F428228
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 379 | 161 | 379 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300001990|JGI24737J22298_10000005|JGI24737J22298_1000000522 |
| Length | 234 |
| Sequence | LNREPRFDDYIEKAAPFAQPILKHVRERVHAVVPHVEEAMKWSAPGFTLDGKILLIMAAFKQHAALNFWRGQEIGDGEAKAGAMGQFGKLTSIDNLPPDDELDALIREAAELAKTAPAPRKTKHEXXXAPTLHPEFAAALAKVPKAKAALDGFPPGAQRDYFEWISEAKQDATRQKRISTAIEWLAEGKRRHWKYQNCXSASASSGYPVQSGSAPRLRXRTRNSRRSAWPADWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 130 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 138 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 139 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 144 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 147 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.85 |
| Rhizosphere | 98.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1011118 | 3300001978 | Bacteria | 908 |
| 2 | JGI24740J21852_10001215 | 3300001979 | Bacteria | 11649 |
| 3 | JGI24740J21852_10007755 | 3300001979 | Bacteria | 4337 |
| 4 | JGI24740J21852_10039991 | 3300001979 | Bacteria | 1425 |
| 5 | JGI24739J22299_10000084 | 3300001989 | Bacteria | 26964 |
| 6 | JGI24739J22299_10006623 | 3300001989 | Bacteria | 4363 |
| 7 | JGI24737J22298_10000005 | 3300001990 | Bacteria | 65241 |
| 8 | JGI24737J22298_10001034 | 3300001990 | Bacteria | 9851 |
| 9 | JGI24745J21846_1003096 | 3300002073 | Bacteria | 1726 |
| 10 | JGI24738J21930_10000170 | 3300002075 | Bacteria | 16595 |
| 11 | Ga0070658_10005858 | 3300005327 | Bacteria | 9966 |
| 12 | Ga0070658_10031304 | 3300005327 | Bacteria | 4272 |
| 13 | Ga0070658_10031730 | 3300005327 | Bacteria | 4244 |
| 14 | Ga0070676_10047706 | 3300005328 | Bacteria | 2502 |
| 15 | Ga0070683_100002263 | 3300005329 | Bacteria | 15247 |
| 16 | Ga0070683_100164383 | 3300005329 | Bacteria | 2106 |
| 17 | Ga0070690_100041108 | 3300005330 | Bacteria | 2926 |
| 18 | Ga0070690_100120653 | 3300005330 | Bacteria | 1759 |
| 19 | Ga0070670_100004136 | 3300005331 | Bacteria | 12125 |
| 20 | Ga0070670_100049007 | 3300005331 | Bacteria | 3634 |
| 21 | Ga0070670_100215767 | 3300005331 | Bacteria | 1669 |
| 22 | Ga0068869_100000003 | 3300005334 | Bacteria | 136262 |
| 23 | Ga0070666_10001518 | 3300005335 | Bacteria | 14090 |
| 24 | Ga0070666_10157419 | 3300005335 | Bacteria | 1587 |
| 25 | Ga0070680_100070926 | 3300005336 | Bacteria | 2862 |
| 26 | Ga0070682_100006410 | 3300005337 | Bacteria | 6610 |
| 27 | Ga0068868_100210937 | 3300005338 | Bacteria | 1623 |
| 28 | Ga0070660_100001342 | 3300005339 | Bacteria | 16720 |
| 29 | Ga0070660_100018067 | 3300005339 | Bacteria | 5146 |
| 30 | Ga0070660_100047663 | 3300005339 | Bacteria | 3289 |
| 31 | Ga0070660_100078210 | 3300005339 | Bacteria | 2594 |
| 32 | Ga0070660_100209659 | 3300005339 | Unclassified | 1581 |
| 33 | Ga0070660_100605652 | 3300005339 | Unclassified | 916 |
| 34 | Ga0070689_100007203 | 3300005340 | Bacteria | 7754 |
| 35 | Ga0070661_100000079 | 3300005344 | Bacteria | 77180 |
| 36 | Ga0070692_10013457 | 3300005345 | Bacteria | 3815 |
| 37 | Ga0070668_100065623 | 3300005347 | Bacteria | 2816 |
| 38 | Ga0070669_100000381 | 3300005353 | Bacteria | 33945 |
| 39 | Ga0070669_100113662 | 3300005353 | Bacteria | 2057 |
| 40 | Ga0070669_100167290 | 3300005353 | Bacteria | 1712 |
| 41 | Ga0070675_100063711 | 3300005354 | Bacteria | 3048 |
| 42 | Ga0070675_100089518 | 3300005354 | Bacteria | 2577 |
| 43 | Ga0070671_100013054 | 3300005355 | Bacteria | 6695 |
| 44 | Ga0070671_100013403 | 3300005355 | Bacteria | 6609 |
| 45 | Ga0070671_100016685 | 3300005355 | Bacteria | 5938 |
| 46 | Ga0070671_100156502 | 3300005355 | Bacteria | 1925 |
| 47 | Ga0070674_100143458 | 3300005356 | Bacteria | 1795 |
| 48 | Ga0070673_100000077 | 3300005364 | Bacteria | 41919 |
| 49 | Ga0070673_100132290 | 3300005364 | Bacteria | 2095 |
| 50 | Ga0070673_100548267 | 3300005364 | Unclassified | 1050 |
| 51 | Ga0070659_100000165 | 3300005366 | Bacteria | 51041 |
| 52 | Ga0070659_100000220 | 3300005366 | Bacteria | 44199 |
| 53 | Ga0070659_100114519 | 3300005366 | Bacteria | 2179 |
| 54 | Ga0070659_100157334 | 3300005366 | Unclassified | 1856 |
| 55 | Ga0070667_100001626 | 3300005367 | Bacteria | 20121 |
| 56 | Ga0070667_100012545 | 3300005367 | Bacteria | 7008 |
| 57 | Ga0070663_100008899 | 3300005455 | Bacteria | 6198 |
| 58 | Ga0070663_100150305 | 3300005455 | Bacteria | 1785 |
| 59 | Ga0070663_100302749 | 3300005455 | Bacteria | 1280 |
| 60 | Ga0070678_100000975 | 3300005456 | Bacteria | 14782 |
| 61 | Ga0070678_100052637 | 3300005456 | Bacteria | 2957 |
| 62 | Ga0070662_100000171 | 3300005457 | Bacteria | 37981 |
| 63 | Ga0070662_100000215 | 3300005457 | Bacteria | 33867 |
| 64 | Ga0070662_100017840 | 3300005457 | Bacteria | 4789 |
| 65 | Ga0070662_100020997 | 3300005457 | Bacteria | 4454 |
| 66 | Ga0070662_100093167 | 3300005457 | Bacteria | 2266 |
| 67 | Ga0070681_10296915 | 3300005458 | Unclassified | 1525 |
| 68 | Ga0070681_10335294 | 3300005458 | Bacteria | 1422 |
| 69 | Ga0068867_100000115 | 3300005459 | Bacteria | 50713 |
| 70 | Ga0068867_100072495 | 3300005459 | Bacteria | 2578 |
| 71 | Ga0068867_100651466 | 3300005459 | Bacteria | 924 |
| 72 | Ga0070679_100419572 | 3300005530 | Bacteria | 1283 |
| 73 | Ga0068853_100000316 | 3300005539 | Bacteria | 33719 |
| 74 | Ga0068853_100009057 | 3300005539 | Bacteria | 8015 |
| 75 | Ga0070672_100000336 | 3300005543 | Bacteria | 26949 |
| 76 | Ga0070672_100189799 | 3300005543 | Bacteria | 1715 |
| 77 | Ga0070693_100000563 | 3300005547 | Bacteria | 16421 |
| 78 | Ga0070665_100001642 | 3300005548 | Bacteria | 25770 |
| 79 | Ga0070665_100042586 | 3300005548 | Bacteria | 4564 |
| 80 | Ga0070665_100049452 | 3300005548 | Bacteria | 4218 |
| 81 | Ga0070665_100562710 | 3300005548 | Unclassified | 1153 |
| 82 | Ga0068855_100000447 | 3300005563 | Bacteria | 51000 |
| 83 | Ga0068855_100003513 | 3300005563 | Bacteria | 19177 |
| 84 | Ga0068855_100147510 | 3300005563 | Unclassified | 2677 |
| 85 | Ga0068855_100292843 | 3300005563 | Bacteria | 1804 |
| 86 | Ga0070664_100000311 | 3300005564 | Bacteria | 35468 |
| 87 | Ga0070664_100033363 | 3300005564 | Bacteria | 4312 |
| 88 | Ga0070664_100049662 | 3300005564 | Bacteria | 3548 |
| 89 | Ga0070664_100686052 | 3300005564 | Bacteria | 953 |
| 90 | Ga0068857_100000026 | 3300005577 | Bacteria | 83525 |
| 91 | Ga0068857_100146195 | 3300005577 | Bacteria | 2139 |
| 92 | Ga0068857_100490531 | 3300005577 | Bacteria | 1152 |
| 93 | Ga0068854_100000320 | 3300005578 | Bacteria | 31598 |
| 94 | Ga0068854_100013639 | 3300005578 | Bacteria | 5341 |
