F428085

General Info

Members Datasets Scaffolds Average Seq Length
378 132 756 136

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0841194|Ga0436364_0841194_93_551
Length 152
Sequence MVFATLATLVAASASPTPIEGNWKNPIGSAIIAIEPCGDKLCGKVVWASARGEREVAQNTRQIVGTTVLTGLRRDGSQWTGSLYIPDDDIHVTAHLRPLGRDQLRLTGCGLIGLICRTQMWTRYDGSLPPRPGSGSSLRKLSVRFPPQIQAR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
103 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.41
Rhizosphere 91.01
Stem 0
Stem Tuber 0
Unclassified 19.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0841194 3300037853 Bacteria 653
2 JGI24740J21852_10045529 3300001979 Bacteria 1294
3 JGI24737J22298_10075199 3300001990 Unclassified 1007
4 rootH1_10007403 3300003323 Archaea 1383
5 Ga0070658_10020445 3300005327 Bacteria 5306
6 Ga0070658_10028762 3300005327 Bacteria 4462
7 Ga0070658_10030925 3300005327 Bacteria 4300
8 Ga0070658_10309224 3300005327 Bacteria 1348
9 Ga0070683_100048294 3300005329 Bacteria 3935
10 Ga0070683_100304292 3300005329 Bacteria 1517
11 Ga0070683_100711190 3300005329 Unclassified 962
12 Ga0070690_100445585 3300005330 Unclassified 959
13 Ga0070670_100000265 3300005331 Bacteria 46560
14 Ga0070666_10022623 3300005335 Bacteria 4083
15 Ga0070666_10070379 3300005335 Bacteria 2380
16 Ga0070680_100001341 3300005336 Bacteria 17830
17 Ga0070680_100018750 3300005336 Bacteria 5475
18 Ga0070680_100024831 3300005336 Bacteria 4790
19 Ga0068868_100081379 3300005338 Bacteria 2596
20 Ga0070660_100007559 3300005339 Bacteria 7573
21 Ga0070660_100011046 3300005339 Bacteria 6402
22 Ga0070660_100031300 3300005339 Bacteria 3995
23 Ga0070660_100340690 3300005339 Bacteria 1234
24 Ga0070660_100652523 3300005339 Unclassified 881
25 Ga0070660_101759942 3300005339 Unclassified 528
26 Ga0070661_100031821 3300005344 Bacteria 3816
27 Ga0070661_100095881 3300005344 Unclassified 2201
28 Ga0070661_101442472 3300005344 Unclassified 580
29 Ga0070668_100330037 3300005347 Bacteria 1286
30 Ga0070671_100000722 3300005355 Bacteria 23671
31 Ga0070671_100011780 3300005355 Bacteria 7034
32 Ga0070671_100034878 3300005355 Bacteria 4166
33 Ga0070671_100340971 3300005355 Bacteria 1278
34 Ga0070674_100010136 3300005356 Bacteria 5678
35 Ga0070674_100334400 3300005356 Unclassified 1218
36 Ga0070673_100368527 3300005364 Bacteria 1278
37 Ga0070659_100371102 3300005366 Bacteria 1204
38 Ga0070659_100436465 3300005366 Bacteria 1109
39 Ga0070659_100444080 3300005366 Bacteria 1099
40 Ga0070659_100561297 3300005366 Bacteria 978
41 Ga0070667_100025812 3300005367 Bacteria 4886
42 Ga0070667_101416378 3300005367 Unclassified 652
43 Ga0070667_101985252 3300005367 Unclassified 548
44 Ga0070709_10703043 3300005434 Bacteria 787
45 Ga0070714_100013344 3300005435 Bacteria 6585
46 Ga0070714_100125433 3300005435 Bacteria 2288
47 Ga0070714_100285537 3300005435 Bacteria 1534
48 Ga0070714_100621251 3300005435 Unclassified 1039
49 Ga0070714_102016468 3300005435 Unclassified 563
50 Ga0070714_102226966 3300005435 Unclassified 533
51 Ga0070713_100024051 3300005436 Bacteria 4738
52 Ga0070713_100362728 3300005436 Bacteria 1346
53 Ga0070663_100017252 3300005455 Bacteria 4707
54 Ga0070663_100271472 3300005455 Bacteria 1348
55 Ga0070663_100320736 3300005455 Bacteria 1246
56 Ga0070678_100001905 3300005456 Bacteria 11243
57 Ga0070678_100036804 3300005456 Bacteria 3429
58 Ga0070662_100009647 3300005457 Bacteria 6315
59 Ga0070662_100025041 3300005457 Bacteria 4117
60 Ga0070662_100231933 3300005457 Bacteria 1477
61 Ga0070681_10171640 3300005458 Bacteria 2090
62 Ga0070679_100098338 3300005530 Bacteria 2914
63 Ga0070679_100179932 3300005530 Bacteria 2087
