014325 | Ga0163163_10062217 | Ga0163163_100622172 | 294 |
| 202 | 3300025302 | Ga0207426_1000189 | Ga0207426_100018955 | 294 |
| 203 | 3300025904 | Ga0207647_10104362 | Ga0207647_101043622 | 294 |
| 204 | 3300025909 | Ga0207705_10171707 | Ga0207705_101717072 | 294 |
| 205 | 3300025913 | Ga0207695_10000076 | Ga0207695_100000763 | 294 |
| 206 | 3300025913 | Ga0207695_10000084 | Ga0207695_100000843 | 294 |
| 207 | 3300025913 | Ga0207695_10000090 | Ga0207695_100000903 | 294 |
| 208 | 3300025913 | Ga0207695_10000257 | Ga0207695_100002572 | 294 |
| 209 | 3300025914 | Ga0207671_10032225 | Ga0207671_100322253 | 294 |
| 210 | 3300025938 | Ga0207704_10058062 | Ga0207704_100580621 | 294 |
| 211 | 3300025940 | Ga0207691_10231772 | Ga0207691_102317722 | 294 |
| 212 | 3300025944 | Ga0207661_10016699 | Ga0207661_100166993 | 294 |
| 213 | 3300025949 | Ga0207667_10000911 | Ga0207667_100009118 | 294 |
| 214 | 3300026041 | Ga0207639_10006147 | Ga0207639_100061473 | 294 |
| 215 | 3300026121 | Ga0207683_10542958 | Ga0207683_105429581 | 294 |
| 216 | 3300026142 | Ga0207698_10312775 | Ga0207698_103127752 | 294 |
| 217 | 3300028786 | Ga0307517_10198040 | Ga0307517_101980402 | 294 |
| 218 | 3300031507 | Ga0307509_10084770 | Ga0307509_100847703 | 294 |
| 219 | 3300031616 | Ga0307508_10002012 | Ga0307508_100020125 | 294 |
| 220 | 3300031730 | Ga0307516_10003848 | Ga0307516_100038485 | 294 |
| 221 | 3300033180 | Ga0307510_10071891 | Ga0307510_100718912 | 294 |
| 222 | 3300035695 | Ga0373927_0099965 | Ga0373927_0099965_510_1394 | 294 |
| 223 | 3300037068 | Ga0373925_0216048 | Ga0373925_0216048_78_962 | 294 |
| 224 | 3300041404 | Ga0439436_0041398 | Ga0439436_0041398_368_1252 | 294 |
| 225 | 3300041406 | Ga0439439_0014095 | Ga0439439_0014095_170_1054 | 294 |
| 226 | 3300041460 | Ga0451802_0124700 | Ga0451802_0124700_201_1085 | 294 |
| 227 | 3300042007 | Ga0439449_0003119 | Ga0439449_0003119_604_1488 | 294 |
| 228 | 3300042014 | Ga0439457_000062 | Ga0439457_000062_2521_3405 | 294 |
| 229 | 3300042015 | Ga0439462_0002057 | Ga0439462_0002057_1688_2572 | 294 |
| 230 | 3300044658 | Ga0466972_0000055 | Ga0466972_0000055_91035_91919 | 294 |
| 231 | 3300044658 | Ga0466972_0000897 | Ga0466972_0000897_11120_12004 | 294 |
| 232 | 3300044658 | Ga0466972_0012675 | Ga0466972_0012675_2604_3488 | 294 |
| 233 | 3300044765 | Ga0466970_0024270 | Ga0466970_0024270_2093_2977 | 294 |
| 234 | 3300044765 | Ga0466970_0094103 | Ga0466970_0094103_78_962 | 294 |
| 235 | 3300044842 | Ga0466957_0012231 | Ga0466957_0012231_2254_3138 | 294 |
| 236 | 3300046460 | Ga0495638_0124145 | Ga0495638_0124145_322_1206 | 294 |
| 237 | 3300046507 | Ga0495606_0004940 | Ga0495606_0004940_2297_3181 | 294 |
| 238 | 3300046648 | Ga0495611_0000828 | Ga0495611_0000828_14677_15561 | 294 |
| 239 | 3300049581 | Ga0501047_0180841 | Ga0501047_0180841_825_1709 | 294 |
| 240 | 3300049822 | Ga0501035_0135363 | Ga0501035_0135363_202_1086 | 294 |
| 241 | 3300050493 | nmdc:mga0k408_40713_c1 | nmdc:mga0k408_40713_c1_1084_1968 | 294 |
