F428228

General Info

Members Datasets Scaffolds Average Seq Length
379 161 379 194

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10000005|JGI24737J22298_1000000522
Length 234
Sequence LNREPRFDDYIEKAAPFAQPILKHVRERVHAVVPHVEEAMKWSAPGFTLDGKILLIMAAFKQHAALNFWRGQEIGDGEAKAGAMGQFGKLTSIDNLPPDDELDALIREAAELAKTAPAPRKTKHEXXXAPTLHPEFAAALAKVPKAKAALDGFPPGAQRDYFEWISEAKQDATRQKRISTAIEWLAEGKRRHWKYQNCXSASASSGYPVQSGSAPRLRXRTRNSRRSAWPADWR

Samples

Sample ID Description Type Environment
1 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.85
Rhizosphere 98.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1011118 3300001978 Bacteria 908
2 JGI24740J21852_10001215 3300001979 Bacteria 11649
3 JGI24740J21852_10007755 3300001979 Bacteria 4337
4 JGI24740J21852_10039991 3300001979 Bacteria 1425
5 JGI24739J22299_10000084 3300001989 Bacteria 26964
6 JGI24739J22299_10006623 3300001989 Bacteria 4363
7 JGI24737J22298_10000005 3300001990 Bacteria 65241
8 JGI24737J22298_10001034 3300001990 Bacteria 9851
9 JGI24745J21846_1003096 3300002073 Bacteria 1726
10 JGI24738J21930_10000170 3300002075 Bacteria 16595
11 Ga0070658_10005858 3300005327 Bacteria 9966
12 Ga0070658_10031304 3300005327 Bacteria 4272
13 Ga0070658_10031730 3300005327 Bacteria 4244
14 Ga0070676_10047706 3300005328 Bacteria 2502
15 Ga0070683_100002263 3300005329 Bacteria 15247
16 Ga0070683_100164383 3300005329 Bacteria 2106
17 Ga0070690_100041108 3300005330 Bacteria 2926
18 Ga0070690_100120653 3300005330 Bacteria 1759
19 Ga0070670_100004136 3300005331 Bacteria 12125
20 Ga0070670_100049007 3300005331 Bacteria 3634
21 Ga0070670_100215767 3300005331 Bacteria 1669
22 Ga0068869_100000003 3300005334 Bacteria 136262
23 Ga0070666_10001518 3300005335 Bacteria 14090
24 Ga0070666_10157419 3300005335 Bacteria 1587
25 Ga0070680_100070926 3300005336 Bacteria 2862
26 Ga0070682_100006410 3300005337 Bacteria 6610
27 Ga0068868_100210937 3300005338 Bacteria 1623
28 Ga0070660_100001342 3300005339 Bacteria 16720
29 Ga0070660_100018067 3300005339 Bacteria 5146
30 Ga0070660_100047663 3300005339 Bacteria 3289
31 Ga0070660_100078210 3300005339 Bacteria 2594
32 Ga0070660_100209659 3300005339 Unclassified 1581
33 Ga0070660_100605652 3300005339 Unclassified 916
34 Ga0070689_100007203 3300005340 Bacteria 7754
35 Ga0070661_100000079 3300005344 Bacteria 77180
36 Ga0070692_10013457 3300005345 Bacteria 3815
37 Ga0070668_100065623 3300005347 Bacteria 2816
38 Ga0070669_100000381 3300005353 Bacteria 33945
39 Ga0070669_100113662 3300005353 Bacteria 2057
40 Ga0070669_100167290 3300005353 Bacteria 1712
41 Ga0070675_100063711 3300005354 Bacteria 3048
42 Ga0070675_100089518 3300005354 Bacteria 2577
43 Ga0070671_100013054 3300005355 Bacteria 6695
44 Ga0070671_100013403 3300005355 Bacteria 6609
45 Ga0070671_100016685 3300005355 Bacteria 5938
46 Ga0070671_100156502 3300005355 Bacteria 1925
47 Ga0070674_100143458 3300005356 Bacteria 1795
48 Ga0070673_100000077 3300005364 Bacteria 41919
49 Ga0070673_100132290 3300005364 Bacteria 2095
50 Ga0070673_100548267 3300005364 Unclassified 1050
51 Ga0070659_100000165 3300005366 Bacteria 51041
52 Ga0070659_100000220 3300005366 Bacteria 44199
53 Ga0070659_100114519 3300005366 Bacteria 2179
54 Ga0070659_100157334 3300005366 Unclassified 1856
55 Ga0070667_100001626 3300005367 Bacteria 20121
56 Ga0070667_100012545 3300005367 Bacteria 7008
57 Ga0070663_100008899 3300005455 Bacteria 6198
58 Ga0070663_100150305 3300005455 Bacteria 1785
59 Ga0070663_100302749 3300005455 Bacteria 1280
60 Ga0070678_100000975 3300005456 Bacteria 14782
61 Ga0070678_100052637 3300005456 Bacteria 2957
62 Ga0070662_100000171 3300005457 Bacteria 37981
63 Ga0070662_100000215 3300005457 Bacteria 33867
64 Ga0070662_100017840 3300005457 Bacteria 4789
65 Ga0070662_100020997 3300005457 Bacteria 4454
66 Ga0070662_100093167 3300005457 Bacteria 2266
67 Ga0070681_10296915 3300005458 Unclassified 1525
68 Ga0070681_10335294 3300005458 Bacteria 1422
69 Ga0068867_100000115 3300005459 Bacteria 50713
70 Ga0068867_100072495 3300005459 Bacteria 2578
71 Ga0068867_100651466 3300005459 Bacteria 924
72 Ga0070679_100419572 3300005530 Bacteria 1283
73 Ga0068853_100000316 3300005539 Bacteria 33719
74 Ga0068853_100009057 3300005539 Bacteria 8015
75 Ga0070672_100000336 3300005543 Bacteria 26949
76 Ga0070672_100189799 3300005543 Bacteria 1715
77 Ga0070693_100000563 3300005547 Bacteria 16421
78 Ga0070665_100001642 3300005548 Bacteria 25770
79 Ga0070665_100042586 3300005548 Bacteria 4564
80 Ga0070665_100049452 3300005548 Bacteria 4218
81 Ga0070665_100562710 3300005548 Unclassified 1153
82 Ga0068855_100000447 3300005563 Bacteria 51000
83 Ga0068855_100003513 3300005563 Bacteria 19177
84 Ga0068855_100147510 3300005563 Unclassified 2677
85 Ga0068855_100292843 3300005563 Bacteria 1804
86 Ga0070664_100000311 3300005564 Bacteria 35468
87 Ga0070664_100033363 3300005564 Bacteria 4312
88 Ga0070664_100049662 3300005564 Bacteria 3548
89 Ga0070664_100686052 3300005564 Bacteria 953
90 Ga0068857_100000026 3300005577 Bacteria 83525
91 Ga0068857_100146195 3300005577 Bacteria 2139
92 Ga0068857_100490531 3300005577 Bacteria 1152
93 Ga0068854_100000320 3300005578 Bacteria 31598
94 Ga0068854_100013639 3300005578 Bacteria 5341
95 Ga0068854_100562333 3300005578 Bacteria 969
96 Ga0068856_100000979 3300005614 Bacteria 30480
97 Ga0068856_100364911 3300005614 Bacteria 1463
98 Ga0068856_100385709 3300005614 Bacteria 1421
99 Ga0068852_100003556 3300005616 Bacteria 10908
100 Ga0068852_100004133 3300005616 Bacteria 10220
101 Ga0068852_100060939 3300005616 Bacteria 3277
102 Ga0068852_100214487 3300005616 Bacteria 1828
103 Ga0068852_100223658 3300005616 Bacteria 1791
104 Ga0068864_100000047 3300005618 Bacteria 150798
105 Ga0068864_100047157 3300005618 Bacteria 3700
106 Ga0068864_100305204 3300005618 Bacteria 1491
107 Ga0068861_100086293 3300005719 Bacteria 2467
108 Ga0068851_10022859 3300005834 Bacteria 3051
109 Ga0068851_10137886 3300005834 Bacteria 1324
110 Ga0068863_100000484 3300005841 Bacteria 40697
111 Ga0068863_100107580 3300005841 Bacteria 2654
112 Ga0068863_100424657 3300005841 Bacteria 1302
113 Ga0068863_101112960 3300005841 Bacteria 794
114 Ga0068858_100003246 3300005842 Bacteria 16210
115 Ga0068858_100035111 3300005842 Bacteria 4650
116 Ga0068860_100005960 3300005843 Bacteria 12260
117 Ga0068862_100185518 3300005844 Bacteria 1869
118 Ga0068862_100649312 3300005844 Bacteria 1018
119 Ga0097621_100060001 3300006237 Bacteria 3116
120 Ga0068871_100015720 3300006358 Bacteria 5677
121 Ga0068865_100001643 3300006881 Bacteria 13102
122 Ga0068865_100079798 3300006881 Bacteria 2345
123 Ga0105245_10000062 3300009098 Bacteria 115179
124 Ga0105243_10616774 3300009148 Bacteria 1046
125 Ga0105241_10015388 3300009174 Bacteria 5602
126 Ga0105241_10023854 3300009174 Bacteria 4539
127 Ga0105248_10000117 3300009177 Bacteria 90169
128 Ga0105248_10003791 3300009177 Bacteria 16748
129 Ga0105248_10452904 3300009177 Bacteria 1446
130 Ga0105238_10022775 3300009551 Bacteria 6385
131 Ga0105238_10067883 3300009551 Bacteria 3567
132 Ga0105239_10122624 3300010375 Bacteria 2888
133 Ga0105239_10569724 3300010375 Bacteria 1290
134 Ga0105246_10017038 3300011119 Bacteria 4614
135 Ga0157373_10007219 3300013100 Bacteria 8286
136 Ga0157373_10098768 3300013100 Bacteria 2055
137 Ga0157373_10172649 3300013100 Bacteria 1521
138 Ga0157373_10285372 3300013100 Unclassified 1170
139 Ga0157373_10305559 3300013100 Bacteria 1129
140 Ga0157373_10487945 3300013100 Bacteria 889
141 Ga0157373_10814648 3300013100 Bacteria 689
142 Ga0157371_10000144 3300013102 Bacteria 103512
143 Ga0157371_10007113 3300013102 Bacteria 9092
144 Ga0157371_10028626 3300013102 Bacteria 4032
145 Ga0157371_10092570 3300013102 Bacteria 2142
146 Ga0157371_10095324 3300013102 Bacteria 2109
147 Ga0157371_10137225 3300013102 Bacteria 1742
148 Ga0157370_10016501 3300013104 Bacteria 7472
149 Ga0157370_10110570 3300013104 Unclassified 2569
150 Ga0157370_10759894 3300013104 Bacteria 883
151 Ga0157369_10075205 3300013105 Bacteria 3622
152 Ga0157369_10130902 3300013105 Bacteria 2659
153 Ga0157369_10803045 3300013105 Unclassified 967
154 Ga0157374_10088143 3300013296 Bacteria 2955
155 Ga0157378_10002137 3300013297 Bacteria 17555
156 Ga0163162_10106846 3300013306 Bacteria 2894
157 Ga0157372_10116014 3300013307 Bacteria 3070
158 Ga0157372_10670432 3300013307 Bacteria 1207
159 Ga0157375_10191946 3300013308 Bacteria 2197
160 Ga0157375_10324296 3300013308 Bacteria 1705
161 Ga0163163_10000380 3300014325 Bacteria 42243
162 Ga0206353_10684851 3300020082 Bacteria 1817
163 Ga0207697_10000328 3300025315 Bacteria 26559
164 Ga0207656_10069076 3300025321 Bacteria 1567
165 Ga0207682_10014912 3300025893 Bacteria 3026
166 Ga0207682_10027252 3300025893 Bacteria 2274
167 Ga0207682_10123193 3300025893 Bacteria 1151
168 Ga0207688_10000019 3300025901 Bacteria 51361
169 Ga0207680_10018140 3300025903 Bacteria 3734
170 Ga0207680_10046653 3300025903 Bacteria 2562
171 Ga0207680_10177217 3300025903 Bacteria 1439
172 Ga0207647_10000822 3300025904 Bacteria 24109
173 Ga0207647_10028522 3300025904 Bacteria 3623
174 Ga0207645_10052730 3300025907 Bacteria 2599
175 Ga0207705_10000222 3300025909 Bacteria 56707
176 Ga0207705_10023703 3300025909 Bacteria 4379
177 Ga0207705_10151255 3300025909 Bacteria 1739
178 Ga0207705_10258489 3300025909 Bacteria 1329
179 Ga0207654_10019595 3300025911 Bacteria 3574
180 Ga0207654_10026755 3300025911 Bacteria 3127
181 Ga0207707_10086271 3300025912 Bacteria 2743
182 Ga0207693_10132074 3300025915 Bacteria 1963
183 Ga0207660_10160822 3300025917 Bacteria 1732
184 Ga0207657_10000378 3300025919 Bacteria 47118
185 Ga0207657_10002521 3300025919 Bacteria 19807
186 Ga0207657_10004541 3300025919 Bacteria 14664
187 Ga0207657_10029706 3300025919 Bacteria 4971
188 Ga0207657_10057870 3300025919 Bacteria 3339
189 Ga0207657_10597725 3300025919 Unclassified 861
190 Ga0207649_10000135 3300025920 Bacteria 63197
191 Ga0207649_10131194 3300025920 Bacteria 1702
192 Ga0207649_10666168 3300025920 Unclassified 805
193 Ga0207652_10094886 3300025921 Bacteria 2627
194 Ga0207652_10159332 3300025921 Bacteria 2023
195 Ga0207652_10827232 3300025921 Bacteria 821
196 Ga0207681_10000489 3300025923 Bacteria 27719
197 Ga0207681_10212421 3300025923 Bacteria 1492
198 Ga0207694_10154558 3300025924 Bacteria 1850
199 Ga0207650_10004793 3300025925 Bacteria 9244
200 Ga0207650_10014807 3300025925 Bacteria 5423
201 Ga0207650_10063243 3300025925 Bacteria 2767
202 Ga0207650_10153103 3300025925 Bacteria 1821
203 Ga0207659_10114612 3300025926 Bacteria 2055
204 Ga0207659_10126240 3300025926 Bacteria 1968
205 Ga0207687_10000424 3300025927 Bacteria 28651
206 Ga0207664_10111340 3300025929 Bacteria 2277
207 Ga0207644_10000495 3300025931 Bacteria 25321
208 Ga0207644_10013887 3300025931 Bacteria 5380
209 Ga0207644_10014702 3300025931 Bacteria 5245
210 Ga0207690_10000509 3300025932 Bacteria 25193
211 Ga0207690_10184777 3300025932 Unclassified 1572
212 Ga0207690_10367743 3300025932 Bacteria 1140
213 Ga0207690_10467227 3300025932 Bacteria 1016
214 Ga0207690_10581764 3300025932 Bacteria 913
215 Ga0207706_10000020 3300025933 Bacteria 162063
216 Ga0207706_10000513 3300025933 Bacteria 41181
217 Ga0207706_10012530 3300025933 Bacteria 7723
218 Ga0207706_10018244 3300025933 Bacteria 6314
219 Ga0207706_10079434 3300025933 Bacteria 2885
220 Ga0207706_10276125 3300025933 Bacteria 1466
221 Ga0207686_10121474 3300025934 Bacteria 1779
222 Ga0207670_10281977 3300025936 Bacteria 1295
223 Ga0207669_10032659 3300025937 Bacteria 2926
224 Ga0207669_10250804 3300025937 Bacteria 1318
225 Ga0207669_10385522 3300025937 Bacteria 1093
226 Ga0207704_10093784 3300025938 Bacteria 1980
227 Ga0207691_10000047 3300025940 Bacteria 99519
228 Ga0207691_10055188 3300025940 Bacteria 3622
229 Ga0207691_10152262 3300025940 Unclassified 2033
230 Ga0207691_10211247 3300025940 Bacteria 1685
231 Ga0207711_10000558 3300025941 Bacteria 37953
232 Ga0207711_10007486 3300025941 Bacteria 9132
233 Ga0207689_10000002 3300025942 Bacteria 198437
234 Ga0207661_10017032 3300025944 Bacteria 5368
235 Ga0207679_10000460 3300025945 Bacteria 28726
236 Ga0207679_10308856 3300025945 Unclassified 1366
237 Ga0207679_10809783 3300025945 Bacteria 854
238 Ga0207667_10001204 3300025949 Bacteria 32354
239 Ga0207667_10099756 3300025949 Bacteria 2996
240 Ga0207667_10257859 3300025949 Bacteria 1783
241 Ga0207667_10434397 3300025949 Bacteria 1335
242 Ga0207667_10494856 3300025949 Bacteria 1240
243 Ga0207651_10000387 3300025960 Bacteria 18790
244 Ga0207651_10394098 3300025960 Bacteria 1176
245 Ga0207651_10681762 3300025960 Unclassified 904
246 Ga0207668_10043239 3300025972 Bacteria 3056
247 Ga0207668_10084211 3300025972 Bacteria 2316
248 Ga0207640_10006259 3300025981 Bacteria 6526
249 Ga0207640_10009697 3300025981 Bacteria 5400
250 Ga0207640_10437483 3300025981 Bacteria 1074
251 Ga0207658_10033797 3300025986 Bacteria 3649
252 Ga0207658_10228203 3300025986 Bacteria 1570
253 Ga0207658_10291518 3300025986 Bacteria 1402
254 Ga0207677_10002499 3300026023 Bacteria 9646
255 Ga0207677_10241191 3300026023 Bacteria 1462
256 Ga0207677_10691253 3300026023 Bacteria 904
257 Ga0207703_10028409 3300026035 Bacteria 4409
258 Ga0207703_10028423 3300026035 Bacteria 4408
259 Ga0207639_10011598 3300026041 Bacteria 6124
260 Ga0207639_10016940 3300026041 Bacteria 5163
261 Ga0207639_10793112 3300026041 Bacteria 882
262 Ga0207639_10919988 3300026041 Bacteria 818
263 Ga0207678_10000879 3300026067 Bacteria 27621
264 Ga0207678_10007682 3300026067 Bacteria 9524
265 Ga0207678_10193582 3300026067 Bacteria 1738
266 Ga0207678_10724498 3300026067 Bacteria 876
267 Ga0207702_10001066 3300026078 Bacteria 28071
268 Ga0207702_10238294 3300026078 Bacteria 1703
269 Ga0207641_10071176 3300026088 Bacteria 2990
270 Ga0207641_10151085 3300026088 Bacteria 2103
271 Ga0207641_10208672 3300026088 Bacteria 1805
272 Ga0207648_10002019 3300026089 Bacteria 22153
273 Ga0207648_10198872 3300026089 Bacteria 1777
274 Ga0207648_10230472 3300026089 Bacteria 1647
275 Ga0207648_10684878 3300026089 Bacteria 949
276 Ga0207676_10007306 3300026095 Bacteria 7832
277 Ga0207676_10511731 3300026095 Bacteria 1141
278 Ga0207674_10002120 3300026116 Bacteria 25085
279 Ga0207674_10003128 3300026116 Bacteria 20417
280 Ga0207674_10003428 3300026116 Bacteria 19410
281 Ga0207674_10253803 3300026116 Bacteria 1705
282 Ga0207674_10834885 3300026116 Bacteria 889
283 Ga0207683_10006670 3300026121 Bacteria 9877
284 Ga0207683_10230333 3300026121 Bacteria 1690
285 Ga0207698_10000675 3300026142 Bacteria 19796
286 Ga0207698_10009531 3300026142 Bacteria 6197
287 Ga0207698_10396186 3300026142 Bacteria 1318
288 Ga0268266_10000256 3300028379 Bacteria 89436
289 Ga0268266_10003320 3300028379 Bacteria 16145
290 Ga0268266_10021362 3300028379 Bacteria 5514
291 Ga0268266_10152938 3300028379 Bacteria 2081
292 Ga0268266_10600505 3300028379 Unclassified 1057
293 Ga0268265_10023775 3300028380 Bacteria 4325
294 Ga0268265_10165579 3300028380 Bacteria 1884
295 Ga0268264_10025243 3300028381 Bacteria 4854
296 Ga0307408_100148376 3300031548 Bacteria 1849
297 Ga0307408_100257847 3300031548 Bacteria 1441
298 Ga0307405_10009268 3300031731 Bacteria 5038
299 Ga0307405_10088429 3300031731 Bacteria 2044
300 Ga0307405_10219458 3300031731 Bacteria 1394
301 Ga0307405_10384894 3300031731 Bacteria 1093
302 Ga0307413_10004530 3300031824 Bacteria 6059
303 Ga0307413_10054404 3300031824 Bacteria 2428
304 Ga0307413_10057228 3300031824 Bacteria 2383
305 Ga0307413_10360112 3300031824 Bacteria 1126
306 Ga0307413_10683702 3300031824 Bacteria 850
307 Ga0307410_10000938 3300031852 Bacteria 12506
308 Ga0307410_10002679 3300031852 Bacteria 8686
309 Ga0307410_10002846 3300031852 Bacteria 8506
310 Ga0307410_10147973 3300031852 Bacteria 1745
311 Ga0307407_10097068 3300031903 Bacteria 1820
312 Ga0307407_10243185 3300031903 Bacteria 1229
313 Ga0307412_10010674 3300031911 Bacteria 5294
314 Ga0307412_10235242 3300031911 Bacteria 1413
315 Ga0307412_10877813 3300031911 Bacteria 784
316 Ga0307409_100007093 3300031995 Bacteria 6670
317 Ga0307416_100005058 3300032002 Bacteria 8040
318 Ga0307416_100014342 3300032002 Bacteria 5427
319 Ga0307416_100033005 3300032002 Bacteria 3919
320 Ga0307416_100284964 3300032002 Bacteria 1631
321 Ga0307416_100707588 3300032002 Bacteria 1097
322 Ga0307414_10003436 3300032004 Bacteria 8451
323 Ga0307414_10043418 3300032004 Bacteria 3062
324 Ga0307414_10044479 3300032004 Bacteria 3033
325 Ga0307414_10328111 3300032004 Bacteria 1305
326 Ga0307414_10720886 3300032004 Bacteria 904
327 Ga0307411_10004374 3300032005 Bacteria 6756
328 Ga0307411_10005073 3300032005 Bacteria 6412
329 Ga0307411_10012563 3300032005 Bacteria 4629
330 Ga0307411_10074098 3300032005 Bacteria 2318
331 Ga0307411_10245588 3300032005 Bacteria 1404
332 Ga0307411_10340164 3300032005 Bacteria 1219
333 Ga0307415_100002188 3300032126 Bacteria 9684
334 Ga0307415_100021786 3300032126 Bacteria 3946
335 Ga0307415_100690116 3300032126 Bacteria 920
336 Ga0373932_0038465 3300035112 Bacteria 1368
337 Ga0373939_0065775 3300035114 Bacteria 1167
338 Ga0373960_0026007 3300035121 Bacteria 1596
339 Ga0373961_0021422 3300035241 Bacteria 1719
340 Ga0373931_0074441 3300035691 Bacteria 1860
341 Ga0395899_0020913 3300037312 Bacteria 4963
342 Ga0395899_0145216 3300037312 Bacteria 1685
343 Ga0395900_0079384 3300037418 Bacteria 3372
344 Ga0395900_0681730 3300037418 Bacteria 962
345 Ga0395898_0289989 3300037466 Bacteria 1561
346 Ga0395898_1073532 3300037466 Bacteria 739
347 Ga0395905_0007559 3300037471 Bacteria 10797
348 Ga0395905_0011136 3300037471 Bacteria 8698
349 Ga0395905_0027784 3300037471 Bacteria 5334
350 Ga0395905_0029219 3300037471 Bacteria 5196
351 Ga0395905_0029856 3300037471 Bacteria 5138
352 Ga0395905_0080514 3300037471 Bacteria 3052
353 Ga0395905_0259250 3300037471 Bacteria 1623
354 Ga0395905_0284029 3300037471 Bacteria 1541
355 Ga0395901_0068752 3300038443 Bacteria 3689
356 Ga0395901_0140279 3300038443 Bacteria 2540
357 Ga0395901_0147162 3300038443 Bacteria 2476
358 Ga0395901_0331438 3300038443 Bacteria 1573
359 Ga0395901_0814850 3300038443 Bacteria 921
360 Ga0466963_0039408 3300044694 Bacteria 3093
361 Ga0466963_0455108 3300044694 Bacteria 903
362 Ga0466957_0085185 3300044842 Bacteria 1974
363 Ga0451576_0562714 3300045051 Bacteria 1198
364 Ga0466958_0026099 3300045836 Bacteria 3451
365 Ga0466958_0031466 3300045836 Bacteria 3154
366 Ga0466967_0348307 3300045976 Bacteria 1433
367 Ga0466967_0413607 3300045976 Bacteria 1313
368 Ga0495621_0014652 3300046539 Bacteria 2486
369 Ga0495668_0043278 3300046616 Bacteria 2505
370 Ga0496104_0286805 3300048907 Bacteria 1559
371 Ga0496107_0264473 3300048910 Bacteria 1280
372 Ga0496108_0000229 3300048911 Bacteria 50203
373 Ga0496108_0265819 3300048911 Bacteria 1493
374 Ga0496109_0025022 3300048912 Bacteria 5315
375 Ga0496110_0257031 3300048913 Bacteria 1590
376 Ga0496112_0002632 3300048915 Bacteria 14504
377 Ga0501067_0104872 3300049583 Bacteria 1571
378 Ga0501070_0308218 3300049586 Bacteria 1289
379 Ga0501071_0238856 3300049587 Bacteria 1370

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100164383 Ga0070683_1001643832 157
2 3300005345 Ga0070692_10013457 Ga0070692_100134575 157
3 3300005366 Ga0070659_100114519 Ga0070659_1001145191 157
4 3300005577 Ga0068857_100490531 Ga0068857_1004905313 164
5 3300013105 Ga0157369_10075205 Ga0157369_100752054 164
6 3300026116 Ga0207674_10253803 Ga0207674_102538033 164
7 3300005327 Ga0070658_10031304 Ga0070658_100313043 165
8 3300005339 Ga0070660_100078210 Ga0070660_1000782103 165
9 3300037471 Ga0395905_0029856 Ga0395905_0029856_3787_4371 165
10 3300005614 Ga0068856_100364911 Ga0068856_1003649111 179
11 3300025949 Ga0207667_10494856 Ga0207667_104948562 180
12 3300005336 Ga0070680_100070926 Ga0070680_1000709263 183
13 3300005339 Ga0070660_100209659 Ga0070660_1002096593 183
14 3300005366 Ga0070659_100157334 Ga0070659_1001573343 183
15 3300013100 Ga0157373_10172649 Ga0157373_101726493 183
16 3300025917 Ga0207660_10160822 Ga0207660_101608223 183
17 3300025919 Ga0207657_10029706 Ga0207657_100297066 183
18 3300025921 Ga0207652_10094886 Ga0207652_100948862 183
19 3300025932 Ga0207690_10184777 Ga0207690_101847773 183
20 3300025932 Ga0207690_10000509 Ga0207690_100005098 186
21 3300001979 JGI24740J21852_10039991 JGI24740J21852_100399912 187
22 3300001989 JGI24739J22299_10006623 JGI24739J22299_100066235 187
23 3300001990 JGI24737J22298_10001034 JGI24737J22298_100010345 187
24 3300005327 Ga0070658_10005858 Ga0070658_100058585 187
25 3300005327 Ga0070658_10031730 Ga0070658_100317302 187
26 3300005329 Ga0070683_100002263 Ga0070683_10000226315 187
27 3300005330 Ga0070690_100120653 Ga0070690_1001206533 187
28 3300005331 Ga0070670_100049007 Ga0070670_1000490075 187
29 3300005335 Ga0070666_10001518 Ga0070666_100015185 187
30 3300005337 Ga0070682_100006410 Ga0070682_1000064107 187
31 3300005339 Ga0070660_100018067 Ga0070660_1000180678 187
32 3300005339 Ga0070660_100605652 Ga0070660_1006056522 187
33 3300005344 Ga0070661_100000079 Ga0070661_10000007983 187
34 3300005355 Ga0070671_100013403 Ga0070671_1000134037 187
35 3300005366 Ga0070659_100000165 Ga0070659_10000016538 187
36 3300005367 Ga0070667_100012545 Ga0070667_1000125455 187
37 3300005455 Ga0070663_100008899 Ga0070663_1000088995 187
38 3300005457 Ga0070662_100000171 Ga0070662_10000017123 187
39 3300005459 Ga0068867_100651466 Ga0068867_1006514662 187
40 3300005539 Ga0068853_100009057 Ga0068853_1000090577 187
41 3300005547 Ga0070693_100000563 Ga0070693_1000005632 187
42 3300005548 Ga0070665_100049452 Ga0070665_1000494522 187
43 3300005563 Ga0068855_100000447 Ga0068855_10000044738 187
44 3300005564 Ga0070664_100000311 Ga0070664_10000031119 187
45 3300005577 Ga0068857_100146195 Ga0068857_1001461953 187
46 3300005578 Ga0068854_100013639 Ga0068854_1000136395 187
47 3300005614 Ga0068856_100000979 Ga0068856_10000097919 187
48 3300005616 Ga0068852_100003556 Ga0068852_10000355611 187
49 3300005618 Ga0068864_100047157 Ga0068864_1000471574 187
50 3300005834 Ga0068851_10022859 Ga0068851_100228592 187
51 3300005841 Ga0068863_100107580 Ga0068863_1001075803 187
52 3300005842 Ga0068858_100035111 Ga0068858_1000351113 187
53 3300006237 Ga0097621_100060001 Ga0097621_1000600012 187
54 3300006358 Ga0068871_100015720 Ga0068871_1000157205 187
55 3300009174 Ga0105241_10023854 Ga0105241_100238543 187
56 3300009177 Ga0105248_10000117 Ga0105248_1000011782 187
57 3300013100 Ga0157373_10098768 Ga0157373_100987682 187
58 3300013102 Ga0157371_10007113 Ga0157371_100071133 187
59 3300013102 Ga0157371_10028626 Ga0157371_100286266 187
60 3300013104 Ga0157370_10110570 Ga0157370_101105701 187
61 3300013105 Ga0157369_10130902 Ga0157369_101309023 187
62 3300013105 Ga0157369_10803045 Ga0157369_108030452 187
63 3300013296 Ga0157374_10088143 Ga0157374_100881433 187
64 3300014325 Ga0163163_10000380 Ga0163163_1000038016 187
65 3300020082 Ga0206353_10684851 Ga0206353_106848513 187
66 3300025903 Ga0207680_10018140 Ga0207680_100181406 187
67 3300025904 Ga0207647_10028522 Ga0207647_100285223 187
68 3300025909 Ga0207705_10000222 Ga0207705_1000022223 187
69 3300025911 Ga0207654_10026755 Ga0207654_100267553 187
70 3300025919 Ga0207657_10000378 Ga0207657_1000037816 187
71 3300025919 Ga0207657_10597725 Ga0207657_105977252 187
72 3300025920 Ga0207649_10000135 Ga0207649_100001352 187
73 3300025925 Ga0207650_10063243 Ga0207650_100632433 187
74 3300025929 Ga0207664_10111340 Ga0207664_101113403 187
75 3300025931 Ga0207644_10013887 Ga0207644_100138874 187
76 3300025933 Ga0207706_10000513 Ga0207706_1000051332 187
77 3300025941 Ga0207711_10000558 Ga0207711_1000055824 187
78 3300025944 Ga0207661_10017032 Ga0207661_100170324 187
79 3300025945 Ga0207679_10000460 Ga0207679_1000046018 187
80 3300025949 Ga0207667_10001204 Ga0207667_100012042 187
81 3300025981 Ga0207640_10009697 Ga0207640_100096973 187
82 3300025986 Ga0207658_10033797 Ga0207658_100337975 187
83 3300026035 Ga0207703_10028423 Ga0207703_100284235 187
84 3300026041 Ga0207639_10011598 Ga0207639_100115985 187
85 3300026067 Ga0207678_10007682 Ga0207678_100076825 187
86 3300026078 Ga0207702_10001066 Ga0207702_1000106627 187
87 3300026088 Ga0207641_10208672 Ga0207641_102086721 187
88 3300026089 Ga0207648_10684878 Ga0207648_106848782 187
89 3300026095 Ga0207676_10511731 Ga0207676_105117312 187
90 3300026142 Ga0207698_10000675 Ga0207698_1000067511 187
91 3300028379 Ga0268266_10003320 Ga0268266_100033202 187
92 3300035112 Ga0373932_0038465 Ga0373932_0038465_599_1204 187
93 3300035114 Ga0373939_0065775 Ga0373939_0065775_152_757 187
94 3300035121 Ga0373960_0026007 Ga0373960_0026007_754_1359 187
95 3300035241 Ga0373961_0021422 Ga0373961_0021422_580_1185 187
96 3300035691 Ga0373931_0074441 Ga0373931_0074441_567_1172 187
97 3300048907 Ga0496104_0286805 Ga0496104_0286805_603_1208 187
98 3300048910 Ga0496107_0264473 Ga0496107_0264473_198_803 187
99 3300048913 Ga0496110_0257031 Ga0496110_0257031_88_693 187
100 3300005331 Ga0070670_100215767 Ga0070670_1002157673 188
101 3300005355 Ga0070671_100013054 Ga0070671_1000130546 188
102 3300005458 Ga0070681_10335294 Ga0070681_103352942 188
103 3300013104 Ga0157370_10016501 Ga0157370_100165017 188
104 3300031824 Ga0307413_10683702 Ga0307413_106837021 188
105 3300032004 Ga0307414_10328111 Ga0307414_103281112 188
106 3300032005 Ga0307411_10074098 Ga0307411_100740982 188
107 3300044694 Ga0466963_0455108 Ga0466963_0455108_151_747 188
108 3300009177 Ga0105248_10452904 Ga0105248_104529043 189
109 3300025921 Ga0207652_10159332 Ga0207652_101593323 189
110 3300037466 Ga0395898_1073532 Ga0395898_1073532_77_667 189
111 3300038443 Ga0395901_0147162 Ga0395901_0147162_559_1149 189
112 3300048915 Ga0496112_0002632 Ga0496112_0002632_8431_9027 189
113 3300005335 Ga0070666_10157419 Ga0070666_101574191 190
114 3300005355 Ga0070671_100016685 Ga0070671_1000166852 190
115 3300005364 Ga0070673_100132290 Ga0070673_1001322903 190
116 3300005456 Ga0070678_100000975 Ga0070678_10000097517 190
117 3300005457 Ga0070662_100017840 Ga0070662_1000178402 190
118 3300005459 Ga0068867_100072495 Ga0068867_1000724953 190
119 3300005548 Ga0070665_100001642 Ga0070665_10000164223 190
120 3300025931 Ga0207644_10000495 Ga0207644_1000049530 190
121 3300025933 Ga0207706_10079434 Ga0207706_100794343 190
122 3300025940 Ga0207691_10152262 Ga0207691_101522623 190
123 3300026089 Ga0207648_10198872 Ga0207648_101988722 190
124 3300026121 Ga0207683_10006670 Ga0207683_1000667010 190
125 3300028379 Ga0268266_10000256 Ga0268266_100002568 190
126 3300005841 Ga0068863_101112960 Ga0068863_1011129602 191
127 3300031731 Ga0307405_10219458 Ga0307405_102194582 191
128 3300031824 Ga0307413_10360112 Ga0307413_103601122 191
129 3300032002 Ga0307416_100005058 Ga0307416_1000050583 191
130 3300037312 Ga0395899_0145216 Ga0395899_0145216_873_1469 191
131 3300037471 Ga0395905_0259250 Ga0395905_0259250_1002_1598 191
132 3300045051 Ga0451576_0562714 Ga0451576_0562714_134_730 191
133 3300049583 Ga0501067_0104872 Ga0501067_0104872_271_867 191
134 3300049587 Ga0501071_0238856 Ga0501071_0238856_395_991 191
135 3300005339 Ga0070660_100047663 Ga0070660_1000476632 192
136 3300013100 Ga0157373_10487945 Ga0157373_104879452 192
137 3300013102 Ga0157371_10137225 Ga0157371_101372252 192
138 3300013104 Ga0157370_10759894 Ga0157370_107598942 192
139 3300025909 Ga0207705_10151255 Ga0207705_101512551 192
140 3300025915 Ga0207693_10132074 Ga0207693_101320743 192
141 3300025919 Ga0207657_10057870 Ga0207657_100578706 192
142 3300026041 Ga0207639_10919988 Ga0207639_109199882 192
143 3300026116 Ga0207674_10834885 Ga0207674_108348852 192
144 3300038443 Ga0395901_0814850 Ga0395901_0814850_138_734 192
145 3300005458 Ga0070681_10296915 Ga0070681_102969152 196
146 3300025912 Ga0207707_10086271 Ga0207707_100862713 196
147 3300026041 Ga0207639_10793112 Ga0207639_107931121 196
148 3300026078 Ga0207702_10238294 Ga0207702_102382943 196
149 3300037418 Ga0395900_0681730 Ga0395900_0681730_19_612 197
150 3300037471 Ga0395905_0027784 Ga0395905_0027784_1469_2062 197
151 3300001978 JGI24747J21853_1011118 JGI24747J21853_10111182 198
152 3300001979 JGI24740J21852_10001215 JGI24740J21852_1000121513 198
153 3300001979 JGI24740J21852_10007755 JGI24740J21852_100077555 198
154 3300001989 JGI24739J22299_10000084 JGI24739J22299_1000008420 198
155 3300001990 JGI24737J22298_10000005 JGI24737J22298_1000000522 198
156 3300002073 JGI24745J21846_1003096 JGI24745J21846_10030962 198
157 3300002075 JGI24738J21930_10000170 JGI24738J21930_1000017015 198
158 3300005328 Ga0070676_10047706 Ga0070676_100477063 198
159 3300005330 Ga0070690_100041108 Ga0070690_1000411081 198
160 3300005331 Ga0070670_100004136 Ga0070670_1000041363 198
161 3300005334 Ga0068869_100000003 Ga0068869_10000000372 198
162 3300005338 Ga0068868_100210937 Ga0068868_1002109373 198
163 3300005339 Ga0070660_100001342 Ga0070660_10000134216 198
164 3300005340 Ga0070689_100007203 Ga0070689_10000720313 198
165 3300005347 Ga0070668_100065623 Ga0070668_1000656233 198
166 3300005353 Ga0070669_100000381 Ga0070669_10000038121 198
167 3300005353 Ga0070669_100113662 Ga0070669_1001136622 198
168 3300005353 Ga0070669_100167290 Ga0070669_1001672903 198
169 3300005354 Ga0070675_100063711 Ga0070675_1000637113 198
170 3300005354 Ga0070675_100089518 Ga0070675_1000895184 198
171 3300005355 Ga0070671_100156502 Ga0070671_1001565022 198
172 3300005356 Ga0070674_100143458 Ga0070674_1001434583 198
173 3300005364 Ga0070673_100000077 Ga0070673_10000007720 198
174 3300005364 Ga0070673_100548267 Ga0070673_1005482672 198
175 3300005366 Ga0070659_100000220 Ga0070659_1000002203 198
176 3300005367 Ga0070667_100001626 Ga0070667_10000162622 198
177 3300005455 Ga0070663_100150305 Ga0070663_1001503052 198
178 3300005455 Ga0070663_100302749 Ga0070663_1003027493 198
179 3300005456 Ga0070678_100052637 Ga0070678_1000526373 198
180 3300005457 Ga0070662_100000215 Ga0070662_10000021518 198
181 3300005457 Ga0070662_100020997 Ga0070662_1000209973 198
182 3300005457 Ga0070662_100093167 Ga0070662_1000931673 198
183 3300005459 Ga0068867_100000115 Ga0068867_10000011517 198
184 3300005530 Ga0070679_100419572 Ga0070679_1004195721 198
185 3300005539 Ga0068853_100000316 Ga0068853_10000031619 198
186 3300005543 Ga0070672_100000336 Ga0070672_10000033615 198
187 3300005543 Ga0070672_100189799 Ga0070672_1001897993 198
188 3300005548 Ga0070665_100042586 Ga0070665_1000425863 198
189 3300005548 Ga0070665_100562710 Ga0070665_1005627102 198
190 3300005563 Ga0068855_100003513 Ga0068855_1000035139 198
191 3300005563 Ga0068855_100147510 Ga0068855_1001475104 198
192 3300005563 Ga0068855_100292843 Ga0068855_1002928433 198
193 3300005564 Ga0070664_100033363 Ga0070664_1000333631 198
194 3300005564 Ga0070664_100049662 Ga0070664_1000496623 198
195 3300005564 Ga0070664_100686052 Ga0070664_1006860522 198
196 3300005577 Ga0068857_100000026 Ga0068857_10000002614 198
197 3300005578 Ga0068854_100000320 Ga0068854_10000032020 198
198 3300005578 Ga0068854_100562333 Ga0068854_1005623332 198
199 3300005614 Ga0068856_100385709 Ga0068856_1003857092 198
200 3300005616 Ga0068852_100004133 Ga0068852_10000413313 198
201 3300005616 Ga0068852_100060939 Ga0068852_1000609392 198
202 3300005616 Ga0068852_100214487 Ga0068852_1002144872 198
203 3300005616 Ga0068852_100223658 Ga0068852_1002236583 198
204 3300005618 Ga0068864_100000047 Ga0068864_10000004784 198
205 3300005618 Ga0068864_100305204 Ga0068864_1003052042 198
206 3300005719 Ga0068861_100086293 Ga0068861_1000862933 198
207 3300005834 Ga0068851_10137886 Ga0068851_101378862 198
208 3300005841 Ga0068863_100000484 Ga0068863_10000048439 198
209 3300005841 Ga0068863_100424657 Ga0068863_1004246571 198
210 3300005842 Ga0068858_100003246 Ga0068858_10000324613 198
211 3300005843 Ga0068860_100005960 Ga0068860_10000596013 198
212 3300005844 Ga0068862_100185518 Ga0068862_1001855181 198
213 3300005844 Ga0068862_100649312 Ga0068862_1006493123 198
214 3300006881 Ga0068865_100001643 Ga0068865_1000016432 198
215 3300006881 Ga0068865_100079798 Ga0068865_1000797983 198
216 3300009098 Ga0105245_10000062 Ga0105245_10000062115 198
217 3300009148 Ga0105243_10616774 Ga0105243_106167743 198
218 3300009174 Ga0105241_10015388 Ga0105241_100153883 198
219 3300009177 Ga0105248_10003791 Ga0105248_100037917 198
220 3300009551 Ga0105238_10022775 Ga0105238_100227753 198
221 3300009551 Ga0105238_10067883 Ga0105238_100678835 198
222 3300010375 Ga0105239_10122624 Ga0105239_101226242 198
223 3300010375 Ga0105239_10569724 Ga0105239_105697242 198
224 3300011119 Ga0105246_10017038 Ga0105246_100170384 198
225 3300013100 Ga0157373_10007219 Ga0157373_100072199 198
226 3300013100 Ga0157373_10285372 Ga0157373_102853723 198
227 3300013100 Ga0157373_10305559 Ga0157373_103055592 198
228 3300013100 Ga0157373_10814648 Ga0157373_108146481 198
229 3300013102 Ga0157371_10000144 Ga0157371_1000014421 198
230 3300013102 Ga0157371_10092570 Ga0157371_100925704 198
231 3300013102 Ga0157371_10095324 Ga0157371_100953242 198
232 3300013297 Ga0157378_10002137 Ga0157378_1000213713 198
233 3300013306 Ga0163162_10106846 Ga0163162_101068464 198
234 3300013307 Ga0157372_10116014 Ga0157372_101160143 198
235 3300013307 Ga0157372_10670432 Ga0157372_106704321 198
236 3300013308 Ga0157375_10191946 Ga0157375_101919463 198
237 3300013308 Ga0157375_10324296 Ga0157375_103242963 198
238 3300025315 Ga0207697_10000328 Ga0207697_1000032818 198
239 3300025321 Ga0207656_10069076 Ga0207656_100690762 198
240 3300025893 Ga0207682_10014912 Ga0207682_100149124 198
241 3300025893 Ga0207682_10027252 Ga0207682_100272523 198
242 3300025893 Ga0207682_10123193 Ga0207682_101231933 198
243 3300025901 Ga0207688_10000019 Ga0207688_1000001940 198
244 3300025903 Ga0207680_10046653 Ga0207680_100466533 198
245 3300025903 Ga0207680_10177217 Ga0207680_101772173 198
246 3300025904 Ga0207647_10000822 Ga0207647_1000082222 198
247 3300025907 Ga0207645_10052730 Ga0207645_100527303 198
248 3300025909 Ga0207705_10023703 Ga0207705_100237037 198
249 3300025909 Ga0207705_10258489 Ga0207705_102584892 198
250 3300025911 Ga0207654_10019595 Ga0207654_100195954 198
251 3300025919 Ga0207657_10002521 Ga0207657_100025214 198
252 3300025919 Ga0207657_10004541 Ga0207657_1000454115 198
253 3300025920 Ga0207649_10131194 Ga0207649_101311942 198
254 3300025920 Ga0207649_10666168 Ga0207649_106661682 198
255 3300025921 Ga0207652_10827232 Ga0207652_108272321 198
256 3300025923 Ga0207681_10000489 Ga0207681_1000048919 198
257 3300025923 Ga0207681_10212421 Ga0207681_102124213 198
258 3300025924 Ga0207694_10154558 Ga0207694_101545582 198
259 3300025925 Ga0207650_10004793 Ga0207650_100047939 198
260 3300025925 Ga0207650_10014807 Ga0207650_100148073 198
261 3300025925 Ga0207650_10153103 Ga0207650_101531031 198
262 3300025926 Ga0207659_10114612 Ga0207659_101146123 198
263 3300025926 Ga0207659_10126240 Ga0207659_101262403 198
264 3300025927 Ga0207687_10000424 Ga0207687_1000042436 198
265 3300025931 Ga0207644_10014702 Ga0207644_100147022 198
266 3300025932 Ga0207690_10367743 Ga0207690_103677431 198
267 3300025932 Ga0207690_10467227 Ga0207690_104672272 198
268 3300025932 Ga0207690_10581764 Ga0207690_105817641 198
269 3300025933 Ga0207706_10000020 Ga0207706_1000002085 198
270 3300025933 Ga0207706_10012530 Ga0207706_100125304 198
271 3300025933 Ga0207706_10018244 Ga0207706_100182446 198
272 3300025933 Ga0207706_10276125 Ga0207706_102761251 198
273 3300025934 Ga0207686_10121474 Ga0207686_101214742 198
274 3300025936 Ga0207670_10281977 Ga0207670_102819772 198
275 3300025937 Ga0207669_10032659 Ga0207669_100326593 198
276 3300025937 Ga0207669_10250804 Ga0207669_102508042 198
277 3300025937 Ga0207669_10385522 Ga0207669_103855223 198
278 3300025938 Ga0207704_10093784 Ga0207704_100937843 198
279 3300025940 Ga0207691_10000047 Ga0207691_1000004798 198
280 3300025940 Ga0207691_10055188 Ga0207691_100551886 198
281 3300025940 Ga0207691_10211247 Ga0207691_102112472 198
282 3300025941 Ga0207711_10007486 Ga0207711_100074867 198
283 3300025942 Ga0207689_10000002 Ga0207689_1000000298 198
284 3300025945 Ga0207679_10308856 Ga0207679_103088563 198
285 3300025945 Ga0207679_10809783 Ga0207679_108097832 198
286 3300025949 Ga0207667_10099756 Ga0207667_100997562 198
287 3300025949 Ga0207667_10257859 Ga0207667_102578592 198
288 3300025949 Ga0207667_10434397 Ga0207667_104343973 198
289 3300025960 Ga0207651_10000387 Ga0207651_1000038721 198
290 3300025960 Ga0207651_10394098 Ga0207651_103940982 198
291 3300025960 Ga0207651_10681762 Ga0207651_106817622 198
292 3300025972 Ga0207668_10043239 Ga0207668_100432393 198
293 3300025972 Ga0207668_10084211 Ga0207668_100842114 198
294 3300025981 Ga0207640_10006259 Ga0207640_100062593 198
295 3300025981 Ga0207640_10437483 Ga0207640_104374832 198
296 3300025986 Ga0207658_10228203 Ga0207658_102282032 198
297 3300025986 Ga0207658_10291518 Ga0207658_102915181 198
298 3300026023 Ga0207677_10002499 Ga0207677_100024997 198
299 3300026023 Ga0207677_10241191 Ga0207677_102411913 198
300 3300026023 Ga0207677_10691253 Ga0207677_106912532 198
301 3300026035 Ga0207703_10028409 Ga0207703_100284093 198
302 3300026041 Ga0207639_10016940 Ga0207639_100169402 198
303 3300026067 Ga0207678_10000879 Ga0207678_1000087924 198
304 3300026067 Ga0207678_10193582 Ga0207678_101935822 198
305 3300026067 Ga0207678_10724498 Ga0207678_107244982 198
306 3300026088 Ga0207641_10071176 Ga0207641_100711763 198
307 3300026088 Ga0207641_10151085 Ga0207641_101510853 198
308 3300026089 Ga0207648_10002019 Ga0207648_1000201916 198
309 3300026089 Ga0207648_10230472 Ga0207648_102304723 198
310 3300026095 Ga0207676_10007306 Ga0207676_100073064 198
311 3300026116 Ga0207674_10002120 Ga0207674_100021205 198
312 3300026116 Ga0207674_10003128 Ga0207674_1000312814 198
313 3300026116 Ga0207674_10003428 Ga0207674_1000342813 198
314 3300026121 Ga0207683_10230333 Ga0207683_102303333 198
315 3300026142 Ga0207698_10009531 Ga0207698_100095313 198
316 3300026142 Ga0207698_10396186 Ga0207698_103961862 198
317 3300028379 Ga0268266_10021362 Ga0268266_100213623 198
318 3300028379 Ga0268266_10152938 Ga0268266_101529382 198
319 3300028379 Ga0268266_10600505 Ga0268266_106005051 198
320 3300028380 Ga0268265_10023775 Ga0268265_100237753 198
321 3300028380 Ga0268265_10165579 Ga0268265_101655792 198
322 3300028381 Ga0268264_10025243 Ga0268264_100252435 198
323 3300031548 Ga0307408_100148376 Ga0307408_1001483762 198
324 3300031548 Ga0307408_100257847 Ga0307408_1002578473 198
325 3300031731 Ga0307405_10009268 Ga0307405_100092682 198
326 3300031731 Ga0307405_10088429 Ga0307405_100884292 198
327 3300031731 Ga0307405_10384894 Ga0307405_103848942 198
328 3300031824 Ga0307413_10004530 Ga0307413_100045304 198
329 3300031824 Ga0307413_10054404 Ga0307413_100544042 198
330 3300031824 Ga0307413_10057228 Ga0307413_100572283 198
331 3300031852 Ga0307410_10000938 Ga0307410_100009383 198
332 3300031852 Ga0307410_10002679 Ga0307410_1000267913 198
333 3300031852 Ga0307410_10002846 Ga0307410_1000284610 198
334 3300031852 Ga0307410_10147973 Ga0307410_101479732 198
335 3300031903 Ga0307407_10097068 Ga0307407_100970681 198
336 3300031903 Ga0307407_10243185 Ga0307407_102431852 198
337 3300031911 Ga0307412_10010674 Ga0307412_100106745 198
338 3300031911 Ga0307412_10235242 Ga0307412_102352422 198
339 3300031911 Ga0307412_10877813 Ga0307412_108778131 198
340 3300031995 Ga0307409_100007093 Ga0307409_1000070932 198
341 3300032002 Ga0307416_100014342 Ga0307416_1000143427 198
342 3300032002 Ga0307416_100033005 Ga0307416_1000330056 198
343 3300032002 Ga0307416_100284964 Ga0307416_1002849643 198
344 3300032002 Ga0307416_100707588 Ga0307416_1007075882 198
345 3300032004 Ga0307414_10003436 Ga0307414_100034362 198
346 3300032004 Ga0307414_10043418 Ga0307414_100434182 198
347 3300032004 Ga0307414_10044479 Ga0307414_100444794 198
348 3300032004 Ga0307414_10720886 Ga0307414_107208861 198
349 3300032005 Ga0307411_10004374 Ga0307411_100043744 198
350 3300032005 Ga0307411_10005073 Ga0307411_100050732 198
351 3300032005 Ga0307411_10012563 Ga0307411_100125632 198
352 3300032005 Ga0307411_10245588 Ga0307411_102455882 198
353 3300032005 Ga0307411_10340164 Ga0307411_103401643 198
354 3300032126 Ga0307415_100002188 Ga0307415_1000021887 198
355 3300032126 Ga0307415_100021786 Ga0307415_1000217863 198
356 3300032126 Ga0307415_100690116 Ga0307415_1006901162 198
357 3300037312 Ga0395899_0020913 Ga0395899_0020913_962_1558 198
358 3300037418 Ga0395900_0079384 Ga0395900_0079384_2419_3015 198
359 3300037466 Ga0395898_0289989 Ga0395898_0289989_76_672 198
360 3300037471 Ga0395905_0007559 Ga0395905_0007559_133_729 198
361 3300037471 Ga0395905_0011136 Ga0395905_0011136_294_890 198
362 3300037471 Ga0395905_0029219 Ga0395905_0029219_3887_4483 198
363 3300037471 Ga0395905_0080514 Ga0395905_0080514_2006_2602 198
364 3300037471 Ga0395905_0284029 Ga0395905_0284029_164_760 198
365 3300038443 Ga0395901_0068752 Ga0395901_0068752_2320_2916 198
366 3300038443 Ga0395901_0140279 Ga0395901_0140279_176_772 198
367 3300038443 Ga0395901_0331438 Ga0395901_0331438_295_891 198
368 3300044694 Ga0466963_0039408 Ga0466963_0039408_493_1089 198
369 3300044842 Ga0466957_0085185 Ga0466957_0085185_573_1169 198
370 3300045836 Ga0466958_0026099 Ga0466958_0026099_2482_3078 198
371 3300045836 Ga0466958_0031466 Ga0466958_0031466_179_775 198
372 3300045976 Ga0466967_0348307 Ga0466967_0348307_705_1301 198
373 3300045976 Ga0466967_0413607 Ga0466967_0413607_409_1005 198
374 3300046539 Ga0495621_0014652 Ga0495621_0014652_887_1483 198
375 3300046616 Ga0495668_0043278 Ga0495668_0043278_1686_2282 198
376 3300048911 Ga0496108_0000229 Ga0496108_0000229_2068_2664 198
377 3300048911 Ga0496108_0265819 Ga0496108_0265819_408_1004 198
378 3300048912 Ga0496109_0025022 Ga0496109_0025022_4139_4735 198
379 3300049586 Ga0501070_0308218 Ga0501070_0308218_47_643 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

129

188

0.97

PF08818

DUF1801

Domain of unknown function (DU1801)

18

110

0.91

PF18899

DUF5655

Domain of unknown function (DUF5655)

7

113

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7401 7 115
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7269 6 115
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6804 6 115
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6596 7 115
6oyc-assembly4.cif.gz_A glycosylation associate protein (gap123) complex from streptococcus agalactiae 0.5855 36 68
ID Description Score Start End Superfamily
2i8dB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7806 8 68 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7679 3 110 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7259 3 110 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7162 7 116 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6954 7 116 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A4Q4CJD5-F1-model_v4 DUF1801 domain-containing protein 0.9601 8 67
AF-A0A538AZV3-F1-model_v4 YdhG-like domain-containing protein 0.94 7 68
AF-A0A6I3DMJ4-F1-model_v4 deleted 0.9367 4 73
AF-A0A7C2RHI1-F1-model_v4 Bacteriocin-protection protein 0.9277 120 188
AF-A0A3D4IUR1-F1-model_v4 deleted 0.9275 8 70

Feature Viewer

pLDDT pTM Quality
84.45 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map