64 Ga0070679_101306257 3300005530 Bacteria 671
65 Ga0070684_100527264 3300005535 Unclassified 1095
66 Ga0070684_100571808 3300005535 Bacteria 1050
67 Ga0070684_100582030 3300005535 Bacteria 1040
68 Ga0070672_100027075 3300005543 Bacteria 4274
69 Ga0070672_100086654 3300005543 Bacteria 2519
70 Ga0070665_100074680 3300005548 Bacteria 3396
71 Ga0070665_100191039 3300005548 Bacteria 2049
72 Ga0070665_102289846 3300005548 Unclassified 543
73 Ga0068855_100334695 3300005563 Bacteria 1670
74 Ga0068855_100391915 3300005563 Bacteria 1523
75 Ga0068855_100448588 3300005563 Bacteria 1408
76 Ga0068855_102359425 3300005563 Unclassified 531
77 Ga0070664_100072824 3300005564 Bacteria 2947
78 Ga0068854_100060805 3300005578 Bacteria 2734
79 Ga0068854_100214860 3300005578 Bacteria 1519
80 Ga0068854_100945867 3300005578 Unclassified 760
81 Ga0068854_101286473 3300005578 Unclassified 658
82 Ga0068856_100024428 3300005614 Bacteria 5883
83 Ga0068856_100337754 3300005614 Bacteria 1524
84 Ga0068856_100640709 3300005614 Unclassified 1083
85 Ga0068856_100984583 3300005614 Bacteria 862
86 Ga0068856_102366447 3300005614 Bacteria 539
87 Ga0068852_100008710 3300005616 Bacteria 7497
88 Ga0068852_100031737 3300005616 Bacteria 4365
89 Ga0068852_100124187 3300005616 Bacteria 2368
90 Ga0068852_100183762 3300005616 Bacteria 1968
91 Ga0068852_100224771 3300005616 Bacteria 1787
92 Ga0068852_100591024 3300005616 Bacteria 1114
93 Ga0068852_100695905 3300005616 Bacteria 1026
94 Ga0068852_101254986 3300005616 Unclassified 762
95 Ga0068852_102403935 3300005616 Unclassified 547
96 Ga0068864_100036201 3300005618 Bacteria 4205
97 Ga0068864_100059639 3300005618 Bacteria 3302
98 Ga0068863_100038266 3300005841 Bacteria 4564
99 Ga0068863_100421694 3300005841 Unclassified 1307
100 Ga0068858_100002927 3300005842 Bacteria 17178
101 Ga0068860_100128271 3300005843 Bacteria 2432
102 Ga0070717_10000431 3300006028 Bacteria 26731
103 Ga0070716_100057383 3300006173 Bacteria 2237
104 Ga0097621_100048503 3300006237 Bacteria 3446
105 Ga0068871_100022750 3300006358 Bacteria 4837
106 Ga0068871_100063784 3300006358 Bacteria 3014
107 Ga0068871_100491364 3300006358 Unclassified 1105
108 Ga0105240_10458614 3300009093 Bacteria 1425
109 Ga0105248_10082477 3300009177 Bacteria 3616
110 Ga0105248_10089375 3300009177 Bacteria 3467
111 Ga0105248_10091083 3300009177 Bacteria 3434
112 Ga0105248_10201949 3300009177 Bacteria 2240
113 Ga0105248_11874194 3300009177 Unclassified 680
114 Ga0105237_10878618 3300009545 Unclassified 903
115 Ga0105237_11623145 3300009545 Unclassified 654
116 Ga0105239_10700386 3300010375 Bacteria 1158
117 Ga0105239_12691842 3300010375 Unclassified 580
118 Ga0157373_10104177 3300013100 Bacteria 1995
119 Ga0157373_10200308 3300013100 Bacteria 1407
120 Ga0157373_10515672 3300013100 Bacteria 865
121 Ga0157373_11294246 3300013100 Unclassified 552
122 Ga0157371_10188796 3300013102 Bacteria 1475
123 Ga0157371_10440571 3300013102 Bacteria 957
124 Ga0157371_10998797 3300013102 Bacteria 638
125 Ga0157370_10016040 3300013104 Bacteria 7597
126 Ga0157370_10462023 3300013104 Bacteria 1167
127 Ga0157370_10478328 3300013104 Bacteria 1144
128 Ga0157369_10147155 3300013105 Bacteria 2490
129 Ga0157369_10524498 3300013105 Unclassified 1225
130 Ga0157369_10562284 3300013105 Bacteria 1178
131 Ga0157369_10796280 3300013105 Bacteria 971
132 Ga0157374_10027384 3300013296 Bacteria 5141
133 Ga0157374_10208153 3300013296 Bacteria 1917
134 Ga0157374_10240464 3300013296 Bacteria 1780
135 Ga0157378_10807452 3300013297 Bacteria 964
136 Ga0163162_10041595 3300013306 Bacteria 4600
137 Ga0157372_10150056 3300013307 Bacteria 2690
138 Ga0157372_10402362 3300013307 Bacteria 1595
139 Ga0157372_11542340 3300013307 Bacteria 765
140 Ga0157372_13181110 3300013307 Unclassified 524
141 Ga0157375_10005824 3300013308 Bacteria 10723
142 Ga0163163_10015399 3300014325 Bacteria 7069
143 Ga0206353_11242695 3300020082 Bacteria 1280
144 Ga0213876_10090673 3300021384 Bacteria 1618
145 Ga0207680_10217578 3300025903 Unclassified 1308
146 Ga0207647_10013726 3300025904 Bacteria 5610
147 Ga0207647_10061688 3300025904 Bacteria 2286
148 Ga0207705_10001727 3300025909 Bacteria 17322
149 Ga0207705_10023027 3300025909 Bacteria 4442
150 Ga0207705_10281463 3300025909 Unclassified 1273
151 Ga0207695_10049410 3300025913 Bacteria 4434
152 Ga0207693_10059413 3300025915 Bacteria 2995
153 Ga0207660_10001743 3300025917 Bacteria 14578
154 Ga0207660_10011479 3300025917 Bacteria 5768
155 Ga0207660_10021018 3300025917 Bacteria 4385
156 Ga0207660_10650704 3300025917 Unclassified 859
157 Ga0207657_10008624 3300025919 Bacteria 10320
158 Ga0207657_10009549 3300025919 Bacteria 9738
159 Ga0207657_10091995 3300025919 Bacteria 2528
160 Ga0207657_10473767 3300025919 Bacteria 982
161 Ga0207657_10965980 3300025919 Bacteria 655
162 Ga0207657_10981287 3300025919 Bacteria 649
163 Ga0207649_10057776 3300025920 Bacteria 2427
164 Ga0207652_10036509 3300025921 Bacteria 4154
165 Ga0207652_10260823 3300025921 Bacteria 1563
166 Ga0207652_10477479 3300025921 Bacteria 1123
167 Ga0207652_10841790 3300025921 Bacteria 813
168 Ga0207650_10001366 3300025925 Bacteria 17614
169 Ga0207700_10049939 3300025928 Bacteria 3114
170 Ga0207700_10098803 3300025928 Bacteria 2323
171 Ga0207664_10044821 3300025929 Bacteria 3465
172 Ga0207664_10049978 3300025929 Bacteria 3295
173 Ga0207664_10338186 3300025929 Bacteria 1331
174 Ga0207664_10610415 3300025929 Bacteria 980
175 Ga0207644_10001903 3300025931 Bacteria 13541
176 Ga0207644_10002431 3300025931 Bacteria 12003
177 Ga0207644_10096135 3300025931 Bacteria 2216
178 Ga0207690_10143376 3300025932 Bacteria 1763
179 Ga0207690_10182390 3300025932 Bacteria 1582
180 Ga0207690_10886779 3300025932 Unclassified 739
181 Ga0207706_10010183 3300025933 Bacteria 8606
182 Ga0207706_10020540 3300025933 Bacteria 5936
183 Ga0207665_10099280 3300025939 Bacteria 2030
184 Ga0207691_10041026 3300025940 Bacteria 4275
185 Ga0207691_10110854 3300025940 Bacteria 2440
186 Ga0207711_10035893 3300025941 Bacteria 4204
187 Ga0207711_10124887 3300025941 Bacteria 2301
188 Ga0207711_10137559 3300025941 Bacteria 2195
189 Ga0207661_10015363 3300025944 Bacteria 5632
190 Ga0207679_10036777 3300025945 Bacteria 3475
191 Ga0207679_10236063 3300025945 Bacteria 1547
192 Ga0207667_10203617 3300025949 Bacteria 2030
193 Ga0207667_10354851 3300025949 Bacteria 1495
194 Ga0207640_10180016 3300025981 Bacteria 1584
195 Ga0207640_10954515 3300025981 Unclassified 752
196 Ga0207658_11529938 3300025986 Unclassified 610
197 Ga0207677_10110038 3300026023 Bacteria 2050
198 Ga0207639_10021637 3300026041 Bacteria 4622
199 Ga0207678_10027507 3300026067 Bacteria 4962
200 Ga0207678_10047054 3300026067 Bacteria 3731
201 Ga0207678_10491730 3300026067 Bacteria 1069
202 Ga0207702_10029709 3300026078 Bacteria 4549
203 Ga0207702_10048153 3300026078 Bacteria 3594
204 Ga0207702_10148507 3300026078 Bacteria 2130
205 Ga0207702_12163720 3300026078 Unclassified 545
206 Ga0207641_10023897 3300026088 Bacteria 5038
207 Ga0207648_11820416 3300026089 Unclassified 571
208 Ga0207676_10041733 3300026095 Bacteria 3524
209 Ga0207676_10048187 3300026095 Bacteria 3307
210 Ga0207674_10067142 3300026116 Bacteria 3611
211 Ga0207683_10013911 3300026121 Bacteria 6861
212 Ga0207683_10034321 3300026121 Bacteria 4408
213 Ga0207698_10008982 3300026142 Bacteria 6343
214 Ga0207698_10153886 3300026142 Bacteria 2000
215 Ga0207698_11025642 3300026142 Unclassified 836
216 Ga0207698_11207572 3300026142 Unclassified 770
217 Ga0207698_11295139 3300026142 Unclassified 743
218 Ga0207698_11763992 3300026142 Unclassified 634
219 Ga0268266_10056120 3300028379 Bacteria 3388
220 Ga0268264_10547021 3300028381 Bacteria 1135
221 Ga0373960_0083541 3300035121 Bacteria 1010
222 Ga0373960_0115421 3300035121 Unclassified 886
223 Ga0395899_0000224 3300037312 Bacteria 76706
224 Ga0395899_0008490 3300037312 Bacteria 7914
225 Ga0395899_0031968 3300037312 Bacteria 3953
226 Ga0395899_0041218 3300037312 Bacteria 3450
227 Ga0395899_0043572 3300037312 Bacteria 3347
228 Ga0395899_0046641 3300037312 Bacteria 3227
229 Ga0395899_0059405 3300037312 Bacteria 2819
230 Ga0395899_0083690 3300037312 Bacteria 2320
231 Ga0395899_0091061 3300037312 Bacteria 2210
232 Ga0395899_0109132 3300037312 Bacteria 1991
233 Ga0395899_0444825 3300037312 Unclassified 850
234 Ga0395900_0000294 3300037418 Bacteria 75260
235 Ga0395900_0001237 3300037418 Bacteria 31404
236 Ga0395900_0004081 3300037418 Bacteria 15571
237 Ga0395900_0028754 3300037418 Bacteria 5698
238 Ga0395900_0035612 3300037418 Bacteria 5127
239 Ga0395900_0058738 3300037418 Bacteria 3959
240 Ga0395900_0076316 3300037418 Bacteria 3444
241 Ga0395900_0079557 3300037418 Bacteria 3368
242 Ga0395900_0086872 3300037418 Bacteria 3214
243 Ga0395900_0098559 3300037418 Bacteria 3003
244 Ga0395900_0099817 3300037418 Bacteria 2982
245 Ga0395900_0132812 3300037418 Bacteria 2550
246 Ga0395900_0141465 3300037418 Bacteria 2464
247 Ga0395900_0156307 3300037418 Bacteria 2329
248 Ga0395900_0203172 3300037418 Bacteria 2004
249 Ga0395900_0265614 3300037418 Bacteria 1712
250 Ga0395900_0376027 3300037418 Bacteria 1389
251 Ga0395900_0478108 3300037418 Bacteria 1198
252 Ga0395900_0548785 3300037418 Unclassified 1100
253 Ga0395900_0647443 3300037418 Bacteria 993
254 Ga0395900_0713143 3300037418 Bacteria 936
255 Ga0395900_0739773 3300037418 Unclassified 914
256 Ga0395898_0001857 3300037466 Bacteria 27083
257 Ga0395898_0007641 3300037466 Bacteria 11477
258 Ga0395898_0010042 3300037466 Bacteria 9910
259 Ga0395898_0067449 3300037466 Bacteria 3463
260 Ga0395898_0071694 3300037466 Bacteria 3347
261 Ga0395898_0090719 3300037466 Bacteria 2940
262 Ga0395898_0336150 3300037466 Bacteria 1440
263 Ga0395898_0367141 3300037466 Bacteria 1372
264 Ga0395898_0379792 3300037466 Bacteria 1347
265 Ga0395898_0553446 3300037466 Bacteria 1092
266 Ga0395898_1031728 3300037466 Unclassified 757
267 Ga0395898_1164600 3300037466 Unclassified 703
268 Ga0395898_1609898 3300037466 Unclassified 573
269 Ga0395905_0000066 3300037471 Bacteria 183121
270 Ga0395905_0000996 3300037471 Bacteria 36252
271 Ga0395905_0003693 3300037471 Bacteria 16206
272 Ga0395905_0019145 3300037471 Bacteria 6492
273 Ga0395905_0043120 3300037471 Bacteria 4232
274 Ga0395905_0059694 3300037471 Bacteria 3565
275 Ga0395905_0065057 3300037471 Bacteria 3413
276 Ga0395905_0069452 3300037471 Bacteria 3299
277 Ga0395905_0140386 3300037471 Bacteria 2273
278 Ga0395905_0146504 3300037471 Bacteria 2221
279 Ga0395905_0218137 3300037471 Bacteria 1786
280 Ga0395905_0276719 3300037471 Bacteria 1564
281 Ga0395905_0462194 3300037471 Bacteria 1167
282 Ga0395905_0470865 3300037471 Bacteria 1155
283 Ga0395905_0481424 3300037471 Unclassified 1140
284 Ga0395905_0663687 3300037471 Bacteria 945
285 Ga0395905_0723611 3300037471 Bacteria 897
286 Ga0395905_0751068 3300037471 Bacteria 878
287 Ga0395905_0755209 3300037471 Unclassified 875
288 Ga0395905_0871970 3300037471 Bacteria 803
289 Ga0395905_0908213 3300037471 Unclassified 783
290 Ga0395905_0959763 3300037471 Bacteria 758
291 Ga0395905_1808627 3300037471 Unclassified 517
292 Ga0436364_0639818 3300037853 Bacteria 785
293 Ga0395901_0002833 3300038443 Bacteria 17513
294 Ga0395901_0006418 3300038443 Bacteria 11917
295 Ga0395901_0016180 3300038443 Bacteria 7597
296 Ga0395901_0026887 3300038443 Bacteria 5907
297 Ga0395901_0055454 3300038443 Bacteria 4121
298 Ga0395901_0092021 3300038443 Bacteria 3175
299 Ga0395901_0118436 3300038443 Bacteria 2782
300 Ga0395901_0155012 3300038443 Bacteria 2406
301 Ga0395901_0176277 3300038443 Bacteria 2242
302 Ga0395901_0275095 3300038443 Bacteria 1751
303 Ga0395901_0368314 3300038443 Unclassified 1480
304 Ga0395901_0410873 3300038443 Bacteria 1389
305 Ga0395901_0432842 3300038443 Bacteria 1347
306 Ga0395901_0482258 3300038443 Bacteria 1264
307 Ga0395901_0660027 3300038443 Bacteria 1048
308 Ga0395901_1040777 3300038443 Bacteria 792
309 Ga0395901_2129268 3300038443 Unclassified 506
310 Ga0436365_0795696 3300039437 Bacteria 1445
311 Ga0436363_1646636 3300039450 Bacteria 1322
312 Ga0439458_0001978 3300042157 Bacteria 5086
313 Ga0466966_0011202 3300044684 Bacteria 5951
314 Ga0466966_0092946 3300044684 Bacteria 1871
315 Ga0466966_0645765 3300044684 Unclassified 637
316 Ga0466961_0006524 3300044693 Bacteria 7416
317 Ga0466961_0040033 3300044693 Bacteria 3004
318 Ga0466961_0218616 3300044693 Bacteria 1175
319 Ga0466961_0689146 3300044693 Unclassified 612
320 Ga0466961_0814036 3300044693 Unclassified 557
321 Ga0466963_0007413 3300044694 Bacteria 6536
322 Ga0466963_0050904 3300044694 Bacteria 2743
323 Ga0466963_0717436 3300044694 Unclassified 705
324 Ga0466963_1059738 3300044694 Bacteria 570
325 Ga0466964_0147520 3300044706 Bacteria 1087
326 Ga0466964_0325215 3300044706 Unclassified 783
327 Ga0466964_0788291 3300044706 Unclassified 536
328 Ga0466971_0144996 3300044719 Bacteria 1107
329 Ga0466971_0217438 3300044719 Unclassified 905
330 Ga0466971_0224044 3300044719 Bacteria 892
331 Ga0466971_0315796 3300044719 Bacteria 752
332 Ga0466957_0004685 3300044842 Bacteria 7650
333 Ga0466957_0281544 3300044842 Bacteria 1113
334 Ga0466959_0013507 3300045049 Bacteria 5918
335 Ga0466959_0134442 3300045049 Bacteria 1751
336 Ga0466959_0291294 3300045049 Unclassified 1119
337 Ga0466959_0913779 3300045049 Unclassified 585
338 Ga0466967_0017865 3300045976 Bacteria 5649
339 Ga0466967_0128961 3300045976 Bacteria 2346
340 Ga0466967_0258008 3300045976 Bacteria 1667
341 Ga0466967_1072270 3300045976 Unclassified 802
342 Ga0466967_2162924 3300045976 Unclassified 552
343 Ga0495629_0515544 3300046459 Unclassified 805
344 Ga0495643_0090035 3300046522 Bacteria 1584
345 Ga0495668_0058292 3300046616 Bacteria 2131
346 Ga0495669_0215149 3300046684 Bacteria 920
347 Ga0495683_0283570 3300047323 Unclassified 716
348 Ga0496100_0886427 3300048903 Unclassified 700
349 Ga0496100_1069379 3300048903 Bacteria 635
350 Ga0496100_1525082 3300048903 Bacteria 528
351 Ga0496101_0075045 3300048904 Bacteria 2488
352 Ga0496101_0165627 3300048904 Bacteria 1697
353 Ga0496102_0075060 3300048905 Bacteria 3108
354 Ga0496103_0158941 3300048906 Bacteria 1449
355 Ga0496106_0114779 3300048909 Bacteria 2100
356 Ga0496107_0072409 3300048910 Bacteria 2505
357 Ga0496107_0332661 3300048910 Bacteria 1130
358 Ga0496108_0008525 3300048911 Bacteria 8314
359 Ga0496108_0050764 3300048911 Bacteria 3473
360 Ga0496108_0725315 3300048911 Bacteria 861
361 Ga0496109_0102402 3300048912 Bacteria 2657
362 Ga0496109_1128725 3300048912 Unclassified 721
363 Ga0496110_0247203 3300048913 Unclassified 1623
364 Ga0496111_0154380 3300048914 Bacteria 1703
365 Ga0496112_0033237 3300048915 Bacteria 5012
366 Ga0496112_0064436 3300048915 Bacteria 3616
367 Ga0496112_0659634 3300048915 Unclassified 975
368 Ga0496112_1810317 3300048915 Unclassified 522
369 Ga0496112_1829070 3300048915 Unclassified 519
370 Ga0496113_0019254 3300048916 Bacteria 4771
371 Ga0496113_0102689 3300048916 Bacteria 2217
372 Ga0496113_0791933 3300048916 Unclassified 753
373 Ga0496114_0002108 3300048917 Bacteria 15105
374 Ga0496114_0019041 3300048917 Bacteria 5562
375 Ga0496115_0104153 3300048918 Bacteria 2328
376 Ga0495655_0001615 3300053083 Bacteria 3478
377 Ga0466962_0105161 3300061719 Bacteria 1357
378 Ga0466962_0285078 3300061719 Bacteria 816
379 Ga0436364_0841194
380 JGI24740J21852_10045529
381 JGI24737J22298_10075199
382 rootH1_10007403
383 Ga0070658_10020445
384 Ga0070658_10028762
385 Ga0070658_10030925
386 Ga0070658_10309224
387 Ga0070683_100048294
388 Ga0070683_100304292
389 Ga0070683_100711190
390 Ga0070690_100445585
391 Ga0070670_100000265
392 Ga0070666_10022623
393 Ga0070666_10070379
394 Ga0070680_100001341
395 Ga0070680_100018750
396 Ga0070680_100024831
397 Ga0068868_100081379
398 Ga0070660_100007559
399 Ga0070660_100011046
400 Ga0070660_100031300
401 Ga0070660_100340690
402 Ga0070660_100652523
403 Ga0070660_101759942
404 Ga0070661_100031821
405 Ga0070661_100095881
406 Ga0070661_101442472
407 Ga0070668_100330037
408 Ga0070671_100000722
409 Ga0070671_100011780
410 Ga0070671_100034878
411 Ga0070671_100340971
412 Ga0070674_100010136
413 Ga0070674_100334400
414 Ga0070673_100368527
415 Ga0070659_100371102
416 Ga0070659_100436465
417 Ga0070659_100444080
418 Ga0070659_100561297
419 Ga0070667_100025812
420 Ga0070667_101416378
421 Ga0070667_101985252
422 Ga0070709_10703043
423 Ga0070714_100013344
424 Ga0070714_100125433
425 Ga0070714_100285537
426 Ga0070714_100621251
427 Ga0070714_102016468
428 Ga0070714_102226966
429 Ga0070713_100024051
430 Ga0070713_100362728
431 Ga0070663_100017252
432 Ga0070663_100271472
433 Ga0070663_100320736
434 Ga0070678_100001905
435 Ga0070678_100036804
436 Ga0070662_100009647
437 Ga0070662_100025041
438 Ga0070662_100231933
439 Ga0070681_10171640
440 Ga0070679_100098338
441 Ga0070679_100179932
442 Ga0070679_101306257
443 Ga0070684_100527264
444 Ga0070684_100571808
445 Ga0070684_100582030
446 Ga0070672_100027075
447 Ga0070672_100086654
448 Ga0070665_100074680
449 Ga0070665_100191039
450 Ga0070665_102289846
451 Ga0068855_100334695
452 Ga0068855_100391915
453 Ga0068855_100448588
454 Ga0068855_102359425
455 Ga0070664_100072824
456 Ga0068854_100060805
457 Ga0068854_100214860
458 Ga0068854_100945867
459 Ga0068854_101286473
460 Ga0068856_100024428
461 Ga0068856_100337754
462 Ga0068856_100640709
463 Ga0068856_100984583
464 Ga0068856_102366447
465 Ga0068852_100008710
466 Ga0068852_100031737
467 Ga0068852_100124187
468 Ga0068852_100183762
469 Ga0068852_100224771
470 Ga0068852_100591024
471 Ga0068852_100695905
472 Ga0068852_101254986
473 Ga0068852_102403935
474 Ga0068864_100036201
475 Ga0068864_100059639
476 Ga0068863_100038266
477 Ga0068863_100421694
478 Ga0068858_100002927
479 Ga0068860_100128271
480 Ga0070717_10000431
481 Ga0070716_100057383
482 Ga0097621_100048503
483 Ga0068871_100022750
484 Ga0068871_100063784
485 Ga0068871_100491364
486 Ga0105240_10458614
487 Ga0105248_10082477
488 Ga0105248_10089375
489 Ga0105248_10091083
490 Ga0105248_10201949
491 Ga0105248_11874194
492 Ga0105237_10878618
493 Ga0105237_11623145
494 Ga0105239_10700386
495 Ga0105239_12691842
496 Ga0157373_10104177
497 Ga0157373_10200308
498 Ga0157373_10515672
499 Ga0157373_11294246
500 Ga0157371_10188796
501 Ga0157371_10440571
502 Ga0157371_10998797
503 Ga0157370_10016040
504 Ga0157370_10462023
505 Ga0157370_10478328
506 Ga0157369_10147155
507 Ga0157369_10524498
508 Ga0157369_10562284
509 Ga0157369_10796280
510 Ga0157374_10027384
511 Ga0157374_10208153
512 Ga0157374_10240464
513 Ga0157378_10807452
514 Ga0163162_10041595
515 Ga0157372_10150056
516 Ga0157372_10402362
517 Ga0157372_11542340
518 Ga0157372_13181110
519 Ga0157375_10005824
520 Ga0163163_10015399
521 Ga0206353_11242695
522 Ga0213876_10090673
523 Ga0207680_10217578
524 Ga0207647_10013726
525 Ga0207647_10061688
526 Ga0207705_10001727
527 Ga0207705_10023027
528 Ga0207705_10281463
529 Ga0207695_10049410
530 Ga0207693_10059413
531 Ga0207660_10001743
532 Ga0207660_10011479
533 Ga0207660_10021018
534 Ga0207660_10650704
535 Ga0207657_10008624
536 Ga0207657_10009549
537 Ga0207657_10091995
538 Ga0207657_10473767
539 Ga0207657_10965980
540 Ga0207657_10981287
541 Ga0207649_10057776
542 Ga0207652_10036509
543 Ga0207652_10260823
544 Ga0207652_10477479
545 Ga0207652_10841790
546 Ga0207650_10001366
547 Ga0207700_10049939
548 Ga0207700_10098803
549 Ga0207664_10044821
550 Ga0207664_10049978
551 Ga0207664_10338186
552 Ga0207664_10610415
553 Ga0207644_10001903
554 Ga0207644_10002431
555 Ga0207644_10096135
556 Ga0207690_10143376
557 Ga0207690_10182390
558 Ga0207690_10886779
559 Ga0207706_10010183
560 Ga0207706_10020540
561 Ga0207665_10099280
562 Ga0207691_10041026
563 Ga0207691_10110854
564 Ga0207711_10035893
565 Ga0207711_10124887
566 Ga0207711_10137559
567 Ga0207661_10015363
568 Ga0207679_10036777
569 Ga0207679_10236063
570 Ga0207667_10203617
571 Ga0207667_10354851
572 Ga0207640_10180016
573 Ga0207640_10954515
574 Ga0207658_11529938
575 Ga0207677_10110038
576 Ga0207639_10021637
577 Ga0207678_10027507
578 Ga0207678_10047054
579 Ga0207678_10491730
580 Ga0207702_10029709
581 Ga0207702_10048153
582 Ga0207702_10148507
583 Ga0207702_12163720
584 Ga0207641_10023897
585 Ga0207648_11820416
586 Ga0207676_10041733
587 Ga0207676_10048187
588 Ga0207674_10067142
589 Ga0207683_10013911
590 Ga0207683_10034321
591 Ga0207698_10008982
592 Ga0207698_10153886
593 Ga0207698_11025642
594 Ga0207698_11207572
595 Ga0207698_11295139
596 Ga0207698_11763992
597 Ga0268266_10056120
598 Ga0268264_10547021
599 Ga0373960_0083541
600 Ga0373960_0115421
601 Ga0395899_0000224
602 Ga0395899_0008490
603 Ga0395899_0031968
604 Ga0395899_0041218
605 Ga0395899_0043572
606 Ga0395899_0046641
607 Ga0395899_0059405
608 Ga0395899_0083690
609 Ga0395899_0091061
610 Ga0395899_0109132
611 Ga0395899_0444825
612 Ga0395900_0000294
613 Ga0395900_0001237
614 Ga0395900_0004081
615 Ga0395900_0028754
616 Ga0395900_0035612
617 Ga0395900_0058738
618 Ga0395900_0076316
619 Ga0395900_0079557
620 Ga0395900_0086872
621 Ga0395900_0098559
622 Ga0395900_0099817
623 Ga0395900_0132812
624 Ga0395900_0141465
625 Ga0395900_0156307
626 Ga0395900_0203172
627 Ga0395900_0265614
628 Ga0395900_0376027
629 Ga0395900_0478108
630 Ga0395900_0548785
631 Ga0395900_0647443
632 Ga0395900_0713143
633 Ga0395900_0739773
634 Ga0395898_0001857
635 Ga0395898_0007641
636 Ga0395898_0010042
637 Ga0395898_0067449
638 Ga0395898_0071694
639 Ga0395898_0090719
640 Ga0395898_0336150
641 Ga0395898_0367141
642 Ga0395898_0379792
643 Ga0395898_0553446
644 Ga0395898_1031728
645 Ga0395898_1164600
646 Ga0395898_1609898
647 Ga0395905_0000066
648 Ga0395905_0000996
649 Ga0395905_0003693
650 Ga0395905_0019145
651 Ga0395905_0043120
652 Ga0395905_0059694
653 Ga0395905_0065057
654 Ga0395905_0069452
655 Ga0395905_0140386
656 Ga0395905_0146504
657 Ga0395905_0218137
658 Ga0395905_0276719
659 Ga0395905_0462194
660 Ga0395905_0470865
661 Ga0395905_0481424
662 Ga0395905_0663687
663 Ga0395905_0723611
664 Ga0395905_0751068
665 Ga0395905_0755209
666 Ga0395905_0871970
667 Ga0395905_0908213
668 Ga0395905_0959763
669 Ga0395905_1808627
670 Ga0436364_0639818
671 Ga0395901_0002833
672 Ga0395901_0006418
673 Ga0395901_0016180
674 Ga0395901_0026887
675 Ga0395901_0055454
676 Ga0395901_0092021
677 Ga0395901_0118436
678 Ga0395901_0155012
679 Ga0395901_0176277
680 Ga0395901_0275095
681 Ga0395901_0368314
682 Ga0395901_0410873
683 Ga0395901_0432842
684 Ga0395901_0482258
685 Ga0395901_0660027
686 Ga0395901_1040777
687 Ga0395901_2129268
688 Ga0436365_0795696
689 Ga0436363_1646636
690 Ga0439458_0001978
691 Ga0466966_0011202
692 Ga0466966_0092946
693 Ga0466966_0645765
694 Ga0466961_0006524
695 Ga0466961_0040033
696 Ga0466961_0218616
697 Ga0466961_0689146
698 Ga0466961_0814036
699 Ga0466963_0007413
700 Ga0466963_0050904
701 Ga0466963_0717436
702 Ga0466963_1059738
703 Ga0466964_0147520
704 Ga0466964_0325215
705 Ga0466964_0788291
706 Ga0466971_0144996
707 Ga0466971_0217438
708 Ga0466971_0224044
709 Ga0466971_0315796
710 Ga0466957_0004685
711 Ga0466957_0281544
712 Ga0466959_0013507
713 Ga0466959_0134442
714 Ga0466959_0291294
715 Ga0466959_0913779
716 Ga0466967_0017865
717 Ga0466967_0128961
718 Ga0466967_0258008
719 Ga0466967_1072270
720 Ga0466967_2162924
721 Ga0495629_0515544
722 Ga0495643_0090035
723 Ga0495668_0058292
724 Ga0495669_0215149
725 Ga0495683_0283570
726 Ga0496100_0886427
727 Ga0496100_1069379
728 Ga0496100_1525082
729 Ga0496101_0075045
730 Ga0496101_0165627
731 Ga0496102_0075060
732 Ga0496103_0158941
733 Ga0496106_0114779
734 Ga0496107_0072409
735 Ga0496107_0332661
736 Ga0496108_0008525
737 Ga0496108_0050764
738 Ga0496108_0725315
739 Ga0496109_0102402
740 Ga0496109_1128725
741 Ga0496110_0247203
742 Ga0496111_0154380
743 Ga0496112_0033237
744 Ga0496112_0064436
745 Ga0496112_0659634
746 Ga0496112_1810317
747 Ga0496112_1829070
748 Ga0496113_0019254
749 Ga0496113_0102689
750 Ga0496113_0791933
751 Ga0496114_0002108
752 Ga0496114_0019041
753 Ga0496115_0104153
754 Ga0495655_0001615
755 Ga0466962_0105161
756 Ga0466962_0285078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09917

DUF2147

Uncharacterized protein conserved in bacteria (DUF2147)

21

123

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nif-assembly1.cif.gz_D heterodimeric structure of erk2 and rsk1 0.7712 71 100
2vwi-assembly1.cif.gz_D structure of the osr1 kinase, a hypertension drug target 0.7566 72 104
4inn-assembly1.cif.gz_A protein hp1028 from the human pathogen helicobacter pylori belongs to the lipocalin family 0.7454 23 129
8wf4-assembly1.cif.gz_A the crystal structure of rsk1 from biortus. 0.7303 71 100
5o0y-assembly1.cif.gz_A tlk2 kinase domain from human 0.726 71 103
ID Description Score Start End Superfamily
af_O97143_4_333_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7941 71 100 1.10.510.10
af_O17100_303_359_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7814 97 126 2.30.29.30
af_Q4D3P7_9_124_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7771 72 103 3.30.200.20
4jnwB01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7749 71 103 3.30.200.20
af_Q9N3L4_13_116_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7687 72 104 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A429V6M0-F1-model_v4 DUF2147 domain-containing protein 0.9793 15 128
AF-A0A7C2U9C0-F1-model_v4 DUF2147 domain-containing protein 0.9693 22 132
AF-A0A2W6WEM7-F1-model_v4 DUF2147 domain-containing protein 0.9665 22 127
AF-A0A2W6X0X9-F1-model_v4 DUF2147 domain-containing protein 0.9648 21 129
AF-A0A097EKP5-F1-model_v4 DUF2147 domain-containing protein 0.9632 21 127

Map