| 242 | 3300053086 | Ga0500578_0000218 | Ga0500578_0000218_57242_58126 | 294 |
| 243 | 3300053086 | Ga0500578_0083274 | Ga0500578_0083274_417_1301 | 294 |
| 244 | 3300053090 | Ga0500646_0019375 | Ga0500646_0019375_718_1602 | 294 |
| 245 | 3300053092 | Ga0500583_0000325 | Ga0500583_0000325_10344_11228 | 294 |
| 246 | 3300053142 | Ga0500577_0077296 | Ga0500577_0077296_115_999 | 294 |
| 247 | 3300053146 | Ga0500588_0008063 | Ga0500588_0008063_1338_2222 | 294 |
| 248 | 3300053150 | Ga0500603_008993 | Ga0500603_008993_343_1227 | 294 |
| 249 | 3300053156 | Ga0500622_0013853 | Ga0500622_0013853_519_1403 | 294 |
| 250 | 3300003316 | rootH1_10030077 | rootH1_100300772 | 295 |
| 251 | 3300005331 | Ga0070670_100099800 | Ga0070670_1000998002 | 295 |
| 252 | 3300005335 | Ga0070666_10072706 | Ga0070666_100727063 | 295 |
| 253 | 3300005338 | Ga0068868_100248679 | Ga0068868_1002486792 | 295 |
| 254 | 3300005344 | Ga0070661_100060093 | Ga0070661_1000600931 | 295 |
| 255 | 3300005364 | Ga0070673_100175404 | Ga0070673_1001754042 | 295 |
| 256 | 3300005458 | Ga0070681_10029175 | Ga0070681_100291753 | 295 |
| 257 | 3300005535 | Ga0070684_100070750 | Ga0070684_1000707503 | 295 |
| 258 | 3300005539 | Ga0068853_100274539 | Ga0068853_1002745392 | 295 |
| 259 | 3300005543 | Ga0070672_100242297 | Ga0070672_1002422972 | 295 |
| 260 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001446 | 295 |
| 261 | 3300005564 | Ga0070664_100003626 | Ga0070664_1000036262 | 295 |
| 262 | 3300005614 | Ga0068856_100089724 | Ga0068856_1000897244 | 295 |
| 263 | 3300005834 | Ga0068851_10204813 | Ga0068851_102048132 | 295 |
| 264 | 3300005843 | Ga0068860_100000097 | Ga0068860_10000009719 | 295 |
| 265 | 3300005843 | Ga0068860_100017799 | Ga0068860_1000177995 | 295 |
| 266 | 3300009093 | Ga0105240_10063236 | Ga0105240_100632364 | 295 |
| 267 | 3300009147 | Ga0114129_10014118 | Ga0114129_1001411810 | 295 |
| 268 | 3300009545 | Ga0105237_10062999 | Ga0105237_100629994 | 295 |
| 269 | 3300009545 | Ga0105237_10235665 | Ga0105237_102356652 | 295 |
| 270 | 3300009551 | Ga0105238_10086837 | Ga0105238_100868373 | 295 |
| 271 | 3300010375 | Ga0105239_10038167 | Ga0105239_100381673 | 295 |
| 272 | 3300013102 | Ga0157371_10023195 | Ga0157371_100231953 | 295 |
| 273 | 3300013306 | Ga0163162_10002183 | Ga0163162_1000218310 | 295 |
| 274 | 3300013307 | Ga0157372_10326599 | Ga0157372_103265992 | 295 |
| 275 | 3300013307 | Ga0157372_10351316 | Ga0157372_103513162 | 295 |
| 276 | 3300014325 | Ga0163163_10004599 | Ga0163163_1000459912 | 295 |
| 277 | 3300025912 | Ga0207707_10022898 | Ga0207707_100228982 | 295 |
| 278 | 3300025913 | Ga0207695_10002714 | Ga0207695_100027142 | 295 |
| 279 | 3300025914 | Ga0207671_10020465 | Ga0207671_100204653 | 295 |
| 280 | 3300025914 | Ga0207671_10033064 | Ga0207671_100330644 | 295 |
| 281 | 3300025914 | Ga0207671_10101819 | Ga0207671_101018192 | 295 |
| 282 | 3300025920 | Ga0207649_10071041 | Ga0207649_100710412 | 295 |
| 283 | 3300025925 | Ga0207650_10047355 | Ga0207650_100473553 | 295 |
| 284 | 3300025925 | Ga0207650_10132137 | Ga0207650_101321372 | 295 |
| 285 | 3300025931 | Ga0207644_10282168 | Ga0207644_102821682 | 295 |
| 286 | 3300025945 | Ga0207679_10135816 | Ga0207679_101358162 | 295 |
| 287 | 3300025949 | Ga0207667_10029268 | Ga0207667_100292681 | 295 |
| 288 | 3300025960 | Ga0207651_10488085 | Ga0207651_104880852 | 295 |
| 289 | 3300026078 | Ga0207702_10079696 | Ga0207702_100796964 | 295 |
| 290 | 3300026142 | Ga0207698_10375427 | Ga0207698_103754272 | 295 |
| 291 | 3300028379 | Ga0268266_10000038 | Ga0268266_10000038193 | 295 |
| 292 | 3300028381 | Ga0268264_10000525 | Ga0268264_1000052519 | 295 |
| 293 | 3300028381 | Ga0268264_10006805 | Ga0268264_100068057 | 295 |
| 294 | 3300033180 | Ga0307510_10264132 | Ga0307510_102641321 | 295 |
| 295 | 3300044842 | Ga0466957_0002949 | Ga0466957_0002949_4527_5414 | 295 |
| 296 | 3300046460 | Ga0495638_0041874 | Ga0495638_0041874_917_1804 | 295 |
| 297 | 3300046524 | Ga0495648_0011249 | Ga0495648_0011249_5167_6054 | 295 |
| 298 | 3300046648 | Ga0495611_0011673 | Ga0495611_0011673_541_1428 | 295 |
| 299 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_676129_677016 | 295 |
| 300 | 3300049579 | Ga0501043_0157196 | Ga0501043_0157196_63_950 | 295 |
| 301 | 3300049581 | Ga0501047_0030619 | Ga0501047_0030619_4271_5158 | 295 |
| 302 | 3300049582 | Ga0501048_0083566 | Ga0501048_0083566_184_1071 | 295 |
| 303 | 3300049823 | Ga0501044_0070002 | Ga0501044_0070002_364_1251 | 295 |
| 304 | 3300050507 | nmdc:mga05p37_13803_c1 | nmdc:mga05p37_13803_c1_610_1497 | 295 |
| 305 | 3300053092 | Ga0500583_0001274 | Ga0500583_0001274_1333_2220 | 295 |
| 306 | 3300053156 | Ga0500622_0001882 | Ga0500622_0001882_1329_2216 | 295 |
| 307 | 3300003323 | rootH1_10152618 | rootH1_101526184 | 296 |
| 308 | 3300010375 | Ga0105239_10091008 | Ga0105239_100910083 | 296 |
| 309 | 3300028786 | Ga0307517_10039167 | Ga0307517_100391674 | 296 |
| 310 | 3300044656 | Ga0466969_0000772 | Ga0466969_0000772_12797_13717 | 296 |
| 311 | 3300044684 | Ga0466966_0000080 | Ga0466966_0000080_13243_14163 | 296 |
| 312 | 3300045049 | Ga0466959_0000009 | Ga0466959_0000009_102844_103764 | 296 |
| 313 | 3300046616 | Ga0495668_0000521 | Ga0495668_0000521_5026_5919 | 297 |
| 314 | 3300005563 | Ga0068855_100033416 | Ga0068855_1000334164 | 298 |
| 315 | 3300009093 | Ga0105240_10003887 | Ga0105240_100038875 | 298 |
| 316 | 3300025913 | Ga0207695_10007357 | Ga0207695_100073577 | 298 |
| 317 | 3300049705 | Ga0501225_0024879 | Ga0501225_0024879_433_1329 | 298 |
| 318 | 3300003203 | JGI25406J46586_10018717 | JGI25406J46586_100187172 | 301 |
| 319 | 3300005985 | Ga0081539_10000893 | Ga0081539_1000089354 | 301 |
| 320 | 3300005329 | Ga0070683_100011657 | Ga0070683_1000116579 | 302 |
| 321 | 3300005330 | Ga0070690_100083926 | Ga0070690_1000839261 | 302 |
| 322 | 3300005335 | Ga0070666_10010924 | Ga0070666_100109243 | 302 |
| 323 | 3300005337 | Ga0070682_100002757 | Ga0070682_1000027575 | 302 |
| 324 | 3300005338 | Ga0068868_100010578 | Ga0068868_1000105786 | 302 |
| 325 | 3300005339 | Ga0070660_100010871 | Ga0070660_1000108716 | 302 |
| 326 | 3300005344 | Ga0070661_100255985 | Ga0070661_1002559852 | 302 |
| 327 | 3300005354 | Ga0070675_100039045 | Ga0070675_1000390453 | 302 |
| 328 | 3300005355 | Ga0070671_100157795 | Ga0070671_1001577952 | 302 |
| 329 | 3300005364 | Ga0070673_100040924 | Ga0070673_1000409243 | 302 |
| 330 | 3300005366 | Ga0070659_100004288 | Ga0070659_10000428811 | 302 |
| 331 | 3300005367 | Ga0070667_100348583 | Ga0070667_1003485832 | 302 |
| 332 | 3300005456 | Ga0070678_100216475 | Ga0070678_1002164752 | 302 |
| 333 | 3300005458 | Ga0070681_10071962 | Ga0070681_100719621 | 302 |
| 334 | 3300005530 | Ga0070679_100099285 | Ga0070679_1000992852 | 302 |
| 335 | 3300005535 | Ga0070684_100044075 | Ga0070684_1000440753 | 302 |
| 336 | 3300005539 | Ga0068853_100318855 | Ga0068853_1003188552 | 302 |
| 337 | 3300005563 | Ga0068855_100120093 | Ga0068855_1001200932 | 302 |
| 338 | 3300005564 | Ga0070664_100039014 | Ga0070664_1000390144 | 302 |
| 339 | 3300005577 | Ga0068857_100122568 | Ga0068857_1001225681 | 302 |
| 340 | 3300005578 | Ga0068854_100102957 | Ga0068854_1001029572 | 302 |
| 341 | 3300005614 | Ga0068856_100026002 | Ga0068856_1000260027 | 302 |
| 342 | 3300005616 | Ga0068852_100181146 | Ga0068852_1001811462 | 302 |
| 343 | 3300005618 | Ga0068864_100109347 | Ga0068864_1001093472 | 302 |
| 344 | 3300006237 | Ga0097621_100010422 | Ga0097621_1000104222 | 302 |
| 345 | 3300006358 | Ga0068871_100027174 | Ga0068871_1000271742 | 302 |
| 346 | 3300013100 | Ga0157373_10001117 | Ga0157373_1000111716 | 302 |
| 347 | 3300013104 | Ga0157370_10127449 | Ga0157370_101274491 | 302 |
| 348 | 3300013105 | Ga0157369_10003748 | Ga0157369_1000374816 | 302 |
| 349 | 3300013296 | Ga0157374_10010111 | Ga0157374_100101115 | 302 |
| 350 | 3300013297 | Ga0157378_10014671 | Ga0157378_100146711 | 302 |
| 351 | 3300013307 | Ga0157372_10215184 | Ga0157372_102151842 | 302 |
| 352 | 3300013307 | Ga0157372_10438954 | Ga0157372_104389542 | 302 |
| 353 | 3300014745 | Ga0157377_10147494 | Ga0157377_101474942 | 302 |
| 354 | 3300025321 | Ga0207656_10020256 | Ga0207656_100202562 | 302 |
| 355 | 3300025903 | Ga0207680_10014833 | Ga0207680_100148335 | 302 |
| 356 | 3300025917 | Ga0207660_10108983 | Ga0207660_101089832 | 302 |
| 357 | 3300025919 | Ga0207657_10001494 | Ga0207657_1000149416 | 302 |
| 358 | 3300025920 | Ga0207649_10362236 | Ga0207649_103622361 | 302 |
| 359 | 3300025926 | Ga0207659_10121334 | Ga0207659_101213342 | 302 |
| 360 | 3300025931 | Ga0207644_10076675 | Ga0207644_100766753 | 302 |
| 361 | 3300025933 | Ga0207706_10006153 | Ga0207706_100061532 | 302 |
| 362 | 3300025944 | Ga0207661_10054907 | Ga0207661_100549072 | 302 |
| 363 | 3300025945 | Ga0207679_10013083 | Ga0207679_100130833 | 302 |
| 364 | 3300025949 | Ga0207667_10035976 | Ga0207667_100359762 | 302 |
| 365 | 3300025960 | Ga0207651_10021947 | Ga0207651_100219472 | 302 |
| 366 | 3300025981 | Ga0207640_10035618 | Ga0207640_100356182 | 302 |
| 367 | 3300025986 | Ga0207658_10434181 | Ga0207658_104341811 | 302 |
| 368 | 3300026041 | Ga0207639_10027360 | Ga0207639_100273605 | 302 |
| 369 | 3300026078 | Ga0207702_10106670 | Ga0207702_101066703 | 302 |
| 370 | 3300026088 | Ga0207641_10517825 | Ga0207641_105178251 | 302 |
| 371 | 3300026116 | Ga0207674_10081181 | Ga0207674_100811814 | 302 |
| 372 | 3300026121 | Ga0207683_10311581 | Ga0207683_103115812 | 302 |
| 373 | 3300026142 | Ga0207698_10037620 | Ga0207698_100376202 | 302 |
| 374 | 2162886011 | MRS1b_contig_5483801 | MRS1b_0939.00000980 | 307 |
| 375 | 3300005290 | Ga0065712_10096572 | Ga0065712_100965722 | 307 |
| 376 | 3300005354 | Ga0070675_100009535 | Ga0070675_1000095356 | 307 |
| 377 | 3300050507 | nmdc:mga05p37_72139_c1 | nmdc:mga05p37_72139_c1_1806_2732 | 307 |
| 378 | 3300050510 | nmdc:mga06r32_60578_c1 | nmdc:mga06r32_60578_c1_48_974 | 307 |
| 379 | 3300050511 | nmdc:mga08y16_50116_c1 | nmdc:mga08y16_50116_c1_484_1413 | 307 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mqh-assembly1.cif.gz_A | crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei | 0.9629 | 7 | 292 |
| 3flu-assembly1.cif.gz_B | crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis | 0.9627 | 7 | 292 |
| 3noe-assembly1.cif.gz_A | crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa | 0.9624 | 7 | 292 |
| 3qze-assembly2.cif.gz_D | crystal structure of dapa (pa1010) at 1.6 a resolution | 0.961 | 7 | 292 |
| 6p90-assembly1.cif.gz_B | crystal structure of padhdps2-h56q mutant | 0.9603 | 7 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2yxgD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9595 | 7 | 293 | 3.20.20.70 |
| 6nvaA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9586 | 4 | 292 | 3.20.20.70 |
| 3pb2D00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9545 | 3 | 294 | 3.20.20.70 |
| 2rfgB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9528 | 8 | 299 | 3.20.20.70 |
| 3a5fA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9507 | 8 | 295 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3V431-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) | 0.9804 | 3 | 236 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |
| AF-E4M8I6-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) | 0.9788 | 3 | 293 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |
| AF-L1P4I3-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) | 0.9788 | 7 | 290 |
GO:0005829
GO:0008840 GO:0009089 GO:0019877 |
| AF-A3XRN1-F1-model_v4 | Putative dihydrodipicolinate synthase | 0.9784 | 191 | 293 |
GO:0005829
GO:0008840 |
| AF-A0A838TPX4-F1-model_v4 | N-acetylneuraminate lyase (EC 4.1.3.3) | 0.9783 | 1 | 120 |
GO:0005829
GO:0008747 GO:0019262 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar