F427966

General Info

Members Datasets Scaffolds Average Seq Length
378 237 756 276

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10031743|Ga0081455_100317432
Length 319
Sequence MSIADLRPEWRASRAARPEAYASQSDIRFGSKANKKRREDPLMHSQSSIHSIALIAALCLTIESAKAFDDASYPDWKGAWFGTGGRYDTSKPAGLGQQAPLKPEFQKILEASIADQADGGQGENPGYRCASHGMPRVMIANVPIGFVIMPETTYVMLERLTQVRRIYTDGRDWPAQLKTSALGYSIGKWIDEDGDGRYDTLEAETRGLKHPHVYDSSGAPFHPDERAIIKERIRLDKANPNMLRNEITVIDNALTRPWTVTRSYRRERDYRWGEYVCAANNQHVVIGKEDYFLSADGYLMPVRKDQKPPDLRNFNPPRQ

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
234 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 8.99
Rhizosphere 87.04
Stem 0
Stem Tuber 0
Unclassified 23.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10031743 3300005937 Bacteria 4772
2 JGI24743J22301_10000268 3300001991 Bacteria 5562
3 JGI24749J21850_1016919 3300002076 Bacteria 1025
4 JGI24033J26618_1002038 3300002155 Unclassified 2034
5 JGI24034J26672_10000329 3300002239 Bacteria 6077
6 JGI24742J22300_10001755 3300002244 Plasmid 3456
7 JGI24751J29686_10002777 3300002459 Plasmid 3521
8 Ga0070683_100132674 3300005329 Unclassified 2357
9 Ga0070690_100039438 3300005330 Unclassified 2984
10 Ga0070670_100023953 3300005331 Bacteria 5251
11 Ga0068869_100009235 3300005334 Bacteria 6391
12 Ga0068868_100020094 3300005338 Bacteria 5012
13 Ga0070689_100032333 3300005340 Plasmid 3979
14 Ga0070687_100001804 3300005343 Bacteria 7729
15 Ga0070692_10013932 3300005345 Bacteria 3760
16 Ga0070668_100043102 3300005347 Bacteria 3460
17 Ga0070675_100007435 3300005354 Bacteria 8461
18 Ga0070671_100019958 3300005355 Bacteria 5460
19 Ga0070674_100007217 3300005356 Bacteria 6542
20 Ga0070673_100002780 3300005364 Bacteria 10762
21 Ga0070659_100019715 3300005366 Bacteria 5116
22 Ga0070667_100009789 3300005367 Bacteria 7947
23 Ga0070703_10060378 3300005406 Archaea 1239
24 Ga0070713_100069289 3300005436 Unclassified 2974
25 Ga0070713_100222198 3300005436 Bacteria 1714
26 Ga0070713_100276623 3300005436 Bacteria 1539
27 Ga0070713_100375623 3300005436 Bacteria 1323
28 Ga0070713_100506162 3300005436 Unclassified 1140
29 Ga0070713_100591923 3300005436 Unclassified 1053
30 Ga0070713_100792440 3300005436 Unclassified 908
31 Ga0070701_10038322 3300005438 Unclassified 2425
32 Ga0070705_100049245 3300005440 Bacteria 2445
33 Ga0070708_100040296 3300005445 Bacteria 4090
34 Ga0070663_100013157 3300005455 Bacteria 5262
35 Ga0070678_100009522 3300005456 Bacteria 5891
36 Ga0070662_100004423 3300005457 Bacteria 8885
37 Ga0068867_100015161 3300005459 Bacteria 5465
38 Ga0070685_10018966 3300005466 Bacteria 3706
39 Ga0070706_100210570 3300005467 Bacteria 1815
40 Ga0070707_100039688 3300005468 Bacteria 4501
41 Ga0070699_100199378 3300005518 Bacteria 1779
42 Ga0070684_100014022 3300005535 Bacteria 6480
43 Ga0070697_100343961 3300005536 Bacteria 1287
44 Ga0068853_100144783 3300005539 Unclassified 2135
45 Ga0070672_100597920 3300005543 Bacteria 961
46 Ga0070665_100014763 3300005548 Bacteria 7840
47 Ga0070704_100167168 3300005549 Bacteria 1745
48 Ga0068857_100191868 3300005577 Unclassified 1861
49 Ga0068854_100014775 3300005578 Bacteria 5155
50 Ga0070702_100006271 3300005615 Bacteria 5615
51 Ga0070702_100205673 3300005615 Unclassified 1306
52 Ga0068852_100007338 3300005616 Bacteria 8043
53 Ga0068864_100010063 3300005618 Bacteria 7808
54 Ga0068866_10008181 3300005718 Plasmid 4396
55 Ga0068861_100041539 3300005719 Bacteria 3445
56 Ga0068870_10002160 3300005840 Bacteria 8140
57 Ga0068863_100008334 3300005841 Bacteria 10125
58 Ga0068863_100108224 3300005841 Unclassified 2646
59 Ga0068863_100206590 3300005841 Unclassified 1890
60 Ga0068858_100028850 3300005842 Bacteria 5153
61 Ga0068860_100088715 3300005843 Bacteria 2944
62 Ga0068862_100024587 3300005844 Bacteria 5055
63 Ga0081455_10010194 3300005937 Bacteria 9564
64 Ga0081455_10011817 3300005937 Bacteria 8744
65 Ga0081455_10022264 3300005937 Bacteria 5926
66 Ga0081455_10028162 3300005937 Bacteria 5136
67 Ga0081540_1037179 3300005983 Bacteria 2584
68 Ga0070717_10048341 3300006028 Bacteria 3488
69 Ga0070717_10437942 3300006028 Unclassified 1177
70 Ga0075365_10035186 3300006038 Bacteria 3239
71 Ga0075365_10103889 3300006038 Unclassified 1948
72 Ga0070715_10057356 3300006163 Bacteria 1696
73 Ga0070716_100011516 3300006173 Bacteria 4453
74 Ga0070712_100299568 3300006175 Bacteria 1301
75 Ga0097621_100226637 3300006237 Bacteria 1630
76 Ga0097621_100347914 3300006237 Bacteria 1317
77 Ga0068871_100137153 3300006358 Bacteria 2078
78 Ga0068871_100286843 3300006358 Unclassified 1441
79 Ga0075431_100247978 3300006847 Bacteria 1810
80 Ga0075433_10157954 3300006852 Bacteria 2018
81 Ga0075434_100008817 3300006871 Bacteria 9385
82 Ga0075434_100035464 3300006871 Bacteria 4931
83 Ga0075434_100129494 3300006871 Bacteria 2542
84 Ga0068865_100005064 3300006881 Bacteria 7975
85 Ga0075435_100227654 3300007076 Bacteria 1584
86 Ga0099794_10013072 3300007265 Bacteria 3603
87 Ga0099795_10000869 3300007788 Bacteria 6050
88 Ga0099795_10005864 3300007788 Bacteria 3305
89 Ga0099795_10021769 3300007788 Bacteria 2108
90 Ga0099795_10038565 3300007788 Bacteria 1687
91 Ga0099795_10062306 3300007788 Bacteria 1387
92 Ga0111539_10025192 3300009094 Bacteria 7292
93 Ga0111539_10039790 3300009094 Bacteria 5664
94 Ga0111539_10087207 3300009094 Bacteria 3667
95 Ga0111539_10104331 3300009094 Bacteria 3326
96 Ga0111539_10106051 3300009094 Unclassified 3297
97 Ga0105245_10004937 3300009098 Bacteria 11729
98 Ga0105247_10002663 3300009101 Bacteria 12022
99 Ga0114129_10497245 3300009147 Bacteria 1593
100 Ga0105243_10013511 3300009148 Bacteria 6176
101 Ga0105242_10016690 3300009176 Bacteria 5711
102 Ga0105248_10013675 3300009177 Bacteria 8934
103 Ga0105237_10189300 3300009545 Unclassified 2058
104 Ga0105249_10035717 3300009553 Bacteria 4507
105 Ga0099796_10001849 3300010159 Bacteria 4457
106 Ga0099796_10026149 3300010159 Bacteria 1850
107 Ga0099796_10051404 3300010159 Bacteria 1432
108 Ga0099796_10066572 3300010159 Bacteria 1291
109 Ga0099796_10137302 3300010159 Bacteria 953
110 Ga0105239_10021623 3300010375 Bacteria 7092
111 Ga0105246_10020726 3300011119 Bacteria 4220
112 Ga0157374_10003066 3300013296 Bacteria 14010
113 Ga0157378_10040769 3300013297 Bacteria 4118
114 Ga0157378_10183845 3300013297 Unclassified 1968
115 Ga0157378_10297877 3300013297 Unclassified 1560
116 Ga0163162_10049387 3300013306 Bacteria 4216
117 Ga0157375_10037777 3300013308 Bacteria 4629
118 Ga0163163_10007647 3300014325 Bacteria 9547
119 Ga0157380_10007444 3300014326 Bacteria 7773
120 Ga0157377_10003781 3300014745 Bacteria 6871
121 Ga0157379_10010133 3300014968 Bacteria 8216
122 Ga0157379_10275573 3300014968 Bacteria 1530
123 Ga0157376_10006579 3300014969 Bacteria 8225
124 Ga0157376_10363767 3300014969 Bacteria 1388
125 Ga0163161_10005212 3300017792 Bacteria 9043
126 Ga0213872_10049167 3300021361 Archaea 1915
127 Ga0207642_10020425 3300025899 Unclassified 2585
128 Ga0207710_10025412 3300025900 Unclassified 2556
129 Ga0207688_10000549 3300025901 Bacteria 18295
130 Ga0207680_10061762 3300025903 Unclassified 2286
131 Ga0207647_10008330 3300025904 Bacteria 7434
132 Ga0207699_10191886 3300025906 Bacteria 1379
133 Ga0207643_10033714 3300025908 Plasmid 2865
134 Ga0207684_10053909 3300025910 Bacteria 3412
135 Ga0207693_10037666 3300025915 Bacteria 3812
136 Ga0207693_10040259 3300025915 Unclassified 3680
137 Ga0207693_10059433 3300025915 Bacteria 2994
138 Ga0207663_10000897 3300025916 Bacteria 13571
139 Ga0207663_10173733 3300025916 Bacteria 1533
140 Ga0207662_10003432 3300025918 Bacteria 8153
141 Ga0207649_10189141 3300025920 Unclassified 1446
142 Ga0207646_10109258 3300025922 Bacteria 2481
143 Ga0207650_10029474 3300025925 Bacteria 3946
144 Ga0207659_10042412 3300025926 Bacteria 3190
145 Ga0207687_10062320 3300025927 Bacteria 2637
146 Ga0207700_10021600 3300025928 Bacteria 4399
147 Ga0207700_10044105 3300025928 Bacteria 3281
148 Ga0207700_10148834 3300025928 Bacteria 1933
149 Ga0207700_10369521 3300025928 Unclassified 1252
150 Ga0207664_10489156 3300025929 Bacteria 1101
151 Ga0207690_10026454 3300025932 Bacteria 3653
152 Ga0207706_10006206 3300025933 Bacteria 11103
153 Ga0207686_10080090 3300025934 Unclassified 2128
154 Ga0207709_10005760 3300025935 Bacteria 7001
155 Ga0207670_10106044 3300025936 Unclassified 2015
156 Ga0207669_10071997 3300025937 Unclassified 2174
157 Ga0207704_10011619 3300025938 Bacteria 4342
158 Ga0207665_10126634 3300025939 Bacteria 1809
159 Ga0207665_10180684 3300025939 Bacteria 1528
160 Ga0207691_10023631 3300025940 Bacteria 5788
161 Ga0207711_10007730 3300025941 Bacteria 8982
162 Ga0207689_10007304 3300025942 Bacteria 9699
163 Ga0207661_10135530 3300025944 Unclassified 2114
164 Ga0207679_10064016 3300025945 Unclassified 2747
165 Ga0207651_10082040 3300025960 Unclassified 2326
166 Ga0207712_10031958 3300025961 Bacteria 3549
167 Ga0207668_10111278 3300025972 Unclassified 2055
168 Ga0207658_10048963 3300025986 Plasmid 3102
169 Ga0207703_10008784 3300026035 Bacteria 7967
170 Ga0207639_10028830 3300026041 Plasmid 4057
171 Ga0207678_10003706 3300026067 Bacteria 13735
172 Ga0207708_10001468 3300026075 Bacteria 17638
173 Ga0207641_10079813 3300026088 Bacteria 2837
174 Ga0207641_10135273 3300026088 Unclassified 2218
175 Ga0207641_10174778 3300026088 Bacteria 1963
176 Ga0207648_10004345 3300026089 Bacteria 14578
177 Ga0207676_10051714 3300026095 Bacteria 3208
178 Ga0207674_10171826 3300026116 Unclassified 2120
179 Ga0207675_100025507 3300026118 Bacteria 5502
180 Ga0207683_10146318 3300026121 Unclassified 2131
181 Ga0207698_10342121 3300026142 Bacteria 1409
182 Ga0209179_1010787 3300027512 Bacteria 1601
183 Ga0209179_1011835 3300027512 Bacteria 1555
184 Ga0209179_1019453 3300027512 Unclassified 1308
185 Ga0209179_1030173 3300027512 Unclassified 1107
186 Ga0209588_1002876 3300027671 Bacteria 4729
187 Ga0209588_1022515 3300027671 Bacteria 1982
188 Ga0268265_10280137 3300028380 Unclassified 1491
189 Ga0268264_10113277 3300028381 Unclassified 2379
190 Ga0373930_0027644 3300034816 Bacteria 1151
191 Ga0373940_0006557 3300035088 Bacteria 2587
192 Ga0373939_0056536 3300035114 Unclassified 1235
193 Ga0373945_0041504 3300035116 Unclassified 1663
194 Ga0373956_0014321 3300035119 Bacteria 3312
195 Ga0373943_0047106 3300035170 Bacteria 2106
196 Ga0373943_0055863 3300035170 Bacteria 1957
197 Ga0373943_0181840 3300035170 Bacteria 1156
198 Ga0373946_0004301 3300035171 Bacteria 5087
199 Ga0373946_0137865 3300035171 Bacteria 1128
200 Ga0373955_0035103 3300035172 Bacteria 2654
201 Ga0373955_0046474 3300035172 Bacteria 2347
202 Ga0373955_0055731 3300035172 Unclassified 2166
203 Ga0373931_0012380 3300035691 Unclassified 4133
204 Ga0373931_0014990 3300035691 Unclassified 3798
205 Ga0373931_0046527 3300035691 Bacteria 2294
206 Ga0373935_0034498 3300035692 Bacteria 3154
207 Ga0373935_0057195 3300035692 Unclassified 2488
208 Ga0373935_0096366 3300035692 Unclassified 1944
209 Ga0373935_0163346 3300035692 Bacteria 1519
210 Ga0373935_0274113 3300035692 Unclassified 1186
211 Ga0373935_0305991 3300035692 Bacteria 1124
212 Ga0373927_0040625 3300035695 Bacteria 3017
213 Ga0373927_0147729 3300035695 Unclassified 1539
214 Ga0373933_0000996 3300035724 Bacteria 17290
215 Ga0373947_0029623 3300035725 Bacteria 3212
216 Ga0373947_0101704 3300035725 Bacteria 1807
217 Ga0373947_0118259 3300035725 Unclassified 1682
218 Ga0373947_0118472 3300035725 Unclassified 1680
219 Ga0373947_0256600 3300035725 Unclassified 1157
220 Ga0373947_0267424 3300035725 Bacteria 1134
221 Ga0373937_0000341 3300036401 Bacteria 44236
222 Ga0373937_0001547 3300036401 Bacteria 19319
223 Ga0373937_0016337 3300036401 Bacteria 6589
224 Ga0373937_0020006 3300036401 Bacteria 5996
225 Ga0373937_0040324 3300036401 Unclassified 4256
226 Ga0373937_0141294 3300036401 Bacteria 2253
227 Ga0373925_0004196 3300037068 Bacteria 10935
228 Ga0373925_0014587 3300037068 Bacteria 5679
229 Ga0373925_0022065 3300037068 Bacteria 4640
230 Ga0373925_0032712 3300037068 Bacteria 3829
231 Ga0373925_0050109 3300037068 Bacteria 3114
232 Ga0373925_0058268 3300037068 Unclassified 2896
233 Ga0373925_0072006 3300037068 Bacteria 2615
234 Ga0373925_0082989 3300037068 Bacteria 2440
235 Ga0373925_0098908 3300037068 Unclassified 2240
236 Ga0373925_0426156 3300037068 Bacteria 1084
237 Ga0436364_0259301 3300037853 Bacteria 1568
238 Ga0436364_1214861 3300037853 Bacteria 2046
239 Ga0436364_1363815 3300037853 Unclassified 1356
240 Ga0436365_0070984 3300039437 Bacteria 1353
241 Ga0436365_0469276 3300039437 Bacteria 4338
242 Ga0436365_0794247 3300039437 Unclassified 1268
243 Ga0436365_1625612 3300039437 Bacteria 4356
244 Ga0436360_0965198 3300039438 Bacteria 1303
245 Ga0436360_1183393 3300039438 Unclassified 901
246 Ga0436361_0368503 3300039447 Bacteria 1272
247 Ga0436361_0608403 3300039447 Bacteria 11894
248 Ga0436363_0039523 3300039450 Bacteria 3438
249 Ga0436363_0221849 3300039450 Bacteria 1169
250 Ga0436363_0506164 3300039450 Bacteria 939
251 Ga0436363_1350454 3300039450 Bacteria 969
252 Ga0436362_0921769 3300039453 Bacteria 1040
253 Ga0436362_1177106 3300039453 Bacteria 970
254 Ga0451853_3199467 3300041512 Unclassified 1620
255 Ga0495603_0163595 3300046455 Unclassified 1290
256 Ga0495629_0003418 3300046459 Bacteria 12013
257 Ga0495641_0018023 3300046461 Bacteria 3657
258 Ga0495651_0000323 3300046462 Bacteria 37079
259 Ga0495653_0007449 3300046463 Bacteria 8959
260 Ga0495580_0081267 3300046472 Bacteria 2259
261 Ga0495580_0110098 3300046472 Unclassified 1913
262 Ga0495580_0343866 3300046472 Bacteria 1011
263 Ga0495582_0018079 3300046473 Bacteria 3856
264 Ga0495582_0057308 3300046473 Unclassified 2148
265 Ga0495639_0147168 3300046475 Unclassified 1135
266 Ga0495662_0027169 3300046476 Bacteria 2765
267 Ga0495662_0039160 3300046476 Bacteria 2290
268 Ga0495662_0051173 3300046476 Bacteria 1994
269 Ga0495664_0085657 3300046477 Bacteria 1892
270 Ga0495584_0051098 3300046491 Bacteria 2082
271 Ga0495585_0101944 3300046492 Bacteria 1534
272 Ga0495594_0085342 3300046499 Unclassified 1766
273 Ga0495608_0002613 3300046511 Bacteria 12943
274 Ga0495628_0041459 3300046516 Bacteria 3675
275 Ga0495630_0036412 3300046517 Bacteria 3679
276 Ga0495630_0104899 3300046517 Unclassified 2140
277 Ga0495630_0126373 3300046517 Unclassified 1941
278 Ga0495630_0160273 3300046517 Bacteria 1713
279 Ga0495630_0186700 3300046517 Bacteria 1582
280 Ga0495631_0085955 3300046518 Unclassified 1355
281 Ga0495666_0045590 3300046526 Unclassified 2115
282 Ga0495652_0143302 3300046529 Bacteria 1877
283 Ga0495640_0055938 3300046533 Bacteria 2697
284 Ga0495640_0060154 3300046533 Bacteria 2584
285 Ga0495640_0065196 3300046533 Bacteria 2460
286 Ga0495587_0001639 3300046536 Bacteria 14931
287 Ga0495598_0021585 3300046537 Unclassified 1714
288 Ga0495598_0025536 3300046537 Unclassified 1612
289 Ga0495645_0211786 3300046543 Bacteria 1308
290 Ga0495667_0057406 3300046559 Bacteria 2558
291 Ga0495656_0074917 3300046615 Unclassified 1513
292 Ga0495656_0088293 3300046615 Bacteria 1413
293 Ga0495634_0240294 3300046642 Bacteria 1111
294 Ga0495635_0004206 3300046663 Bacteria 9984
295 Ga0495659_0137590 3300046664 Bacteria 972
296 Ga0495659_0140632 3300046664 Bacteria 963
297 Ga0495588_0017425 3300046674 Bacteria 3489
298 Ga0495599_0030007 3300046678 Bacteria 3410
299 Ga0495623_0111523 3300046679 Bacteria 1657
300 Ga0495646_0001971 3300046680 Bacteria 12380
301 Ga0495647_0004238 3300046681 Bacteria 4644
302 Ga0495658_0010139 3300046683 Bacteria 4708
303 Ga0495658_0048299 3300046683 Bacteria 2399
304 Ga0495658_0061710 3300046683 Bacteria 2153
305 Ga0495658_0071458 3300046683 Bacteria 2016
306 Ga0495613_0110282 3300046689 Unclassified 1983
307 Ga0495613_0118066 3300046689 Bacteria 1907
308 Ga0495624_0024121 3300046690 Bacteria 4004
309 Ga0495671_0185961 3300046692 Unclassified 1009
310 Ga0495649_0115563 3300046694 Unclassified 1421
311 Ga0495581_0053709 3300047315 Bacteria 2327
312 Ga0495581_0087727 3300047315 Bacteria 1804
313 Ga0495674_0137249 3300047319 Bacteria 2057
314 Ga0495674_0419167 3300047319 Bacteria 1079
315 Ga0495680_0066892 3300047322 Bacteria 2749
316 Ga0495675_0099307 3300047444 Bacteria 1823
317 Ga0495679_059903 3300047446 Unclassified 1119
318 Ga0495684_0112384 3300047471 Bacteria 2054
319 Ga0495593_0020366 3300047673 Bacteria 3715
320 Ga0495602_0065546 3300048088 Bacteria 3134
321 Ga0496100_0013738 3300048903 Bacteria 4682
322 Ga0496101_0052953 3300048904 Bacteria 2927
323 Ga0496101_0071148 3300048904 Bacteria 2549
324 Ga0496102_0084500 3300048905 Unclassified 2929
325 Ga0496103_0001572 3300048906 Bacteria 15074
326 Ga0496104_0035285 3300048907 Bacteria 4670
327 Ga0496104_0065633 3300048907 Bacteria 3444
328 Ga0496104_0078993 3300048907 Unclassified 3136
329 Ga0496104_0363321 3300048907 Bacteria 1360
330 Ga0496105_0014731 3300048908 Bacteria 6224
331 Ga0496106_0067652 3300048909 Unclassified 2723
332 Ga0496106_0257896 3300048909 Bacteria 1395
333 Ga0496106_0576902 3300048909 Bacteria 902
334 Ga0496107_0031431 3300048910 Unclassified 3789
335 Ga0496107_0062463 3300048910 Bacteria 2699
336 Ga0496107_0448633 3300048910 Bacteria 958
337 Ga0496108_0285399 3300048911 Bacteria 1437
338 Ga0496109_0014200 3300048912 Bacteria 6926
339 Ga0496110_0111992 3300048913 Unclassified 2453
340 Ga0496110_0171953 3300048913 Archaea 1966
341 Ga0496110_0272492 3300048913 Unclassified 1541
342 Ga0496110_0496680 3300048913 Unclassified 1111
343 Ga0496111_0004206 3300048914 Bacteria 9064
344 Ga0496111_0132105 3300048914 Bacteria 1848
345 Ga0496112_0077034 3300048915 Bacteria 3297
346 Ga0496112_0114788 3300048915 Bacteria 2664
347 Ga0496113_0207829 3300048916 Bacteria 1557
348 Ga0496114_0067757 3300048917 Unclassified 2994
349 Ga0496114_0214457 3300048917 Bacteria 1689
350 Ga0496114_0549252 3300048917 Bacteria 1021
351 Ga0496115_0018065 3300048918 Bacteria 5405
352 Ga0496115_0044219 3300048918 Unclassified 3552
353 Ga0496115_0086889 3300048918 Bacteria 2552
354 Ga0496115_0223791 3300048918 Bacteria 1553
355 nmdc:mga05p37_467185_c1 3300050507 Bacteria 1456
356 nmdc:mga06r32_180485_c1 3300050510 Unclassified 2096
357 nmdc:mga06r32_401631_c1 3300050510 Bacteria 1352
358 nmdc:mga08y16_110656_c1 3300050511 Bacteria 2860
359 nmdc:mga08y16_18210_c1 3300050511 Bacteria 7400
360 nmdc:mga08y16_221187_c1 3300050511 Unclassified 1960
361 nmdc:mga08y16_69129_c1 3300050511 Bacteria 3682
362 nmdc:mga0n895_218990_c1 3300050512 Bacteria 1933
363 nmdc:mga0n895_334024_c1 3300050512 Bacteria 1535
364 nmdc:mga0n895_57855_c1 3300050512 Bacteria 3822
365 nmdc:mga0n895_72614_c1 3300050512 Bacteria 3414
366 nmdc:mga0n895_8749_c1 3300050512 Bacteria 8800
367 nmdc:mga0rr50_246944_c1 3300050513 Bacteria 1481
368 nmdc:mga0a205_161534_c1 3300050515 Bacteria 2137
369 nmdc:mga0a205_255577_c1 3300050515 Bacteria 1631
370 nmdc:mga0a205_98688_c2 3300050515 Bacteria 1983
371 Ga0495601_0054788 3300053077 Bacteria 2523
372 Ga0495612_0033384 3300053078 Bacteria 2082
373 Ga0495612_0180580 3300053078 Bacteria 927
374 Ga0495655_0001923 3300053083 Unclassified 3240
375 Ga0495655_0009608 3300053083 Unclassified 1881
376 Ga0495595_0000781 3300053084 Bacteria 12065
377 Ga0495619_0019168 3300053085 Bacteria 4347
378 Ga0500642_0153336 3300053130 Unclassified 1081
379 Ga0081455_10031743
380 JGI24743J22301_10000268
381 JGI24749J21850_1016919
382 JGI24033J26618_1002038
383 JGI24034J26672_10000329
384 JGI24742J22300_10001755
385 JGI24751J29686_10002777
386 Ga0070683_100132674
387 Ga0070690_100039438
388 Ga0070670_100023953
389 Ga0068869_100009235
390 Ga0068868_100020094
391 Ga0070689_100032333
392 Ga0070687_100001804
393 Ga0070692_10013932
394 Ga0070668_100043102
395 Ga0070675_100007435
396 Ga0070671_100019958
397 Ga0070674_100007217
398 Ga0070673_100002780
399 Ga0070659_100019715
400 Ga0070667_100009789
401 Ga0070703_10060378
402 Ga0070713_100069289
403 Ga0070713_100222198
404 Ga0070713_100276623
405 Ga0070713_100375623
406 Ga0070713_100506162
407 Ga0070713_100591923
408 Ga0070713_100792440
409 Ga0070701_10038322
410 Ga0070705_100049245
411 Ga0070708_100040296
412 Ga0070663_100013157
413 Ga0070678_100009522
414 Ga0070662_100004423
415 Ga0068867_100015161
416 Ga0070685_10018966
417 Ga0070706_100210570
418 Ga0070707_100039688
419 Ga0070699_100199378
420 Ga0070684_100014022
421 Ga0070697_100343961
422 Ga0068853_100144783
423 Ga0070672_100597920
424 Ga0070665_100014763
425 Ga0070704_100167168
426 Ga0068857_100191868
427 Ga0068854_100014775
428 Ga0070702_100006271
429 Ga0070702_100205673
430 Ga0068852_100007338
431 Ga0068864_100010063
432 Ga0068866_10008181
433 Ga0068861_100041539
434 Ga0068870_10002160
435 Ga0068863_100008334
436 Ga0068863_100108224
437 Ga0068863_100206590
438 Ga0068858_100028850
439 Ga0068860_100088715
440 Ga0068862_100024587
441 Ga0081455_10010194
442 Ga0081455_10011817
443 Ga0081455_10022264
444 Ga0081455_10028162
445 Ga0081540_1037179
446 Ga0070717_10048341
447 Ga0070717_10437942
448 Ga0075365_10035186
449 Ga0075365_10103889
450 Ga0070715_10057356
451 Ga0070716_100011516
452 Ga0070712_100299568
453 Ga0097621_100226637
454 Ga0097621_100347914
455 Ga0068871_100137153
456 Ga0068871_100286843
457 Ga0075431_100247978
458 Ga0075433_10157954
459 Ga0075434_100008817
460 Ga0075434_100035464
461 Ga0075434_100129494
462 Ga0068865_100005064
463 Ga0075435_100227654
464 Ga0099794_10013072
465 Ga0099795_10000869
466 Ga0099795_10005864
467 Ga0099795_10021769
468 Ga0099795_10038565
469 Ga0099795_10062306
470 Ga0111539_10025192
471 Ga0111539_10039790
472 Ga0111539_10087207
473 Ga0111539_10104331
474 Ga0111539_10106051
475 Ga0105245_10004937
476 Ga0105247_10002663
477 Ga0114129_10497245
478 Ga0105243_10013511
479 Ga0105242_10016690
480 Ga0105248_10013675
481 Ga0105237_10189300
482 Ga0105249_10035717
483 Ga0099796_10001849
484 Ga0099796_10026149
485 Ga0099796_10051404
486 Ga0099796_10066572
487 Ga0099796_10137302
488 Ga0105239_10021623
489 Ga0105246_10020726
490 Ga0157374_10003066
491 Ga0157378_10040769
492 Ga0157378_10183845
493 Ga0157378_10297877
494 Ga0163162_10049387
495 Ga0157375_10037777
496 Ga0163163_10007647
497 Ga0157380_10007444
498 Ga0157377_10003781
499 Ga0157379_10010133
500 Ga0157379_10275573
501 Ga0157376_10006579
502 Ga0157376_10363767
503 Ga0163161_10005212
504 Ga0213872_10049167
505 Ga0207642_10020425
506 Ga0207710_10025412
507 Ga0207688_10000549
508 Ga0207680_10061762
509 Ga0207647_10008330
510 Ga0207699_10191886
511 Ga0207643_10033714
512 Ga0207684_10053909
513 Ga0207693_10037666
514 Ga0207693_10040259
515 Ga0207693_10059433
516 Ga0207663_10000897
517 Ga0207663_10173733
518 Ga0207662_10003432
519 Ga0207649_10189141
520 Ga0207646_10109258
521 Ga0207650_10029474
522 Ga0207659_10042412
523 Ga0207687_10062320
524 Ga0207700_10021600
525 Ga0207700_10044105
526 Ga0207700_10148834
527 Ga0207700_10369521
528 Ga0207664_10489156
529 Ga0207690_10026454
530 Ga0207706_10006206
531 Ga0207686_10080090
532 Ga0207709_10005760
533 Ga0207670_10106044
534 Ga0207669_10071997
535 Ga0207704_10011619
536 Ga0207665_10126634
537 Ga0207665_10180684
538 Ga0207691_10023631
539 Ga0207711_10007730
540 Ga0207689_10007304
541 Ga0207661_10135530
542 Ga0207679_10064016
543 Ga0207651_10082040
544 Ga0207712_10031958
545 Ga0207668_10111278
546 Ga0207658_10048963
547 Ga0207703_10008784
548 Ga0207639_10028830
549 Ga0207678_10003706
550 Ga0207708_10001468
551 Ga0207641_10079813
552 Ga0207641_10135273
553 Ga0207641_10174778
554 Ga0207648_10004345
555 Ga0207676_10051714
556 Ga0207674_10171826
557 Ga0207675_100025507
558 Ga0207683_10146318
559 Ga0207698_10342121
560 Ga0209179_1010787
561 Ga0209179_1011835
562 Ga0209179_1019453
563 Ga0209179_1030173
564 Ga0209588_1002876
565 Ga0209588_1022515
566 Ga0268265_10280137
567 Ga0268264_10113277
568 Ga0373930_0027644
569 Ga0373940_0006557
570 Ga0373939_0056536
571 Ga0373945_0041504
572 Ga0373956_0014321
573 Ga0373943_0047106
574 Ga0373943_0055863
575 Ga0373943_0181840
576 Ga0373946_0004301
577 Ga0373946_0137865
578 Ga0373955_0035103
579 Ga0373955_0046474
580 Ga0373955_0055731
581 Ga0373931_0012380
582 Ga0373931_0014990
583 Ga0373931_0046527
584 Ga0373935_0034498
585 Ga0373935_0057195
586 Ga0373935_0096366
587 Ga0373935_0163346
588 Ga0373935_0274113
589 Ga0373935_0305991
590 Ga0373927_0040625
591 Ga0373927_0147729
592 Ga0373933_0000996
593 Ga0373947_0029623
594 Ga0373947_0101704
595 Ga0373947_0118259
596 Ga0373947_0118472
597 Ga0373947_0256600
598 Ga0373947_0267424
599 Ga0373937_0000341
600 Ga0373937_0001547
601 Ga0373937_0016337
602 Ga0373937_0020006
603 Ga0373937_0040324
604 Ga0373937_0141294
605 Ga0373925_0004196
606 Ga0373925_0014587
607 Ga0373925_0022065
608 Ga0373925_0032712
609 Ga0373925_0050109
610 Ga0373925_0058268
611 Ga0373925_0072006
612 Ga0373925_0082989
613 Ga0373925_0098908
614 Ga0373925_0426156
615 Ga0436364_0259301
616 Ga0436364_1214861
617 Ga0436364_1363815
618 Ga0436365_0070984
619 Ga0436365_0469276
620 Ga0436365_0794247
621 Ga0436365_1625612
622 Ga0436360_0965198
623 Ga0436360_1183393
624 Ga0436361_0368503
625 Ga0436361_0608403
626 Ga0436363_0039523
627 Ga0436363_0221849
628 Ga0436363_0506164
629 Ga0436363_1350454
630 Ga0436362_0921769
631 Ga0436362_1177106
632 Ga0451853_3199467
633 Ga0495603_0163595
634 Ga0495629_0003418
635 Ga0495641_0018023
636 Ga0495651_0000323
637 Ga0495653_0007449
638 Ga0495580_0081267
639 Ga0495580_0110098
640 Ga0495580_0343866
641 Ga0495582_0018079
642 Ga0495582_0057308
643 Ga0495639_0147168
644 Ga0495662_0027169
645 Ga0495662_0039160
646 Ga0495662_0051173
647 Ga0495664_0085657
648 Ga0495584_0051098
649 Ga0495585_0101944
650 Ga0495594_0085342
651 Ga0495608_0002613
652 Ga0495628_0041459
653 Ga0495630_0036412
654 Ga0495630_0104899
655 Ga0495630_0126373
656 Ga0495630_0160273
657 Ga0495630_0186700
658 Ga0495631_0085955
659 Ga0495666_0045590
660 Ga0495652_0143302
661 Ga0495640_0055938
662 Ga0495640_0060154
663 Ga0495640_0065196
664 Ga0495587_0001639
665 Ga0495598_0021585
666 Ga0495598_0025536
667 Ga0495645_0211786
668 Ga0495667_0057406
669 Ga0495656_0074917
670 Ga0495656_0088293
671 Ga0495634_0240294
672 Ga0495635_0004206
673 Ga0495659_0137590
674 Ga0495659_0140632
675 Ga0495588_0017425
676 Ga0495599_0030007
677 Ga0495623_0111523
678 Ga0495646_0001971
679 Ga0495647_0004238
680 Ga0495658_0010139
681 Ga0495658_0048299
682 Ga0495658_0061710
683 Ga0495658_0071458
684 Ga0495613_0110282
685 Ga0495613_0118066
686 Ga0495624_0024121
687 Ga0495671_0185961
688 Ga0495649_0115563
689 Ga0495581_0053709
690 Ga0495581_0087727
691 Ga0495674_0137249
692 Ga0495674_0419167
693 Ga0495680_0066892
694 Ga0495675_0099307
695 Ga0495679_059903
696 Ga0495684_0112384
697 Ga0495593_0020366
698 Ga0495602_0065546
699 Ga0496100_0013738
700 Ga0496101_0052953
701 Ga0496101_0071148
702 Ga0496102_0084500
703 Ga0496103_0001572
704 Ga0496104_0035285
705 Ga0496104_0065633
706 Ga0496104_0078993
707 Ga0496104_0363321
708 Ga0496105_0014731
709 Ga0496106_0067652
710 Ga0496106_0257896
711 Ga0496106_0576902
712 Ga0496107_0031431
713 Ga0496107_0062463
714 Ga0496107_0448633
715 Ga0496108_0285399
716 Ga0496109_0014200
717 Ga0496110_0111992
718 Ga0496110_0171953
719 Ga0496110_0272492
720 Ga0496110_0496680
721 Ga0496111_0004206
722 Ga0496111_0132105
723 Ga0496112_0077034
724 Ga0496112_0114788
725 Ga0496113_0207829
726 Ga0496114_0067757
727 Ga0496114_0214457
728 Ga0496114_0549252
729 Ga0496115_0018065
730 Ga0496115_0044219
731 Ga0496115_0086889
732 Ga0496115_0223791
733 nmdc:mga05p37_467185_c1
734 nmdc:mga06r32_180485_c1
735 nmdc:mga06r32_401631_c1
736 nmdc:mga08y16_110656_c1
737 nmdc:mga08y16_18210_c1
738 nmdc:mga08y16_221187_c1
739 nmdc:mga08y16_69129_c1
740 nmdc:mga0n895_218990_c1
741 nmdc:mga0n895_334024_c1
742 nmdc:mga0n895_57855_c1
743 nmdc:mga0n895_72614_c1
744 nmdc:mga0n895_8749_c1
745 nmdc:mga0rr50_246944_c1
746 nmdc:mga0a205_161534_c1
747 nmdc:mga0a205_255577_c1
748 nmdc:mga0a205_98688_c2
749 Ga0495601_0054788
750 Ga0495612_0033384
751 Ga0495612_0180580
752 Ga0495655_0001923
753 Ga0495655_0009608
754 Ga0495595_0000781
755 Ga0495619_0019168
756 Ga0500642_0153336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gyw-assembly1.cif.gz_A gamma-adaptin appendage domain from clathrin adaptor ap1 a753d mutant 0.7912 185 226
1iu1-assembly1.cif.gz_A crystal structure of human gamma1-adaptin ear domain 0.7489 179 226
1gyv-assembly1.cif.gz_A gamma-adaptin appendage domain from clathrin adaptor ap1, l762e mutant 0.7402 179 226
2ia7-assembly1.cif.gz_A crystal structure of putative tail lysozyme (np_952040.1) from geobacter sulfurreducens at 1.44 a resolution 0.7248 181 228
1gyu-assembly1.cif.gz_A gamma-adaptin appendage domain from clathrin adaptor ap1 0.7094 179 209
ID Description Score Start End Superfamily
af_Q9ZUI6_735_860_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.7268 179 226 2.60.40.1230
2ia7A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7248 181 228 3.10.450.40
af_Q8NDV3_3_196_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7212 180 219 3.40.50.300
3zhfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.7119 179 226 2.60.40.1230
af_Q7T1H5_323_403_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7083 184 227 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A7V8NQQ8-F1-model_v4 Uncharacterized protein 0.9425 20 182
AF-A0A537UUM3-F1-model_v4 Uncharacterized protein 0.9316 36 237
AF-A0A317I6A0-F1-model_v4 deleted 0.9182 20 277
AF-A0A537UUM3-F1-model_v4 Uncharacterized protein 0.9134 36 237
AF-A0A317HW04-F1-model_v4 deleted 0.8941 7 213

Map