| 95 | Ga0068854_100562333 | 3300005578 | Bacteria | 969 |
| 96 | Ga0068856_100000979 | 3300005614 | Bacteria | 30480 |
| 97 | Ga0068856_100364911 | 3300005614 | Bacteria | 1463 |
| 98 | Ga0068856_100385709 | 3300005614 | Bacteria | 1421 |
| 99 | Ga0068852_100003556 | 3300005616 | Bacteria | 10908 |
| 100 | Ga0068852_100004133 | 3300005616 | Bacteria | 10220 |
| 101 | Ga0068852_100060939 | 3300005616 | Bacteria | 3277 |
| 102 | Ga0068852_100214487 | 3300005616 | Bacteria | 1828 |
| 103 | Ga0068852_100223658 | 3300005616 | Bacteria | 1791 |
| 104 | Ga0068864_100000047 | 3300005618 | Bacteria | 150798 |
| 105 | Ga0068864_100047157 | 3300005618 | Bacteria | 3700 |
| 106 | Ga0068864_100305204 | 3300005618 | Bacteria | 1491 |
| 107 | Ga0068861_100086293 | 3300005719 | Bacteria | 2467 |
| 108 | Ga0068851_10022859 | 3300005834 | Bacteria | 3051 |
| 109 | Ga0068851_10137886 | 3300005834 | Bacteria | 1324 |
| 110 | Ga0068863_100000484 | 3300005841 | Bacteria | 40697 |
| 111 | Ga0068863_100107580 | 3300005841 | Bacteria | 2654 |
| 112 | Ga0068863_100424657 | 3300005841 | Bacteria | 1302 |
| 113 | Ga0068863_101112960 | 3300005841 | Bacteria | 794 |
| 114 | Ga0068858_100003246 | 3300005842 | Bacteria | 16210 |
| 115 | Ga0068858_100035111 | 3300005842 | Bacteria | 4650 |
| 116 | Ga0068860_100005960 | 3300005843 | Bacteria | 12260 |
| 117 | Ga0068862_100185518 | 3300005844 | Bacteria | 1869 |
| 118 | Ga0068862_100649312 | 3300005844 | Bacteria | 1018 |
| 119 | Ga0097621_100060001 | 3300006237 | Bacteria | 3116 |
| 120 | Ga0068871_100015720 | 3300006358 | Bacteria | 5677 |
| 121 | Ga0068865_100001643 | 3300006881 | Bacteria | 13102 |
| 122 | Ga0068865_100079798 | 3300006881 | Bacteria | 2345 |
| 123 | Ga0105245_10000062 | 3300009098 | Bacteria | 115179 |
| 124 | Ga0105243_10616774 | 3300009148 | Bacteria | 1046 |
| 125 | Ga0105241_10015388 | 3300009174 | Bacteria | 5602 |
| 126 | Ga0105241_10023854 | 3300009174 | Bacteria | 4539 |
| 127 | Ga0105248_10000117 | 3300009177 | Bacteria | 90169 |
| 128 | Ga0105248_10003791 | 3300009177 | Bacteria | 16748 |
| 129 | Ga0105248_10452904 | 3300009177 | Bacteria | 1446 |
| 130 | Ga0105238_10022775 | 3300009551 | Bacteria | 6385 |
| 131 | Ga0105238_10067883 | 3300009551 | Bacteria | 3567 |
| 132 | Ga0105239_10122624 | 3300010375 | Bacteria | 2888 |
| 133 | Ga0105239_10569724 | 3300010375 | Bacteria | 1290 |
| 134 | Ga0105246_10017038 | 3300011119 | Bacteria | 4614 |
| 135 | Ga0157373_10007219 | 3300013100 | Bacteria | 8286 |
| 136 | Ga0157373_10098768 | 3300013100 | Bacteria | 2055 |
| 137 | Ga0157373_10172649 | 3300013100 | Bacteria | 1521 |
| 138 | Ga0157373_10285372 | 3300013100 | Unclassified | 1170 |
| 139 | Ga0157373_10305559 | 3300013100 | Bacteria | 1129 |
| 140 | Ga0157373_10487945 | 3300013100 | Bacteria | 889 |
| 141 | Ga0157373_10814648 | 3300013100 | Bacteria | 689 |
| 142 | Ga0157371_10000144 | 3300013102 | Bacteria | 103512 |
| 143 | Ga0157371_10007113 | 3300013102 | Bacteria | 9092 |
| 144 | Ga0157371_10028626 | 3300013102 | Bacteria | 4032 |
| 145 | Ga0157371_10092570 | 3300013102 | Bacteria | 2142 |
| 146 | Ga0157371_10095324 | 3300013102 | Bacteria | 2109 |
| 147 | Ga0157371_10137225 | 3300013102 | Bacteria | 1742 |
| 148 | Ga0157370_10016501 | 3300013104 | Bacteria | 7472 |
| 149 | Ga0157370_10110570 | 3300013104 | Unclassified | 2569 |
| 150 | Ga0157370_10759894 | 3300013104 | Bacteria | 883 |
| 151 | Ga0157369_10075205 | 3300013105 | Bacteria | 3622 |
| 152 | Ga0157369_10130902 | 3300013105 | Bacteria | 2659 |
| 153 | Ga0157369_10803045 | 3300013105 | Unclassified | 967 |
| 154 | Ga0157374_10088143 | 3300013296 | Bacteria | 2955 |
| 155 | Ga0157378_10002137 | 3300013297 | Bacteria | 17555 |
| 156 | Ga0163162_10106846 | 3300013306 | Bacteria | 2894 |
| 157 | Ga0157372_10116014 | 3300013307 | Bacteria | 3070 |
| 158 | Ga0157372_10670432 | 3300013307 | Bacteria | 1207 |
| 159 | Ga0157375_10191946 | 3300013308 | Bacteria | 2197 |
| 160 | Ga0157375_10324296 | 3300013308 | Bacteria | 1705 |
| 161 | Ga0163163_10000380 | 3300014325 | Bacteria | 42243 |
| 162 | Ga0206353_10684851 | 3300020082 | Bacteria | 1817 |
| 163 | Ga0207697_10000328 | 3300025315 | Bacteria | 26559 |
| 164 | Ga0207656_10069076 | 3300025321 | Bacteria | 1567 |
| 165 | Ga0207682_10014912 | 3300025893 | Bacteria | 3026 |
| 166 | Ga0207682_10027252 | 3300025893 | Bacteria | 2274 |
| 167 | Ga0207682_10123193 | 3300025893 | Bacteria | 1151 |
| 168 | Ga0207688_10000019 | 3300025901 | Bacteria | 51361 |
| 169 | Ga0207680_10018140 | 3300025903 | Bacteria | 3734 |
| 170 | Ga0207680_10046653 | 3300025903 | Bacteria | 2562 |
| 171 | Ga0207680_10177217 | 3300025903 | Bacteria | 1439 |
| 172 | Ga0207647_10000822 | 3300025904 | Bacteria | 24109 |
| 173 | Ga0207647_10028522 | 3300025904 | Bacteria | 3623 |
| 174 | Ga0207645_10052730 | 3300025907 | Bacteria | 2599 |
| 175 | Ga0207705_10000222 | 3300025909 | Bacteria | 56707 |
| 176 | Ga0207705_10023703 | 3300025909 | Bacteria | 4379 |
| 177 | Ga0207705_10151255 | 3300025909 | Bacteria | 1739 |
| 178 | Ga0207705_10258489 | 3300025909 | Bacteria | 1329 |
| 179 | Ga0207654_10019595 | 3300025911 | Bacteria | 3574 |
| 180 | Ga0207654_10026755 | 3300025911 | Bacteria | 3127 |
| 181 | Ga0207707_10086271 | 3300025912 | Bacteria | 2743 |
| 182 | Ga0207693_10132074 | 3300025915 | Bacteria | 1963 |
| 183 | Ga0207660_10160822 | 3300025917 | Bacteria | 1732 |
| 184 | Ga0207657_10000378 | 3300025919 | Bacteria | 47118 |
| 185 | Ga0207657_10002521 | 3300025919 | Bacteria | 19807 |
| 186 | Ga0207657_10004541 | 3300025919 | Bacteria | 14664 |
| 187 | Ga0207657_10029706 | 3300025919 | Bacteria | 4971 |
| 188 | Ga0207657_10057870 | 3300025919 | Bacteria | 3339 |
| 189 | Ga0207657_10597725 | 3300025919 | Unclassified | 861 |
| 190 | Ga0207649_10000135 | 3300025920 | Bacteria | 63197 |
| 191 | Ga0207649_10131194 | 3300025920 | Bacteria | 1702 |
| 192 | Ga0207649_10666168 | 3300025920 | Unclassified | 805 |
| 193 | Ga0207652_10094886 | 3300025921 | Bacteria | 2627 |
| 194 | Ga0207652_10159332 | 3300025921 | Bacteria | 2023 |
| 195 | Ga0207652_10827232 | 3300025921 | Bacteria | 821 |
| 196 | Ga0207681_10000489 | 3300025923 | Bacteria | 27719 |
| 197 | Ga0207681_10212421 | 3300025923 | Bacteria | 1492 |
| 198 | Ga0207694_10154558 | 3300025924 | Bacteria | 1850 |
| 199 | Ga0207650_10004793 | 3300025925 | Bacteria | 9244 |
| 200 | Ga0207650_10014807 | 3300025925 | Bacteria | 5423 |
| 201 | Ga0207650_10063243 | 3300025925 | Bacteria | 2767 |
| 202 | Ga0207650_10153103 | 3300025925 | Bacteria | 1821 |
| 203 | Ga0207659_10114612 | 3300025926 | Bacteria | 2055 |
| 204 | Ga0207659_10126240 | 3300025926 | Bacteria | 1968 |
| 205 | Ga0207687_10000424 | 3300025927 | Bacteria | 28651 |
| 206 | Ga0207664_10111340 | 3300025929 | Bacteria | 2277 |
| 207 | Ga0207644_10000495 | 3300025931 | Bacteria | 25321 |
| 208 | Ga0207644_10013887 | 3300025931 | Bacteria | 5380 |
| 209 | Ga0207644_10014702 | 3300025931 | Bacteria | 5245 |
| 210 | Ga0207690_10000509 | 3300025932 | Bacteria | 25193 |
| 211 | Ga0207690_10184777 | 3300025932 | Unclassified | 1572 |
| 212 | Ga0207690_10367743 | 3300025932 | Bacteria | 1140 |
| 213 | Ga0207690_10467227 | 3300025932 | Bacteria | 1016 |
| 214 | Ga0207690_10581764 | 3300025932 | Bacteria | 913 |
| 215 | Ga0207706_10000020 | 3300025933 | Bacteria | 162063 |
| 216 | Ga0207706_10000513 | 3300025933 | Bacteria | 41181 |
| 217 | Ga0207706_10012530 | 3300025933 | Bacteria | 7723 |
| 218 | Ga0207706_10018244 | 3300025933 | Bacteria | 6314 |
| 219 | Ga0207706_10079434 | 3300025933 | Bacteria | 2885 |
| 220 | Ga0207706_10276125 | 3300025933 | Bacteria | 1466 |
| 221 | Ga0207686_10121474 | 3300025934 | Bacteria | 1779 |
| 222 | Ga0207670_10281977 | 3300025936 | Bacteria | 1295 |
| 223 | Ga0207669_10032659 | 3300025937 | Bacteria | 2926 |
| 224 | Ga0207669_10250804 | 3300025937 | Bacteria | 1318 |
| 225 | Ga0207669_10385522 | 3300025937 | Bacteria | 1093 |
| 226 | Ga0207704_10093784 | 3300025938 | Bacteria | 1980 |
| 227 | Ga0207691_10000047 | 3300025940 | Bacteria | 99519 |
| 228 | Ga0207691_10055188 | 3300025940 | Bacteria | 3622 |
| 229 | Ga0207691_10152262 | 3300025940 | Unclassified | 2033 |
| 230 | Ga0207691_10211247 | 3300025940 | Bacteria | 1685 |
| 231 | Ga0207711_10000558 | 3300025941 | Bacteria | 37953 |
| 232 | Ga0207711_10007486 | 3300025941 | Bacteria | 9132 |
| 233 | Ga0207689_10000002 | 3300025942 | Bacteria | 198437 |
| 234 | Ga0207661_10017032 | 3300025944 | Bacteria | 5368 |
| 235 | Ga0207679_10000460 | 3300025945 | Bacteria | 28726 |
| 236 | Ga0207679_10308856 | 3300025945 | Unclassified | 1366 |
| 237 | Ga0207679_10809783 | 3300025945 | Bacteria | 854 |
| 238 | Ga0207667_10001204 | 3300025949 | Bacteria | 32354 |
| 239 | Ga0207667_10099756 | 3300025949 | Bacteria | 2996 |
| 240 | Ga0207667_10257859 | 3300025949 | Bacteria | 1783 |
| 241 | Ga0207667_10434397 | 3300025949 | Bacteria | 1335 |
| 242 | Ga0207667_10494856 | 3300025949 | Bacteria | 1240 |
| 243 | Ga0207651_10000387 | 3300025960 | Bacteria | 18790 |
| 244 | Ga0207651_10394098 | 3300025960 | Bacteria | 1176 |
| 245 | Ga0207651_10681762 | 3300025960 | Unclassified | 904 |
| 246 | Ga0207668_10043239 | 3300025972 | Bacteria | 3056 |
| 247 | Ga0207668_10084211 | 3300025972 | Bacteria | 2316 |
| 248 | Ga0207640_10006259 | 3300025981 | Bacteria | 6526 |
| 249 | Ga0207640_10009697 | 3300025981 | Bacteria | 5400 |
| 250 | Ga0207640_10437483 | 3300025981 | Bacteria | 1074 |
| 251 | Ga0207658_10033797 | 3300025986 | Bacteria | 3649 |
| 252 | Ga0207658_10228203 | 3300025986 | Bacteria | 1570 |
| 253 | Ga0207658_10291518 | 3300025986 | Bacteria | 1402 |
| 254 | Ga0207677_10002499 | 3300026023 | Bacteria | 9646 |
| 255 | Ga0207677_10241191 | 3300026023 | Bacteria | 1462 |
| 256 | Ga0207677_10691253 | 3300026023 | Bacteria | 904 |
| 257 | Ga0207703_10028409 | 3300026035 | Bacteria | 4409 |
| 258 | Ga0207703_10028423 | 3300026035 | Bacteria | 4408 |
| 259 | Ga0207639_10011598 | 3300026041 | Bacteria | 6124 |
| 260 | Ga0207639_10016940 | 3300026041 | Bacteria | 5163 |
| 261 | Ga0207639_10793112 | 3300026041 | Bacteria | 882 |
| 262 | Ga0207639_10919988 | 3300026041 | Bacteria | 818 |
| 263 | Ga0207678_10000879 | 3300026067 | Bacteria | 27621 |
| 264 | Ga0207678_10007682 | 3300026067 | Bacteria | 9524 |
| 265 | Ga0207678_10193582 | 3300026067 | Bacteria | 1738 |
| 266 | Ga0207678_10724498 | 3300026067 | Bacteria | 876 |
| 267 | Ga0207702_10001066 | 3300026078 | Bacteria | 28071 |
| 268 | Ga0207702_10238294 | 3300026078 | Bacteria | 1703 |
| 269 | Ga0207641_10071176 | 3300026088 | Bacteria | 2990 |
| 270 | Ga0207641_10151085 | 3300026088 | Bacteria | 2103 |
| 271 | Ga0207641_10208672 | 3300026088 | Bacteria | 1805 |
| 272 | Ga0207648_10002019 | 3300026089 | Bacteria | 22153 |
| 273 | Ga0207648_10198872 | 3300026089 | Bacteria | 1777 |
| 274 | Ga0207648_10230472 | 3300026089 | Bacteria | 1647 |
| 275 | Ga0207648_10684878 | 3300026089 | Bacteria | 949 |
| 276 | Ga0207676_10007306 | 3300026095 | Bacteria | 7832 |
| 277 | Ga0207676_10511731 | 3300026095 | Bacteria | 1141 |
| 278 | Ga0207674_10002120 | 3300026116 | Bacteria | 25085 |
| 279 | Ga0207674_10003128 | 3300026116 | Bacteria | 20417 |
| 280 | Ga0207674_10003428 | 3300026116 | Bacteria | 19410 |
| 281 | Ga0207674_10253803 | 3300026116 | Bacteria | 1705 |
| 282 | Ga0207674_10834885 | 3300026116 | Bacteria | 889 |
| 283 | Ga0207683_10006670 | 3300026121 | Bacteria | 9877 |
| 284 | Ga0207683_10230333 | 3300026121 | Bacteria | 1690 |
| 285 | Ga0207698_10000675 | 3300026142 | Bacteria | 19796 |
| 286 | Ga0207698_10009531 | 3300026142 | Bacteria | 6197 |
| 287 | Ga0207698_10396186 | 3300026142 | Bacteria | 1318 |
| 288 | Ga0268266_10000256 | 3300028379 | Bacteria | 89436 |
| 289 | Ga0268266_10003320 | 3300028379 | Bacteria | 16145 |
| 290 | Ga0268266_10021362 | 3300028379 | Bacteria | 5514 |
| 291 | Ga0268266_10152938 | 3300028379 | Bacteria | 2081 |
| 292 | Ga0268266_10600505 | 3300028379 | Unclassified | 1057 |
| 293 | Ga0268265_10023775 | 3300028380 | Bacteria | 4325 |
| 294 | Ga0268265_10165579 | 3300028380 | Bacteria | 1884 |
| 295 | Ga0268264_10025243 | 3300028381 | Bacteria | 4854 |
| 296 | Ga0307408_100148376 | 3300031548 | Bacteria | 1849 |
| 297 | Ga0307408_100257847 | 3300031548 | Bacteria | 1441 |
| 298 | Ga0307405_10009268 | 3300031731 | Bacteria | 5038 |
| 299 | Ga0307405_10088429 | 3300031731 | Bacteria | 2044 |
| 300 | Ga0307405_10219458 | 3300031731 | Bacteria | 1394 |
| 301 | Ga0307405_10384894 | 3300031731 | Bacteria | 1093 |
| 302 | Ga0307413_10004530 | 3300031824 | Bacteria | 6059 |
| 303 | Ga0307413_10054404 | 3300031824 | Bacteria | 2428 |
| 304 | Ga0307413_10057228 | 3300031824 | Bacteria | 2383 |
| 305 | Ga0307413_10360112 | 3300031824 | Bacteria | 1126 |
| 306 | Ga0307413_10683702 | 3300031824 | Bacteria | 850 |
| 307 | Ga0307410_10000938 | 3300031852 | Bacteria | 12506 |
| 308 | Ga0307410_10002679 | 3300031852 | Bacteria | 8686 |
| 309 | Ga0307410_10002846 | 3300031852 | Bacteria | 8506 |
| 310 | Ga0307410_10147973 | 3300031852 | Bacteria | 1745 |
| 311 | Ga0307407_10097068 | 3300031903 | Bacteria | 1820 |
| 312 | Ga0307407_10243185 | 3300031903 | Bacteria | 1229 |
| 313 | Ga0307412_10010674 | 3300031911 | Bacteria | 5294 |
| 314 | Ga0307412_10235242 | 3300031911 | Bacteria | 1413 |
| 315 | Ga0307412_10877813 | 3300031911 | Bacteria | 784 |
| 316 | Ga0307409_100007093 | 3300031995 | Bacteria | 6670 |
| 317 | Ga0307416_100005058 | 3300032002 | Bacteria | 8040 |
| 318 | Ga0307416_100014342 | 3300032002 | Bacteria | 5427 |
| 319 | Ga0307416_100033005 | 3300032002 | Bacteria | 3919 |
| 320 | Ga0307416_100284964 | 3300032002 | Bacteria | 1631 |
| 321 | Ga0307416_100707588 | 3300032002 | Bacteria | 1097 |
| 322 | Ga0307414_10003436 | 3300032004 | Bacteria | 8451 |
| 323 | Ga0307414_10043418 | 3300032004 | Bacteria | 3062 |
| 324 | Ga0307414_10044479 | 3300032004 | Bacteria | 3033 |
| 325 | Ga0307414_10328111 | 3300032004 | Bacteria | 1305 |
| 326 | Ga0307414_10720886 | 3300032004 | Bacteria | 904 |
| 327 | Ga0307411_10004374 | 3300032005 | Bacteria | 6756 |
| 328 | Ga0307411_10005073 | 3300032005 | Bacteria | 6412 |
| 329 | Ga0307411_10012563 | 3300032005 | Bacteria | 4629 |
| 330 | Ga0307411_10074098 | 3300032005 | Bacteria | 2318 |
| 331 | Ga0307411_10245588 | 3300032005 | Bacteria | 1404 |
| 332 | Ga0307411_10340164 | 3300032005 | Bacteria | 1219 |
| 333 | Ga0307415_100002188 | 3300032126 | Bacteria | 9684 |
| 334 | Ga0307415_100021786 | 3300032126 | Bacteria | 3946 |
| 335 | Ga0307415_100690116 | 3300032126 | Bacteria | 920 |
| 336 | Ga0373932_0038465 | 3300035112 | Bacteria | 1368 |
| 337 | Ga0373939_0065775 | 3300035114 | Bacteria | 1167 |
| 338 | Ga0373960_0026007 | 3300035121 | Bacteria | 1596 |
| 339 | Ga0373961_0021422 | 3300035241 | Bacteria | 1719 |
| 340 | Ga0373931_0074441 | 3300035691 | Bacteria | 1860 |
| 341 | Ga0395899_0020913 | 3300037312 | Bacteria | 4963 |
| 342 | Ga0395899_0145216 | 3300037312 | Bacteria | 1685 |
| 343 | Ga0395900_0079384 | 3300037418 | Bacteria | 3372 |
| 344 | Ga0395900_0681730 | 3300037418 | Bacteria | 962 |
| 345 | Ga0395898_0289989 | 3300037466 | Bacteria | 1561 |
| 346 | Ga0395898_1073532 | 3300037466 | Bacteria | 739 |
| 347 | Ga0395905_0007559 | 3300037471 | Bacteria | 10797 |
| 348 | Ga0395905_0011136 | 3300037471 | Bacteria | 8698 |
| 349 | Ga0395905_0027784 | 3300037471 | Bacteria | 5334 |
| 350 | Ga0395905_0029219 | 3300037471 | Bacteria | 5196 |
| 351 | Ga0395905_0029856 | 3300037471 | Bacteria | 5138 |
| 352 | Ga0395905_0080514 | 3300037471 | Bacteria | 3052 |
| 353 | Ga0395905_0259250 | 3300037471 | Bacteria | 1623 |
| 354 | Ga0395905_0284029 | 3300037471 | Bacteria | 1541 |
| 355 | Ga0395901_0068752 | 3300038443 | Bacteria | 3689 |
| 356 | Ga0395901_0140279 | 3300038443 | Bacteria | 2540 |
| 357 | Ga0395901_0147162 | 3300038443 | Bacteria | 2476 |
| 358 | Ga0395901_0331438 | 3300038443 | Bacteria | 1573 |
| 359 | Ga0395901_0814850 | 3300038443 | Bacteria | 921 |
| 360 | Ga0466963_0039408 | 3300044694 | Bacteria | 3093 |
| 361 | Ga0466963_0455108 | 3300044694 | Bacteria | 903 |
| 362 | Ga0466957_0085185 | 3300044842 | Bacteria | 1974 |
| 363 | Ga0451576_0562714 | 3300045051 | Bacteria | 1198 |
| 364 | Ga0466958_0026099 | 3300045836 | Bacteria | 3451 |
| 365 | Ga0466958_0031466 | 3300045836 | Bacteria | 3154 |
| 366 | Ga0466967_0348307 | 3300045976 | Bacteria | 1433 |
| 367 | Ga0466967_0413607 | 3300045976 | Bacteria | 1313 |
| 368 | Ga0495621_0014652 | 3300046539 | Bacteria | 2486 |
| 369 | Ga0495668_0043278 | 3300046616 | Bacteria | 2505 |
| 370 | Ga0496104_0286805 | 3300048907 | Bacteria | 1559 |
| 371 | Ga0496107_0264473 | 3300048910 | Bacteria | 1280 |
| 372 | Ga0496108_0000229 | 3300048911 | Bacteria | 50203 |
| 373 | Ga0496108_0265819 | 3300048911 | Bacteria | 1493 |
| 374 | Ga0496109_0025022 | 3300048912 | Bacteria | 5315 |
| 375 | Ga0496110_0257031 | 3300048913 | Bacteria | 1590 |
| 376 | Ga0496112_0002632 | 3300048915 | Bacteria | 14504 |
| 377 | Ga0501067_0104872 | 3300049583 | Bacteria | 1571 |
| 378 | Ga0501070_0308218 | 3300049586 | Bacteria | 1289 |
| 379 | Ga0501071_0238856 | 3300049587 | Bacteria | 1370 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_100164383 | Ga0070683_1001643832 | 157 |
| 2 | 3300005345 | Ga0070692_10013457 | Ga0070692_100134575 | 157 |
| 3 | 3300005366 | Ga0070659_100114519 | Ga0070659_1001145191 | 157 |
| 4 | 3300005577 | Ga0068857_100490531 | Ga0068857_1004905313 | 164 |
| 5 | 3300013105 | Ga0157369_10075205 | Ga0157369_100752054 | 164 |
| 6 | 3300026116 | Ga0207674_10253803 | Ga0207674_102538033 | 164 |
| 7 | 3300005327 | Ga0070658_10031304 | Ga0070658_100313043 | 165 |
| 8 | 3300005339 | Ga0070660_100078210 | Ga0070660_1000782103 | 165 |
| 9 | 3300037471 | Ga0395905_0029856 | Ga0395905_0029856_3787_4371 | 165 |
| 10 | 3300005614 | Ga0068856_100364911 | Ga0068856_1003649111 | 179 |
| 11 | 3300025949 | Ga0207667_10494856 | Ga0207667_104948562 | 180 |
| 12 | 3300005336 | Ga0070680_100070926 | Ga0070680_1000709263 | 183 |
| 13 | 3300005339 | Ga0070660_100209659 | Ga0070660_1002096593 | 183 |
| 14 | 3300005366 | Ga0070659_100157334 | Ga0070659_1001573343 | 183 |
| 15 | 3300013100 | Ga0157373_10172649 | Ga0157373_101726493 | 183 |
| 16 | 3300025917 | Ga0207660_10160822 | Ga0207660_101608223 | 183 |
| 17 | 3300025919 | Ga0207657_10029706 | Ga0207657_100297066 | 183 |
| 18 | 3300025921 | Ga0207652_10094886 | Ga0207652_100948862 | 183 |
| 19 | 3300025932 | Ga0207690_10184777 | Ga0207690_101847773 | 183 |
| 20 | 3300025932 | Ga0207690_10000509 | Ga0207690_100005098 | 186 |
| 21 | 3300001979 | JGI24740J21852_10039991 | JGI24740J21852_100399912 | 187 |
| 22 | 3300001989 | JGI24739J22299_10006623 | JGI24739J22299_100066235 | 187 |
| 23 | 3300001990 | JGI24737J22298_10001034 | JGI24737J22298_100010345 | 187 |
| 24 | 3300005327 | Ga0070658_10005858 | Ga0070658_100058585 | 187 |
| 25 | 3300005327 | Ga0070658_10031730 | Ga0070658_100317302 | 187 |
| 26 | 3300005329 | Ga0070683_100002263 | Ga0070683_10000226315 | 187 |
| 27 | 3300005330 | Ga0070690_100120653 | Ga0070690_1001206533 | 187 |
| 28 | 3300005331 | Ga0070670_100049007 | Ga0070670_1000490075 | 187 |
| 29 | 3300005335 | Ga0070666_10001518 | Ga0070666_100015185 | 187 |
| 30 | 3300005337 | Ga0070682_100006410 | Ga0070682_1000064107 | 187 |
| 31 | 3300005339 | Ga0070660_100018067 | Ga0070660_1000180678 | 187 |
| 32 | 3300005339 | Ga0070660_100605652 | Ga0070660_1006056522 | 187 |
| 33 | 3300005344 | Ga0070661_100000079 | Ga0070661_10000007983 | 187 |
| 34 | 3300005355 | Ga0070671_100013403 | Ga0070671_1000134037 | 187 |
| 35 | 3300005366 | Ga0070659_100000165 | Ga0070659_10000016538 | 187 |
| 36 | 3300005367 | Ga0070667_100012545 | Ga0070667_1000125455 | 187 |
| 37 | 3300005455 | Ga0070663_100008899 | Ga0070663_1000088995 | 187 |
| 38 | 3300005457 | Ga0070662_100000171 | Ga0070662_10000017123 | 187 |
| 39 | 3300005459 | Ga0068867_100651466 | Ga0068867_1006514662 | 187 |
| 40 | 3300005539 | Ga0068853_100009057 | Ga0068853_1000090577 | 187 |
| 41 | 3300005547 | Ga0070693_100000563 | Ga0070693_1000005632 | 187 |
| 42 | 3300005548 | Ga0070665_100049452 | Ga0070665_1000494522 | 187 |
| 43 | 3300005563 | Ga0068855_100000447 | Ga0068855_10000044738 | 187 |
| 44 | 3300005564 | Ga0070664_100000311 | Ga0070664_10000031119 | 187 |
| 45 | 3300005577 | Ga0068857_100146195 | Ga0068857_1001461953 | 187 |
| 46 | 3300005578 | Ga0068854_100013639 | Ga0068854_1000136395 | 187 |
| 47 | 3300005614 | Ga0068856_100000979 | Ga0068856_10000097919 | 187 |
| 48 | 3300005616 | Ga0068852_100003556 | Ga0068852_10000355611 | 187 |
| 49 | 3300005618 | Ga0068864_100047157 | Ga0068864_1000471574 | 187 |
| 50 | 3300005834 | Ga0068851_10022859 | Ga0068851_100228592 | 187 |
| 51 | 3300005841 | Ga0068863_100107580 | Ga0068863_1001075803 | 187 |
| 52 | 3300005842 | Ga0068858_100035111 | Ga0068858_1000351113 | 187 |
| 53 | 3300006237 | Ga0097621_100060001 | Ga0097621_1000600012 | 187 |
| 54 | 3300006358 | Ga0068871_100015720 | Ga0068871_1000157205 | 187 |
| 55 | 3300009174 | Ga0105241_10023854 | Ga0105241_100238543 | 187 |
| 56 | 3300009177 | Ga0105248_10000117 | Ga0105248_1000011782 | 187 |
| 57 | 3300013100 | Ga0157373_10098768 | Ga0157373_100987682 | 187 |
| 58 | 3300013102 | Ga0157371_10007113 | Ga0157371_100071133 | 187 |
| 59 | 3300013102 | Ga0157371_10028626 | Ga0157371_100286266 | 187 |
| 60 | 3300013104 | Ga0157370_10110570 | Ga0157370_101105701 | 187 |
| 61 | 3300013105 | Ga0157369_10130902 | Ga0157369_101309023 | 187 |
| 62 | 3300013105 | Ga0157369_10803045 | Ga0157369_108030452 | 187 |
| 63 | 3300013296 | Ga0157374_10088143 | Ga0157374_100881433 | 187 |
| 64 | 3300014325 | Ga0163163_10000380 | Ga0163163_1000038016 | 187 |
| 65 | 3300020082 | Ga0206353_10684851 | Ga0206353_106848513 | 187 |
| 66 | 3300025903 | Ga0207680_10018140 | Ga0207680_100181406 | 187 |
| 67 | 3300025904 | Ga0207647_10028522 | Ga0207647_100285223 | 187 |
| 68 | 3300025909 | Ga0207705_10000222 | Ga0207705_1000022223 | 187 |
| 69 | 3300025911 | Ga0207654_10026755 | Ga0207654_100267553 | 187 |
| 70 | 3300025919 | Ga0207657_10000378 | Ga0207657_1000037816 | 187 |
| 71 | 3300025919 | Ga0207657_10597725 | Ga0207657_105977252 | 187 |
| 72 | 3300025920 | Ga0207649_10000135 | Ga0207649_100001352 | 187 |
| 73 | 3300025925 | Ga0207650_10063243 | Ga0207650_100632433 | 187 |
| 74 | 3300025929 | Ga0207664_10111340 | Ga0207664_101113403 | 187 |
| 75 | 3300025931 | Ga0207644_10013887 | Ga0207644_100138874 | 187 |
| 76 | 3300025933 | Ga0207706_10000513 | Ga0207706_1000051332 | 187 |
| 77 | 3300025941 | Ga0207711_10000558 | Ga0207711_1000055824 | 187 |
| 78 | 3300025944 | Ga0207661_10017032 | Ga0207661_100170324 | 187 |
| 79 | 3300025945 | Ga0207679_10000460 | Ga0207679_1000046018 | 187 |
| 80 | 3300025949 | Ga0207667_10001204 | Ga0207667_100012042 | 187 |
| 81 | 3300025981 | Ga0207640_10009697 | Ga0207640_100096973 | 187 |
| 82 | 3300025986 | Ga0207658_10033797 | Ga0207658_100337975 | 187 |
| 83 | 3300026035 | Ga0207703_10028423 | Ga0207703_100284235 | 187 |
| 84 | 3300026041 | Ga0207639_10011598 | Ga0207639_100115985 | 187 |
| 85 | 3300026067 | Ga0207678_10007682 | Ga0207678_100076825 | 187 |
| 86 | 3300026078 | Ga0207702_10001066 | Ga0207702_1000106627 | 187 |
| 87 | 3300026088 | Ga0207641_10208672 | Ga0207641_102086721 | 187 |
| 88 | 3300026089 | Ga0207648_10684878 | Ga0207648_106848782 | 187 |
| 89 | 3300026095 | Ga0207676_10511731 | Ga0207676_105117312 | 187 |
| 90 | 3300026142 | Ga0207698_10000675 | Ga0207698_1000067511 | 187 |
| 91 | 3300028379 | Ga0268266_10003320 | Ga0268266_100033202 | 187 |
| 92 | 3300035112 | Ga0373932_0038465 | Ga0373932_0038465_599_1204 | 187 |
| 93 | 3300035114 | Ga0373939_0065775 | Ga0373939_0065775_152_757 | 187 |
| 94 | 3300035121 | Ga0373960_0026007 | Ga0373960_0026007_754_1359 | 187 |
| 95 | 3300035241 | Ga0373961_0021422 | Ga0373961_0021422_580_1185 | 187 |
| 96 | 3300035691 | Ga0373931_0074441 | Ga0373931_0074441_567_1172 | 187 |
| 97 | 3300048907 | Ga0496104_0286805 | Ga0496104_0286805_603_1208 | 187 |
| 98 | 3300048910 | Ga0496107_0264473 | Ga0496107_0264473_198_803 | 187 |
| 99 | 3300048913 | Ga0496110_0257031 | Ga0496110_0257031_88_693 | 187 |
| 100 | 3300005331 | Ga0070670_100215767 | Ga0070670_1002157673 | 188 |
| 101 | 3300005355 | Ga0070671_100013054 | Ga0070671_1000130546 | 188 |
| 102 | 3300005458 | Ga0070681_10335294 | Ga0070681_103352942 | 188 |
| 103 | 3300013104 | Ga0157370_10016501 | Ga0157370_100165017 | 188 |
| 104 | 3300031824 | Ga0307413_10683702 | Ga0307413_106837021 | 188 |
| 105 | 3300032004 | Ga0307414_10328111 | Ga0307414_103281112 | 188 |
| 106 | 3300032005 | Ga0307411_10074098 | Ga0307411_100740982 | 188 |
| 107 | 3300044694 | Ga0466963_0455108 | Ga0466963_0455108_151_747 | 188 |
| 108 | 3300009177 | Ga0105248_10452904 | Ga0105248_104529043 | 189 |
| 109 | 3300025921 | Ga0207652_10159332 | Ga0207652_101593323 | 189 |
| 110 | 3300037466 | Ga0395898_1073532 | Ga0395898_1073532_77_667 | 189 |
| 111 | 3300038443 | Ga0395901_0147162 | Ga0395901_0147162_559_1149 | 189 |
| 112 | 3300048915 | Ga0496112_0002632 | Ga0496112_0002632_8431_9027 | 189 |
| 113 | 3300005335 | Ga0070666_10157419 | Ga0070666_101574191 | 190 |
| 114 | 3300005355 | Ga0070671_100016685 | Ga0070671_1000166852 | 190 |
| 115 | 3300005364 | Ga0070673_100132290 | Ga0070673_1001322903 | 190 |
| 116 | 3300005456 | Ga0070678_100000975 | Ga0070678_10000097517 | 190 |
| 117 | 3300005457 | Ga0070662_100017840 | Ga0070662_1000178402 | 190 |
| 118 | 3300005459 | Ga0068867_100072495 | Ga0068867_1000724953 | 190 |
| 119 | 3300005548 | Ga0070665_100001642 | Ga0070665_10000164223 | 190 |
| 120 | 3300025931 | Ga0207644_10000495 | Ga0207644_1000049530 | 190 |
| 121 | 3300025933 | Ga0207706_10079434 | Ga0207706_100794343 | 190 |
| 122 | 3300025940 | Ga0207691_10152262 | Ga0207691_101522623 | 190 |
| 123 | 3300026089 | Ga0207648_10198872 | Ga0207648_101988722 | 190 |
| 124 | 3300026121 | Ga0207683_10006670 | Ga0207683_1000667010 | 190 |
| 125 | 3300028379 | Ga0268266_10000256 | Ga0268266_100002568 | 190 |
| 126 | 3300005841 | Ga0068863_101112960 | Ga0068863_1011129602 | 191 |
| 127 | 3300031731 | Ga0307405_10219458 | Ga0307405_102194582 | 191 |
| 128 | 3300031824 | Ga0307413_10360112 | Ga0307413_103601122 | 191 |
| 129 | 3300032002 | Ga0307416_100005058 | Ga0307416_1000050583 | 191 |
| 130 | 3300037312 | Ga0395899_0145216 | Ga0395899_0145216_873_1469 | 191 |
| 131 | 3300037471 | Ga0395905_0259250 | Ga0395905_0259250_1002_1598 | 191 |
| 132 | 3300045051 | Ga0451576_0562714 | Ga0451576_0562714_134_730 | 191 |
| 133 | 3300049583 | Ga0501067_0104872 | Ga0501067_0104872_271_867 | 191 |
| 134 | 3300049587 | Ga0501071_0238856 | Ga0501071_0238856_395_991 | 191 |
| 135 | 3300005339 | Ga0070660_100047663 | Ga0070660_1000476632 | 192 |
| 136 | 3300013100 | Ga0157373_10487945 | Ga0157373_104879452 | 192 |
| 137 | 3300013102 | Ga0157371_10137225 | Ga0157371_101372252 | 192 |
| 138 | 3300013104 | Ga0157370_10759894 | Ga0157370_107598942 | 192 |
| 139 | 3300025909 | Ga0207705_10151255 | Ga0207705_101512551 | 192 |
| 140 | 3300025915 | Ga0207693_10132074 | Ga0207693_101320743 | 192 |
| 141 | 3300025919 | Ga0207657_10057870 | Ga0207657_100578706 | 192 |
| 142 | 3300026041 | Ga0207639_10919988 | Ga0207639_109199882 | 192 |
| 143 | 3300026116 | Ga0207674_10834885 | Ga0207674_108348852 | 192 |
| 144 | 3300038443 | Ga0395901_0814850 | Ga0395901_0814850_138_734 | 192 |
| 145 | 3300005458 | Ga0070681_10296915 | Ga0070681_102969152 | 196 |
| 146 | 3300025912 | Ga0207707_10086271 | Ga0207707_100862713 | 196 |
| 147 | 3300026041 | Ga0207639_10793112 | Ga0207639_107931121 | 196 |
| 148 | 3300026078 | Ga0207702_10238294 | Ga0207702_102382943 | 196 |
| 149 | 3300037418 | Ga0395900_0681730 | Ga0395900_0681730_19_612 | 197 |
| 150 | 3300037471 | Ga0395905_0027784 | Ga0395905_0027784_1469_2062 | 197 |
| 151 | 3300001978 | JGI24747J21853_1011118 | JGI24747J21853_10111182 | 198 |
| 152 | 3300001979 | JGI24740J21852_10001215 | JGI24740J21852_1000121513 | 198 |
| 153 | 3300001979 | JGI24740J21852_10007755 | JGI24740J21852_100077555 | 198 |
| 154 | 3300001989 | JGI24739J22299_10000084 | JGI24739J22299_1000008420 | 198 |
| 155 | 3300001990 | JGI24737J22298_10000005 | JGI24737J22298_1000000522 | 198 |
| 156 | 3300002073 | JGI24745J21846_1003096 | JGI24745J21846_10030962 | 198 |
| 157 | 3300002075 | JGI24738J21930_10000170 | JGI24738J21930_1000017015 | 198 |
| 158 | 3300005328 | Ga0070676_10047706 | Ga0070676_100477063 | 198 |
| 159 | 3300005330 | Ga0070690_100041108 | Ga0070690_1000411081 | 198 |
| 160 | 3300005331 | Ga0070670_100004136 | Ga0070670_1000041363 | 198 |
| 161 | 3300005334 | Ga0068869_100000003 | Ga0068869_10000000372 | 198 |
| 162 | 3300005338 | Ga0068868_100210937 | Ga0068868_1002109373 | 198 |
| 163 | 3300005339 | Ga0070660_100001342 | Ga0070660_10000134216 | 198 |
| 164 | 3300005340 | Ga0070689_100007203 | Ga0070689_10000720313 | 198 |
| 165 | 3300005347 | Ga0070668_100065623 | Ga0070668_1000656233 | 198 |
| 166 | 3300005353 | Ga0070669_100000381 | Ga0070669_10000038121 | 198 |
| 167 | 3300005353 | Ga0070669_100113662 | Ga0070669_1001136622 | 198 |
| 168 | 3300005353 | Ga0070669_100167290 | Ga0070669_1001672903 | 198 |
| 169 | 3300005354 | Ga0070675_100063711 | Ga0070675_1000637113 | 198 |
| 170 | 3300005354 | Ga0070675_100089518 | Ga0070675_1000895184 | 198 |
| 171 | 3300005355 | Ga0070671_100156502 | Ga0070671_1001565022 | 198 |
| 172 | 3300005356 | Ga0070674_100143458 | Ga0070674_1001434583 | 198 |
| 173 | 3300005364 | Ga0070673_100000077 | Ga0070673_10000007720 | 198 |
| 174 | 3300005364 | Ga0070673_100548267 | Ga0070673_1005482672 | 198 |
| 175 | 3300005366 | Ga0070659_100000220 | Ga0070659_1000002203 | 198 |
| 176 | 3300005367 | Ga0070667_100001626 | Ga0070667_10000162622 | 198 |
| 177 | 3300005455 | Ga0070663_100150305 | Ga0070663_1001503052 | 198 |
| 178 | 3300005455 | Ga0070663_100302749 | Ga0070663_1003027493 | 198 |
| 179 | 3300005456 | Ga0070678_100052637 | Ga0070678_1000526373 | 198 |
| 180 | 3300005457 | Ga0070662_100000215 | Ga0070662_10000021518 | 198 |
| 181 | 3300005457 | Ga0070662_100020997 | Ga0070662_1000209973 | 198 |
| 182 | 3300005457 | Ga0070662_100093167 | Ga0070662_1000931673 | 198 |
| 183 | 3300005459 | Ga0068867_100000115 | Ga0068867_10000011517 | 198 |
| 184 | 3300005530 | Ga0070679_100419572 | Ga0070679_1004195721 | 198 |
| 185 | 3300005539 | Ga0068853_100000316 | Ga0068853_10000031619 | 198 |
| 186 | 3300005543 | Ga0070672_100000336 | Ga0070672_10000033615 | 198 |
| 187 | 3300005543 | Ga0070672_100189799 | Ga0070672_1001897993 | 198 |
| 188 | 3300005548 | Ga0070665_100042586 | Ga0070665_1000425863 | 198 |
| 189 | 3300005548 | Ga0070665_100562710 | Ga0070665_1005627102 | 198 |
| 190 | 3300005563 | Ga0068855_100003513 | Ga0068855_1000035139 | 198 |
| 191 | 3300005563 | Ga0068855_100147510 | Ga0068855_1001475104 | 198 |
| 192 | 3300005563 | Ga0068855_100292843 | Ga0068855_1002928433 | 198 |
| 193 | 3300005564 | Ga0070664_100033363 | Ga0070664_1000333631 | 198 |
| 194 | 3300005564 | Ga0070664_100049662 | Ga0070664_1000496623 | 198 |
| 195 | 3300005564 | Ga0070664_100686052 | Ga0070664_1006860522 | 198 |
| 196 | 3300005577 | Ga0068857_100000026 | Ga0068857_10000002614 | 198 |
| 197 | 3300005578 | Ga0068854_100000320 | Ga0068854_10000032020 | 198 |
| 198 | 3300005578 | Ga0068854_100562333 | Ga0068854_1005623332 | 198 |
| 199 | 3300005614 | Ga0068856_100385709 | Ga0068856_1003857092 | 198 |
| 200 | 3300005616 | Ga0068852_100004133 | Ga0068852_10000413313 | 198 |
| 201 | 3300005616 | Ga0068852_100060939 | Ga0068852_1000609392 | 198 |
| 202 | 3300005616 | Ga0068852_100214487 | Ga0068852_1002144872 | 198 |
| 203 | 3300005616 | Ga0068852_100223658 | Ga0068852_1002236583 | 198 |
| 204 | 3300005618 | Ga0068864_100000047 | Ga0068864_10000004784 | 198 |
| 205 | 3300005618 | Ga0068864_100305204 | Ga0068864_1003052042 | 198 |
| 206 | 3300005719 | Ga0068861_100086293 | Ga0068861_1000862933 | 198 |
| 207 | 3300005834 | Ga0068851_10137886 | Ga0068851_101378862 | 198 |
| 208 | 3300005841 | Ga0068863_100000484 | Ga0068863_10000048439 | 198 |
| 209 | 3300005841 | Ga0068863_100424657 | Ga0068863_1004246571 | 198 |
| 210 | 3300005842 | Ga0068858_100003246 | Ga0068858_10000324613 | 198 |
| 211 | 3300005843 | Ga0068860_100005960 | Ga0068860_10000596013 | 198 |
| 212 | 3300005844 | Ga0068862_100185518 | Ga0068862_1001855181 | 198 |
| 213 | 3300005844 | Ga0068862_100649312 | Ga0068862_1006493123 | 198 |
| 214 | 3300006881 | Ga0068865_100001643 | Ga0068865_1000016432 | 198 |
| 215 | 3300006881 | Ga0068865_100079798 | Ga0068865_1000797983 | 198 |
| 216 | 3300009098 | Ga0105245_10000062 | Ga0105245_10000062115 | 198 |
| 217 | 3300009148 | Ga0105243_10616774 | Ga0105243_106167743 | 198 |
| 218 | 3300009174 | Ga0105241_10015388 | Ga0105241_100153883 | 198 |
| 219 | 3300009177 | Ga0105248_10003791 | Ga0105248_100037917 | 198 |
| 220 | 3300009551 | Ga0105238_10022775 | Ga0105238_100227753 | 198 |
| 221 | 3300009551 | Ga0105238_10067883 | Ga0105238_100678835 | 198 |
| 222 | 3300010375 | Ga0105239_10122624 | Ga0105239_101226242 | 198 |
| 223 | 3300010375 | Ga0105239_10569724 | Ga0105239_105697242 | 198 |
| 224 | 3300011119 | Ga0105246_10017038 | Ga0105246_100170384 | 198 |
| 225 | 3300013100 | Ga0157373_10007219 | Ga0157373_100072199 | 198 |
| 226 | 3300013100 | Ga0157373_10285372 | Ga0157373_102853723 | 198 |
| 227 | 3300013100 | Ga0157373_10305559 | Ga0157373_103055592 | 198 |
| 228 | 3300013100 | Ga0157373_10814648 | Ga0157373_108146481 | 198 |
| 229 | 3300013102 | Ga0157371_10000144 | Ga0157371_1000014421 | 198 |
| 230 | 3300013102 | Ga0157371_10092570 | Ga0157371_100925704 | 198 |
| 231 | 3300013102 | Ga0157371_10095324 | Ga0157371_100953242 | 198 |
| 232 | 3300013297 | Ga0157378_10002137 | Ga0157378_1000213713 | 198 |
| 233 | 3300013306 | Ga0163162_10106846 | Ga0163162_101068464 | 198 |
| 234 | 3300013307 | Ga0157372_10116014 | Ga0157372_101160143 | 198 |
| 235 | 3300013307 | Ga0157372_10670432 | Ga0157372_106704321 | 198 |
| 236 | 3300013308 | Ga0157375_10191946 | Ga0157375_101919463 | 198 |
| 237 | 3300013308 | Ga0157375_10324296 | Ga0157375_103242963 | 198 |
| 238 | 3300025315 | Ga0207697_10000328 | Ga0207697_1000032818 | 198 |
| 239 | 3300025321 | Ga0207656_10069076 | Ga0207656_100690762 | 198 |
| 240 | 3300025893 | Ga0207682_10014912 | Ga0207682_100149124 | 198 |
| 241 | 3300025893 | Ga0207682_10027252 | Ga0207682_100272523 | 198 |
| 242 | 3300025893 | Ga0207682_10123193 | Ga0207682_101231933 | 198 |
| 243 | 3300025901 | Ga0207688_10000019 | Ga0207688_1000001940 | 198 |
| 244 | 3300025903 | Ga0207680_10046653 | Ga0207680_100466533 | 198 |
| 245 | 3300025903 | Ga0207680_10177217 | Ga0207680_101772173 | 198 |
| 246 | 3300025904 | Ga0207647_10000822 | Ga0207647_1000082222 | 198 |
| 247 | 3300025907 | Ga0207645_10052730 | Ga0207645_100527303 | 198 |
| 248 | 3300025909 | Ga0207705_10023703 | Ga0207705_100237037 | 198 |
| 249 | 3300025909 | Ga0207705_10258489 | Ga0207705_102584892 | 198 |
| 250 | 3300025911 | Ga0207654_10019595 | Ga0207654_100195954 | 198 |
| 251 | 3300025919 | Ga0207657_10002521 | Ga0207657_100025214 | 198 |
| 252 | 3300025919 | Ga0207657_10004541 | Ga0207657_1000454115 | 198 |
| 253 | 3300025920 | Ga0207649_10131194 | Ga0207649_101311942 | 198 |
| 254 | 3300025920 | Ga0207649_10666168 | Ga0207649_106661682 | 198 |
| 255 | 3300025921 | Ga0207652_10827232 | Ga0207652_108272321 | 198 |
| 256 | 3300025923 | Ga0207681_10000489 | Ga0207681_1000048919 | 198 |
| 257 | 3300025923 | Ga0207681_10212421 | Ga0207681_102124213 | 198 |
| 258 | 3300025924 | Ga0207694_10154558 | Ga0207694_101545582 | 198 |
| 259 | 3300025925 | Ga0207650_10004793 | Ga0207650_100047939 | 198 |
| 260 | 3300025925 | Ga0207650_10014807 | Ga0207650_100148073 | 198 |
| 261 | 3300025925 | Ga0207650_10153103 | Ga0207650_101531031 | 198 |
| 262 | 3300025926 | Ga0207659_10114612 | Ga0207659_101146123 | 198 |
| 263 | 3300025926 | Ga0207659_10126240 | Ga0207659_101262403 | 198 |
| 264 | 3300025927 | Ga0207687_10000424 | Ga0207687_1000042436 | 198 |
| 265 | 3300025931 | Ga0207644_10014702 | Ga0207644_100147022 | 198 |
| 266 | 3300025932 | Ga0207690_10367743 | Ga0207690_103677431 | 198 |
| 267 | 3300025932 | Ga0207690_10467227 | Ga0207690_104672272 | 198 |
| 268 | 3300025932 | Ga0207690_10581764 | Ga0207690_105817641 | 198 |
| 269 | 3300025933 | Ga0207706_10000020 | Ga0207706_1000002085 | 198 |
| 270 | 3300025933 | Ga0207706_10012530 | Ga0207706_100125304 | 198 |
| 271 | 3300025933 | Ga0207706_10018244 | Ga0207706_100182446 | 198 |
| 272 | 3300025933 | Ga0207706_10276125 | Ga0207706_102761251 | 198 |
| 273 | 3300025934 | Ga0207686_10121474 | Ga0207686_101214742 | 198 |
| 274 | 3300025936 | Ga0207670_10281977 | Ga0207670_102819772 | 198 |
| 275 | 3300025937 | Ga0207669_10032659 | Ga0207669_100326593 | 198 |
| 276 | 3300025937 | Ga0207669_10250804 | Ga0207669_102508042 | 198 |
| 277 | 3300025937 | Ga0207669_10385522 | Ga0207669_103855223 | 198 |
| 278 | 3300025938 | Ga0207704_10093784 | Ga0207704_100937843 | 198 |
| 279 | 3300025940 | Ga0207691_10000047 | Ga0207691_1000004798 | 198 |
| 280 | 3300025940 | Ga0207691_10055188 | Ga0207691_100551886 | 198 |
| 281 | 3300025940 | Ga0207691_10211247 | Ga0207691_102112472 | 198 |
| 282 | 3300025941 | Ga0207711_10007486 | Ga0207711_100074867 | 198 |
| 283 | 3300025942 | Ga0207689_10000002 | Ga0207689_1000000298 | 198 |
| 284 | 3300025945 | Ga0207679_10308856 | Ga0207679_103088563 | 198 |
| 285 | 3300025945 | Ga0207679_10809783 | Ga0207679_108097832 | 198 |
| 286 | 3300025949 | Ga0207667_10099756 | Ga0207667_100997562 | 198 |
| 287 | 3300025949 | Ga0207667_10257859 | Ga0207667_102578592 | 198 |
| 288 | 3300025949 | Ga0207667_10434397 | Ga0207667_104343973 | 198 |
| 289 | 3300025960 | Ga0207651_10000387 | Ga0207651_1000038721 | 198 |
| 290 | 3300025960 | Ga0207651_10394098 | Ga0207651_103940982 | 198 |
| 291 | 3300025960 | Ga0207651_10681762 | Ga0207651_106817622 | 198 |
| 292 | 3300025972 | Ga0207668_10043239 | Ga0207668_100432393 | 198 |
| 293 | 3300025972 | Ga0207668_10084211 | Ga0207668_100842114 | 198 |
| 294 | 3300025981 | Ga0207640_10006259 | Ga0207640_100062593 | 198 |
| 295 | 3300025981 | Ga0207640_10437483 | Ga0207640_104374832 | 198 |
| 296 | 3300025986 | Ga0207658_10228203 | Ga0207658_102282032 | 198 |
| 297 | 3300025986 | Ga0207658_10291518 | Ga0207658_102915181 | 198 |
| 298 | 3300026023 | Ga0207677_10002499 | Ga0207677_100024997 | 198 |
| 299 | 3300026023 | Ga0207677_10241191 | Ga0207677_102411913 | 198 |
| 300 | 3300026023 | Ga0207677_10691253 | Ga0207677_106912532 | 198 |
| 301 | 3300026035 | Ga0207703_10028409 | Ga0207703_100284093 | 198 |
| 302 | 3300026041 | Ga0207639_10016940 | Ga0207639_100169402 | 198 |
| 303 | 3300026067 | Ga0207678_10000879 | Ga0207678_1000087924 | 198 |
| 304 | 3300026067 | Ga0207678_10193582 | Ga0207678_101935822 | 198 |
| 305 | 3300026067 | Ga0207678_10724498 | Ga0207678_107244982 | 198 |
| 306 | 3300026088 | Ga0207641_10071176 | Ga0207641_100711763 | 198 |
| 307 | 3300026088 | Ga0207641_10151085 | Ga0207641_101510853 | 198 |
| 308 | 3300026089 | Ga0207648_10002019 | Ga0207648_1000201916 | 198 |
| 309 | 3300026089 | Ga0207648_10230472 | Ga0207648_102304723 | 198 |
| 310 | 3300026095 | Ga0207676_10007306 | Ga0207676_100073064 | 198 |
| 311 | 3300026116 | Ga0207674_10002120 | Ga0207674_100021205 | 198 |
| 312 | 3300026116 | Ga0207674_10003128 | Ga0207674_1000312814 | 198 |
| 313 | 3300026116 | Ga0207674_10003428 | Ga0207674_1000342813 | 198 |
| 314 | 3300026121 | Ga0207683_10230333 | Ga0207683_102303333 | 198 |
| 315 | 3300026142 | Ga0207698_10009531 | Ga0207698_100095313 | 198 |
| 316 | 3300026142 | Ga0207698_10396186 | Ga0207698_103961862 | 198 |
| 317 | 3300028379 | Ga0268266_10021362 | Ga0268266_100213623 | 198 |
| 318 | 3300028379 | Ga0268266_10152938 | Ga0268266_101529382 | 198 |
| 319 | 3300028379 | Ga0268266_10600505 | Ga0268266_106005051 | 198 |
| 320 | 3300028380 | Ga0268265_10023775 | Ga0268265_100237753 | 198 |
| 321 | 3300028380 | Ga0268265_10165579 | Ga0268265_101655792 | 198 |
| 322 | 3300028381 | Ga0268264_10025243 | Ga0268264_100252435 | 198 |
| 323 | 3300031548 | Ga0307408_100148376 | Ga0307408_1001483762 | 198 |
| 324 | 3300031548 | Ga0307408_100257847 | Ga0307408_1002578473 | 198 |
| 325 | 3300031731 | Ga0307405_10009268 | Ga0307405_100092682 | 198 |
| 326 | 3300031731 | Ga0307405_10088429 | Ga0307405_100884292 | 198 |
| 327 | 3300031731 | Ga0307405_10384894 | Ga0307405_103848942 | 198 |
| 328 | 3300031824 | Ga0307413_10004530 | Ga0307413_100045304 | 198 |
| 329 | 3300031824 | Ga0307413_10054404 | Ga0307413_100544042 | 198 |
| 330 | 3300031824 | Ga0307413_10057228 | Ga0307413_100572283 | 198 |
| 331 | 3300031852 | Ga0307410_10000938 | Ga0307410_100009383 | 198 |
| 332 | 3300031852 | Ga0307410_10002679 | Ga0307410_1000267913 | 198 |
| 333 | 3300031852 | Ga0307410_10002846 | Ga0307410_1000284610 | 198 |
| 334 | 3300031852 | Ga0307410_10147973 | Ga0307410_101479732 | 198 |
| 335 | 3300031903 | Ga0307407_10097068 | Ga0307407_100970681 | 198 |
| 336 | 3300031903 | Ga0307407_10243185 | Ga0307407_102431852 | 198 |
| 337 | 3300031911 | Ga0307412_10010674 | Ga0307412_100106745 | 198 |
| 338 | 3300031911 | Ga0307412_10235242 | Ga0307412_102352422 | 198 |
| 339 | 3300031911 | Ga0307412_10877813 | Ga0307412_108778131 | 198 |
| 340 | 3300031995 | Ga0307409_100007093 | Ga0307409_1000070932 | 198 |
| 341 | 3300032002 | Ga0307416_100014342 | Ga0307416_1000143427 | 198 |
| 342 | 3300032002 | Ga0307416_100033005 | Ga0307416_1000330056 | 198 |
| 343 | 3300032002 | Ga0307416_100284964 | Ga0307416_1002849643 | 198 |
| 344 | 3300032002 | Ga0307416_100707588 | Ga0307416_1007075882 | 198 |
| 345 | 3300032004 | Ga0307414_10003436 | Ga0307414_100034362 | 198 |
| 346 | 3300032004 | Ga0307414_10043418 | Ga0307414_100434182 | 198 |
| 347 | 3300032004 | Ga0307414_10044479 | Ga0307414_100444794 | 198 |
| 348 | 3300032004 | Ga0307414_10720886 | Ga0307414_107208861 | 198 |
| 349 | 3300032005 | Ga0307411_10004374 | Ga0307411_100043744 | 198 |
| 350 | 3300032005 | Ga0307411_10005073 | Ga0307411_100050732 | 198 |
| 351 | 3300032005 | Ga0307411_10012563 | Ga0307411_100125632 | 198 |
| 352 | 3300032005 | Ga0307411_10245588 | Ga0307411_102455882 | 198 |
| 353 | 3300032005 | Ga0307411_10340164 | Ga0307411_103401643 | 198 |
| 354 | 3300032126 | Ga0307415_100002188 | Ga0307415_1000021887 | 198 |
| 355 | 3300032126 | Ga0307415_100021786 | Ga0307415_1000217863 | 198 |
| 356 | 3300032126 | Ga0307415_100690116 | Ga0307415_1006901162 | 198 |
| 357 | 3300037312 | Ga0395899_0020913 | Ga0395899_0020913_962_1558 | 198 |
| 358 | 3300037418 | Ga0395900_0079384 | Ga0395900_0079384_2419_3015 | 198 |
| 359 | 3300037466 | Ga0395898_0289989 | Ga0395898_0289989_76_672 | 198 |
| 360 | 3300037471 | Ga0395905_0007559 | Ga0395905_0007559_133_729 | 198 |
| 361 | 3300037471 | Ga0395905_0011136 | Ga0395905_0011136_294_890 | 198 |
| 362 | 3300037471 | Ga0395905_0029219 | Ga0395905_0029219_3887_4483 | 198 |
| 363 | 3300037471 | Ga0395905_0080514 | Ga0395905_0080514_2006_2602 | 198 |
| 364 | 3300037471 | Ga0395905_0284029 | Ga0395905_0284029_164_760 | 198 |
| 365 | 3300038443 | Ga0395901_0068752 | Ga0395901_0068752_2320_2916 | 198 |
| 366 | 3300038443 | Ga0395901_0140279 | Ga0395901_0140279_176_772 | 198 |
| 367 | 3300038443 | Ga0395901_0331438 | Ga0395901_0331438_295_891 | 198 |
| 368 | 3300044694 | Ga0466963_0039408 | Ga0466963_0039408_493_1089 | 198 |
| 369 | 3300044842 | Ga0466957_0085185 | Ga0466957_0085185_573_1169 | 198 |
| 370 | 3300045836 | Ga0466958_0026099 | Ga0466958_0026099_2482_3078 | 198 |
| 371 | 3300045836 | Ga0466958_0031466 | Ga0466958_0031466_179_775 | 198 |
| 372 | 3300045976 | Ga0466967_0348307 | Ga0466967_0348307_705_1301 | 198 |
| 373 | 3300045976 | Ga0466967_0413607 | Ga0466967_0413607_409_1005 | 198 |
| 374 | 3300046539 | Ga0495621_0014652 | Ga0495621_0014652_887_1483 | 198 |
| 375 | 3300046616 | Ga0495668_0043278 | Ga0495668_0043278_1686_2282 | 198 |
| 376 | 3300048911 | Ga0496108_0000229 | Ga0496108_0000229_2068_2664 | 198 |
| 377 | 3300048911 | Ga0496108_0265819 | Ga0496108_0265819_408_1004 | 198 |
| 378 | 3300048912 | Ga0496109_0025022 | Ga0496109_0025022_4139_4735 | 198 |
| 379 | 3300049586 | Ga0501070_0308218 | Ga0501070_0308218_47_643 | 198 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oc6-assembly2.cif.gz_B | crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution | 0.7401 | 7 | 115 |
| 2kl4-assembly1.cif.gz_A | nmr structure of the protein nb7804a | 0.7269 | 6 | 115 |
| 2kl4-assembly1.cif.gz_A | nmr structure of the protein nb7804a | 0.6804 | 6 | 115 |
| 2oc6-assembly2.cif.gz_B | crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution | 0.6596 | 7 | 115 |
| 6oyc-assembly4.cif.gz_A | glycosylation associate protein (gap123) complex from streptococcus agalactiae | 0.5855 | 36 | 68 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2i8dB01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7806 | 8 | 68 | 3.90.1150.200 |
| af_Q2FVG5_6_119_3.90.1150.200 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7679 | 3 | 110 | 3.90.1150.200 |
| af_Q2FVG5_6_119_3.90.1150.200 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7259 | 3 | 110 | 3.90.1150.200 |
| 2oc6B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.7162 | 7 | 116 | 3.90.1150.200 |
| 2oc6B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; | 0.6954 | 7 | 116 | 3.90.1150.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q4CJD5-F1-model_v4 | DUF1801 domain-containing protein | 0.9601 | 8 | 67 |
|
| AF-A0A538AZV3-F1-model_v4 | YdhG-like domain-containing protein | 0.94 | 7 | 68 |
|
| AF-A0A6I3DMJ4-F1-model_v4 | deleted | 0.9367 | 4 | 73 |
|
| AF-A0A7C2RHI1-F1-model_v4 | Bacteriocin-protection protein | 0.9277 | 120 | 188 |
|
| AF-A0A3D4IUR1-F1-model_v4 | deleted | 0.9275 | 8 | 70 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar