F427947

General Info

Members Datasets Scaffolds Average Seq Length
378 216 368 282

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10280873|Ga0070681_102808731
Length 312
Sequence MGGLASTPNSQLLTGQNVCVKLEASIERLAGFLDTSGRVLVLTGAGCSTESGIPDYRDANGEWKHARPVMYQQFIGSEATRQRYWARSLVGWRRISHARPNRAHLALARLEAAGFVSGLLTQNVDGLHTRAGSADVIDLHGRLDTVQCLSCGVLSDRAEFQVRLEASNPHLTNLTPSAVAPDGDAALVDVDYASVDVPPCGACGGILKPHVVFFGEGVPPARLAEAFARLDSAAALLVVGSSLMVFSGYRFVQSAVRGGKPVAAVNLGRTRADDVISLKVEASCSDALAAIESRLLRRGLTPSGPAAAEFGV

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
4 2643221672 Variovorax sp. Root434 Isolate Unclassified
5 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
6 2884411467 Dyella sp. AD56 Isolate Rhizosphere
7 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
8 2928963466 Dyella japonica 1073 Isolate Unclassified
9 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
191 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 0
Isolates 2.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.4
Nodule 0.53
Rhizoplane 1.32
Rhizosphere 61.64
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1003785 3300002705 Bacteria 4824
2 JGI25156J39149_1008470 3300002705 Bacteria 2585
3 JGI25162J39368_1000066 3300002737 Bacteria 130612
4 JGI25162J39368_1000993 3300002737 Bacteria 17917
5 JGI25157J39369_1000050 3300002741 Bacteria 114470
6 JGI25157J39369_1000957 3300002741 Bacteria 13522
7 JGI25157J39369_1002364 3300002741 Bacteria 4824
8 JGI25163J39215_1000603 3300002771 Bacteria 9995
9 JGI25164J39214_1000056 3300002772 Bacteria 114468
10 JGI25164J39214_1000061 3300002772 Bacteria 110617
11 JGI25165J46597_1000009 3300003214 Bacteria 467965
12 JGI25165J46597_1000151 3300003214 Bacteria 114835
13 Ga0055538_1001542 3300003751 Bacteria 4241
14 Ga0055539_1008077 3300003752 Bacteria 1322
15 Ga0055525_1000122 3300003759 Bacteria 119205
16 Ga0055527_1000213 3300003760 Bacteria 37745
17 Ga0055527_1000392 3300003760 Bacteria 18684
18 Ga0055527_1000624 3300003760 Bacteria 11220
19 Ga0055527_1006024 3300003760 Bacteria 1538
20 Ga0055535_1000045 3300003761 Bacteria 140688
21 Ga0055535_1000466 3300003761 Bacteria 37034
22 Ga0055535_1001249 3300003761 Bacteria 14116
23 Ga0055535_1001389 3300003761 Bacteria 12541
24 Ga0055535_1001715 3300003761 Bacteria 9934
25 Ga0055542_1000010 3300003762 Bacteria 414813
26 Ga0055542_1000079 3300003762 Bacteria 130623
27 Ga0055542_1000104 3300003762 Bacteria 113323
28 Ga0055542_1000370 3300003762 Bacteria 46537
29 Ga0055542_1000971 3300003762 Bacteria 18684
30 Ga0055542_1001011 3300003762 Bacteria 17923
31 Ga0055542_1001591 3300003762 Bacteria 10528
32 Ga0055529_1000122 3300003763 Bacteria 114462
33 Ga0055529_1000140 3300003763 Bacteria 102393
34 Ga0055529_1001222 3300003763 Bacteria 9930
35 Ga0055529_1001688 3300003763 Bacteria 5705
36 Ga0055524_1017622 3300003775 Bacteria 2515
37 Ga0055536_1029120 3300003781 Bacteria 1490
38 Ga0055530_10003411 3300003791 Bacteria 9063
39 Ga0055531_10012640 3300003794 Bacteria 3957
40 Ga0070658_10015529 3300005327 Bacteria 6090
41 Ga0070670_100167524 3300005331 Bacteria 1905
42 Ga0068869_100028117 3300005334 Bacteria 3926
43 Ga0070666_10000003 3300005335 Bacteria 463666
44 Ga0068868_100100000 3300005338 Bacteria 2346
45 Ga0070660_100012407 3300005339 Bacteria 6084
46 Ga0070660_100078244 3300005339 Bacteria 2593
47 Ga0070661_100022871 3300005344 Bacteria 4477
48 Ga0070661_100026893 3300005344 Bacteria 4141
49 Ga0070661_100250013 3300005344 Bacteria 1368
50 Ga0070692_10000986 3300005345 Bacteria 9742
51 Ga0070668_100019535 3300005347 Bacteria 5100
52 Ga0070668_100027379 3300005347 Bacteria 4328
53 Ga0070668_100028593 3300005347 Bacteria 4232
54 Ga0070675_100029678 3300005354 Bacteria 4412
55 Ga0070675_100173037 3300005354 Bacteria 1863
56 Ga0070671_100043805 3300005355 Bacteria 3719
57 Ga0070673_100171105 3300005364 Bacteria 1854
58 Ga0070673_100255225 3300005364 Bacteria 1530
59 Ga0070688_100047055 3300005365 Bacteria 2674
60 Ga0070659_100000593 3300005366 Bacteria 26524
61 Ga0070659_100135308 3300005366 Bacteria 2004
62 Ga0070667_100195808 3300005367 Bacteria 1791
63 Ga0070714_100000034 3300005435 Bacteria 130742
64 Ga0070714_100336874 3300005435 Bacteria 1414
65 Ga0070713_100001740 3300005436 Bacteria 14023
66 Ga0070713_100103880 3300005436 Bacteria 2466
67 Ga0070708_100253288 3300005445 Bacteria 1654
68 Ga0070663_100265764 3300005455 Bacteria 1362
69 Ga0070678_100237631 3300005456 Bacteria 1522
70 Ga0070662_100021678 3300005457 Bacteria 4391
71 Ga0070681_10070761 3300005458 Bacteria 3453
72 Ga0070681_10079005 3300005458 Bacteria 3247
73 Ga0070681_10103830 3300005458 Bacteria 2786
74 Ga0070681_10243439 3300005458 Bacteria 1712
75 Ga0070681_10280873 3300005458 Bacteria 1576
76 Ga0068867_100047608 3300005459 Bacteria 3152
77 Ga0070685_10034043 3300005466 Bacteria 2867
78 Ga0070679_100145319 3300005530 Bacteria 2349
79 Ga0068853_100043299 3300005539 Bacteria 3851
80 Ga0068853_100237650 3300005539 Bacteria 1669
81 Ga0070693_100061222 3300005547 Bacteria 2187
82 Ga0070665_100000053 3300005548 Bacteria 244523
83 Ga0070665_100015704 3300005548 Bacteria 7607
84 Ga0070665_100145145 3300005548 Bacteria 2376
85 Ga0068855_100144591 3300005563 Bacteria 2708
86 Ga0068857_100094626 3300005577 Bacteria 2676
87 Ga0068857_100318967 3300005577 Bacteria 1435
88 Ga0068857_100380822 3300005577 Bacteria 1310
89 Ga0068856_100007807 3300005614 Bacteria 10447
90 Ga0068856_100044464 3300005614 Bacteria 4371
91 Ga0068852_100199520 3300005616 Bacteria 1893
92 Ga0068859_100000070 3300005617 Bacteria 94311
93 Ga0068864_100255878 3300005618 Bacteria 1627
94 Ga0068863_100192248 3300005841 Bacteria 1961
95 Ga0068863_100514924 3300005841 Bacteria 1179
96 Ga0068860_100062891 3300005843 Bacteria 3527
97 Ga0068860_100315018 3300005843 Bacteria 1535
98 Ga0068860_100384073 3300005843 Bacteria 1387
99 Ga0068860_100561265 3300005843 Bacteria 1144
100 Ga0068862_100007143 3300005844 Bacteria 9273
101 Ga0097621_100163236 3300006237 Bacteria 1916
102 Ga0097621_100692030 3300006237 Bacteria 938
103 Ga0075370_10009465 3300006353 Bacteria 5061
104 Ga0075431_100108517 3300006847 Bacteria 2864
105 Ga0075433_10002930 3300006852 Bacteria 13096
106 Ga0075433_10003186 3300006852 Bacteria 12645
107 Ga0075434_100000852 3300006871 Bacteria 24305
108 Ga0075434_100003273 3300006871 Bacteria 14491
109 Ga0097620_100000070 3300006931 Bacteria 94311
110 Ga0075435_100007756 3300007076 Bacteria 7672
111 Ga0105244_10000965 3300009036 Bacteria 24157
112 Ga0105240_10047723 3300009093 Bacteria 5418
113 Ga0105247_10186256 3300009101 Bacteria 1388
114 Ga0105243_10001101 3300009148 Bacteria 24566
115 Ga0105243_10001682 3300009148 Bacteria 19081
116 Ga0105241_10270214 3300009174 Bacteria 1448
117 Ga0105237_10067755 3300009545 Bacteria 3563
118 Ga0105237_10146583 3300009545 Bacteria 2355
119 Ga0105238_10001572 3300009551 Bacteria 22880
120 Ga0105238_10271501 3300009551 Bacteria 1676
121 Ga0105239_10018850 3300010375 Bacteria 7624
122 Ga0157378_10081869 3300013297 Bacteria 2918
123 Ga0163162_10003167 3300013306 Bacteria 15727
124 Ga0157372_10150697 3300013307 Bacteria 2684
125 Ga0157372_10171450 3300013307 Bacteria 2510
126 Ga0157376_10025900 3300014969 Bacteria 4626
127 Ga0182006_1001032 3300015261 Bacteria 18152
128 Ga0182006_1012365 3300015261 Bacteria 3731
129 Ga0182007_10000366 3300015262 Bacteria 28535
130 Ga0183368_1004 3300015687 Bacteria 1211761
131 Ga0213876_10000497 3300021384 Bacteria 30729
132 Ga0209784_100013 3300025224 Bacteria 518664
133 Ga0209674_100053 3300025226 Bacteria 323159
134 Ga0209674_100062 3300025226 Bacteria 276316
135 Ga0209674_101247 3300025226 Bacteria 7181
136 Ga0209672_100009 3300025228 Bacteria 883623
137 Ga0209672_100056 3300025228 Bacteria 217675
138 Ga0209672_100107 3300025228 Bacteria 99267
139 Ga0209672_100310 3300025228 Bacteria 32650
140 Ga0209672_100742 3300025228 Bacteria 15916
141 Ga0209563_100077 3300025230 Bacteria 205130
142 Ga0207427_100021 3300025231 Bacteria 494115
143 Ga0207427_100030 3300025231 Bacteria 358045
144 Ga0207427_101033 3300025231 Bacteria 11617
145 Ga0209437_100012 3300025233 Bacteria 792625
146 Ga0209437_100150 3300025233 Bacteria 157430
147 Ga0209437_101008 3300025233 Bacteria 9779
148 Ga0209437_102895 3300025233 Bacteria 3209
149 Ga0209258_100011 3300025242 Bacteria 867542
150 Ga0209258_100019 3300025242 Bacteria 566728
151 Ga0209258_100045 3300025242 Bacteria 369941
152 Ga0209258_100096 3300025242 Bacteria 217675
153 Ga0209258_100299 3300025242 Bacteria 80970
154 Ga0209258_102051 3300025242 Bacteria 5732
155 Ga0209646_1000349 3300025246 Bacteria 33708
156 Ga0209646_1000553 3300025246 Bacteria 15780
157 Ga0209026_1000015 3300025250 Bacteria 395555
158 Ga0209026_1000163 3300025250 Bacteria 102814
159 Ga0209026_1000741 3300025250 Bacteria 18731
160 Ga0209026_1000856 3300025250 Bacteria 15889
161 Ga0209677_105064 3300025253 Bacteria 3564
162 Ga0209148_1000001 3300025254 Bacteria 2545271
163 Ga0209148_1000005 3300025254 Bacteria 1806504
164 Ga0209148_1000013 3300025254 Bacteria 956684
165 Ga0209148_1000052 3300025254 Bacteria 399449
166 Ga0209148_1000101 3300025254 Bacteria 217675
167 Ga0209148_1000205 3300025254 Bacteria 104659
168 Ga0209759_1000367 3300025256 Bacteria 56530
169 Ga0209759_1000622 3300025256 Bacteria 33847
170 Ga0209759_1003043 3300025256 Bacteria 6912
171 Ga0209759_1013180 3300025256 Bacteria 2250
172 Ga0209233_1000002 3300025261 Bacteria 2501366
173 Ga0209233_1000023 3300025261 Bacteria 738870
174 Ga0209233_1019238 3300025261 Bacteria 1820
175 Ga0209455_1000012 3300025272 Bacteria 867234
176 Ga0209455_1000027 3300025272 Bacteria 566710
177 Ga0209455_1000081 3300025272 Bacteria 263674
178 Ga0209455_1000094 3300025272 Bacteria 217675
179 Ga0209455_1008104 3300025272 Bacteria 2889
180 Ga0209675_1020573 3300025291 Bacteria 1784
181 Ga0209676_1001525 3300025292 Bacteria 21042
182 Ga0209676_1001985 3300025292 Bacteria 16259
183 Ga0209676_1002999 3300025292 Bacteria 10977
184 Ga0209025_1006876 3300025294 Bacteria 8675
185 Ga0209025_1039304 3300025294 Bacteria 2065
186 Ga0209564_1021836 3300025295 Bacteria 2286
187 Ga0209758_1023740 3300025297 Bacteria 2761
188 Ga0209050_1001232 3300025298 Bacteria 29637
189 Ga0209050_1005137 3300025298 Bacteria 8395
190 Ga0209256_1003680 3300025299 Bacteria 10439
191 Ga0209256_1005300 3300025299 Bacteria 7507
192 Ga0209051_1000500 3300025303 Bacteria 49702
193 Ga0209257_1000226 3300025304 Bacteria 133836
194 Ga0209257_1003014 3300025304 Bacteria 15243
195 Ga0209257_1003029 3300025304 Bacteria 15201
196 Ga0209257_1003109 3300025304 Bacteria 14863
197 Ga0207655_1002684 3300025728 Bacteria 13976
198 Ga0207680_10000006 3300025903 Bacteria 635950
199 Ga0207680_10144556 3300025903 Bacteria 1580
200 Ga0207680_10162743 3300025903 Bacteria 1498
201 Ga0207645_10162931 3300025907 Bacteria 1459
202 Ga0207705_10001672 3300025909 Bacteria 17645
203 Ga0207705_10007388 3300025909 Bacteria 8080
204 Ga0207654_10166575 3300025911 Bacteria 1427
205 Ga0207707_10018808 3300025912 Bacteria 6026
206 Ga0207707_10034717 3300025912 Bacteria 4412
207 Ga0207707_10326247 3300025912 Bacteria 1325
208 Ga0207695_10048516 3300025913 Bacteria 4483
209 Ga0207657_10035806 3300025919 Bacteria 4447
210 Ga0207657_10108932 3300025919 Bacteria 2290
211 Ga0207649_10036746 3300025920 Bacteria 2953
212 Ga0207649_10064586 3300025920 Bacteria 2315
213 Ga0207694_10003648 3300025924 Bacteria 12194
214 Ga0207694_10217097 3300025924 Bacteria 1559
215 Ga0207650_10139625 3300025925 Bacteria 1904
216 Ga0207700_10032931 3300025928 Bacteria 3703
217 Ga0207700_10419914 3300025928 Bacteria 1175
218 Ga0207664_10000021 3300025929 Bacteria 216875
219 Ga0207690_10002276 3300025932 Bacteria 11703
220 Ga0207706_10003793 3300025933 Bacteria 14408
221 Ga0207709_10001360 3300025935 Bacteria 17193
222 Ga0207709_10005021 3300025935 Bacteria 7560
223 Ga0207669_10000912 3300025937 Bacteria 12523
224 Ga0207691_10093734 3300025940 Bacteria 2688
225 Ga0207679_10151343 3300025945 Bacteria 1889
226 Ga0207668_10024567 3300025972 Bacteria 3891
227 Ga0207668_10082838 3300025972 Bacteria 2332
228 Ga0207677_10283635 3300026023 Bacteria 1361
229 Ga0207639_10151263 3300026041 Bacteria 1944
230 Ga0207678_10122149 3300026067 Bacteria 2222
231 Ga0207678_10199378 3300026067 Bacteria 1711
232 Ga0207702_10001103 3300026078 Bacteria 27598
233 Ga0207702_10396714 3300026078 Bacteria 1330
234 Ga0207641_10345221 3300026088 Bacteria 1417
235 Ga0207676_10208646 3300026095 Bacteria 1732
236 Ga0207674_10076579 3300026116 Bacteria 3353
237 Ga0207674_10135218 3300026116 Bacteria 2427
238 Ga0207674_10187729 3300026116 Bacteria 2017
239 Ga0207428_10005748 3300027907 Bacteria 11519
240 Ga0268266_10000001 3300028379 Bacteria 4040580
241 Ga0268266_10000043 3300028379 Bacteria 316604
242 Ga0268266_10022489 3300028379 Bacteria 5372
243 Ga0268265_10014094 3300028380 Bacteria 5449
244 Ga0268265_10366456 3300028380 Bacteria 1321
245 Ga0268264_10123363 3300028381 Bacteria 2286
246 Ga0268264_10129370 3300028381 Bacteria 2236
247 Ga0268264_10660438 3300028381 Bacteria 1035
248 Ga0265334_10000007 3300028573 Bacteria 217454
249 Ga0265334_10052889 3300028573 Bacteria 1552
250 Ga0265318_10006899 3300028577 Bacteria 5179
251 Ga0265338_10016888 3300028800 Bacteria 7901
252 Ga0265338_10026108 3300028800 Bacteria 5903
253 Ga0265330_10005636 3300031235 Bacteria 6226
254 Ga0265332_10004025 3300031238 Bacteria 6994
255 Ga0265328_10009270 3300031239 Bacteria 4013
256 Ga0265320_10026643 3300031240 Bacteria 3022
257 Ga0265329_10010048 3300031242 Bacteria 3496
258 Ga0265339_10034691 3300031249 Bacteria 2834
259 Ga0265331_10013886 3300031250 Bacteria 4309
260 Ga0265316_10027799 3300031344 Bacteria 4676
261 Ga0307408_100165849 3300031548 Bacteria 1759
262 Ga0265313_10000113 3300031595 Bacteria 81921
263 Ga0265313_10016497 3300031595 Bacteria 4243
264 Ga0265314_10005592 3300031711 Bacteria 11295
265 Ga0265342_10009894 3300031712 Bacteria 6669
266 Ga0395899_0000195 3300037312 Bacteria 89015
267 Ga0395899_0014093 3300037312 Bacteria 6104
268 Ga0395900_0000018 3300037418 Bacteria 363472
269 Ga0395900_0034113 3300037418 Bacteria 5239
270 Ga0395900_0127468 3300037418 Bacteria 2609
271 Ga0395898_0000533 3300037466 Bacteria 72575
272 Ga0395901_0007659 3300038443 Bacteria 10894
273 Ga0436365_0107859 3300039437 Bacteria 44837
274 Ga0466969_0002600 3300044656 Bacteria 9648
275 Ga0466969_0007795 3300044656 Bacteria 5691
276 Ga0466972_0000292 3300044658 Bacteria 30590
277 Ga0466966_0010573 3300044684 Bacteria 6134
278 Ga0466961_0000604 3300044693 Bacteria 22628
279 Ga0466961_0002253 3300044693 Bacteria 11991
280 Ga0466961_0020645 3300044693 Bacteria 4239
281 Ga0466964_0013932 3300044706 Bacteria 3054
282 Ga0466971_0194855 3300044719 Bacteria 955
283 Ga0466970_0003438 3300044765 Bacteria 7710
284 Ga0466970_0004966 3300044765 Bacteria 6571
285 Ga0466970_0087287 3300044765 Bacteria 1691
286 Ga0466970_0146329 3300044765 Bacteria 1303
287 Ga0466970_0156567 3300044765 Bacteria 1259
288 Ga0466957_0028063 3300044842 Bacteria 3349
289 Ga0466957_0134376 3300044842 Bacteria 1588
290 Ga0466959_0000043 3300045049 Bacteria 92533
291 Ga0466959_0022058 3300045049 Bacteria 4703
292 Ga0466959_0038750 3300045049 Bacteria 3521
293 Ga0466959_0072838 3300045049 Bacteria 2485
294 Ga0495638_0000009 3300046460 Bacteria 525345
295 Ga0495638_0000087 3300046460 Bacteria 152531
296 Ga0495650_0000502 3300046471 Bacteria 59150
297 Ga0495650_0003239 3300046471 Bacteria 12073
298 Ga0495606_0000173 3300046507 Bacteria 114285
299 Ga0495606_0158311 3300046507 Bacteria 1323
300 Ga0495597_0123573 3300046542 Bacteria 1077
301 Ga0495622_0128026 3300046557 Bacteria 1157
302 Ga0495625_0011514 3300046660 Bacteria 7206
303 Ga0495625_0026818 3300046660 Bacteria 4346
304 Ga0495671_0000960 3300046692 Bacteria 20228
305 Ga0495649_0070518 3300046694 Bacteria 1873
306 Ga0495672_0023824 3300047320 Bacteria 3954
307 Ga0496102_0308511 3300048905 Bacteria 1491
308 Ga0496113_0058371 3300048916 Bacteria 2903
309 Ga0496115_0000048 3300048918 Bacteria 110056
310 Ga0496115_0050579 3300048918 Bacteria 3330
311 Ga0496115_0059468 3300048918 Bacteria 3077
312 Ga0496117_0012218 3300048920 Bacteria 7593
313 Ga0496118_0001387 3300048921 Bacteria 36508
314 Ga0496121_0072435 3300048924 Bacteria 2766
315 Ga0496121_0089146 3300048924 Bacteria 2416
316 Ga0496121_0135655 3300048924 Bacteria 1834
317 Ga0496121_0210919 3300048924 Bacteria 1376
318 Ga0496122_0002577 3300048925 Bacteria 25463
319 Ga0496122_0024324 3300048925 Bacteria 5302
320 Ga0496123_0003337 3300048926 Bacteria 18161
321 Ga0496123_0021322 3300048926 Bacteria 5039
322 Ga0496124_0001367 3300048927 Bacteria 36513
323 Ga0496124_0006158 3300048927 Bacteria 13150
324 Ga0496124_0033582 3300048927 Bacteria 4512
325 Ga0496124_0074128 3300048927 Bacteria 2814
326 Ga0496125_0087585 3300048928 Bacteria 2351
327 Ga0496125_0110753 3300048928 Bacteria 1989
328 Ga0496126_0023895 3300048929 Bacteria 5911
329 Ga0496126_0024025 3300048929 Bacteria 5891
330 Ga0496126_0148584 3300048929 Bacteria 2010
331 Ga0496126_0490622 3300048929 Bacteria 983
332 Ga0495678_036102 3300049459 Bacteria 2020
333 Ga0495678_117659 3300049459 Bacteria 897
334 Ga0495682_0015967 3300049460 Bacteria 2842
335 Ga0501031_0088427 3300049568 Bacteria 2020
336 Ga0501032_0036630 3300049569 Bacteria 3348
337 Ga0501033_0045105 3300049570 Bacteria 3281
338 Ga0501033_0090089 3300049570 Bacteria 2244
339 Ga0501034_0195088 3300049571 Bacteria 1985
340 Ga0501034_0296357 3300049571 Bacteria 1555
341 Ga0501038_0082777 3300049574 Bacteria 2702
342 Ga0501043_0045570 3300049579 Bacteria 3449
343 Ga0501043_0061498 3300049579 Bacteria 2949
344 Ga0501047_0010397 3300049581 Bacteria 8805
345 Ga0501047_0019252 3300049581 Bacteria 6549
346 Ga0501047_0417180 3300049581 Bacteria 1174
347 Ga0501070_0196923 3300049586 Bacteria 1655
348 Ga0501070_0438513 3300049586 Bacteria 1054
349 Ga0501074_0204380 3300049590 Bacteria 1407
350 Ga0501079_0110290 3300049741 Bacteria 2138
351 Ga0501035_0050467 3300049822 Bacteria 3728
352 Ga0501044_0189049 3300049823 Bacteria 2023
353 Ga0501044_0299473 3300049823 Bacteria 1537
354 Ga0501044_0476386 3300049823 Bacteria 1152
355 nmdc:mga07m45_55718_c1 3300050496 Bacteria 2235
356 nmdc:mga08y16_9425_c1 3300050511 Bacteria 10239
357 nmdc:mga0n895_1486_c1 3300050512 Bacteria 17585
358 nmdc:mga0n895_24554_c1 3300050512 Bacteria 5682
359 nmdc:mga0rr50_5456_c1 3300050513 Bacteria 7588
360 nmdc:mga0a205_16818_c1 3300050515 Bacteria 6851
361 nmdc:mga0a205_367569_c1 3300050515 Bacteria 1305
362 Ga0500646_0007088 3300053090 Bacteria 2860
363 Ga0500651_0020700 3300053093 Bacteria 4097
364 Ga0500641_0020558 3300053096 Bacteria 2507
365 Ga0500568_0001190 3300053139 Bacteria 17397
366 Ga0500616_0000016 3300053153 Bacteria 627087
367 Ga0501082_0000666 3300060353 Bacteria 30194
368 Ga0466962_0044622 3300061719 Bacteria 2121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8019659431 8019665535 244
2 3300049586 Ga0501070_0438513 Ga0501070_0438513_256_1032 255
3 3300046507 Ga0495606_0000173 Ga0495606_0000173_104459_105325 260
4 3300046660 Ga0495625_0026818 Ga0495625_0026818_1482_2348 260
5 3300046694 Ga0495649_0070518 Ga0495649_0070518_234_1100 260
6 3300048918 Ga0496115_0000048 Ga0496115_0000048_23495_24361 260
7 3300048929 Ga0496126_0148584 Ga0496126_0148584_1058_1924 260
8 3300049459 Ga0495678_036102 Ga0495678_036102_358_1224 260
9 3300049460 Ga0495682_0015967 Ga0495682_0015967_1363_2229 260
10 3300049459 Ga0495678_117659 Ga0495678_117659_87_881 262
11 3300044765 Ga0466970_0156567 Ga0466970_0156567_396_1211 263
12 iso_pu_bacteria 2895395659 2895398584 263
13 iso_pu_bacteria 2537561836 2538834653 264
14 iso_pu_bacteria 2643221562 2643829824 264
15 iso_pu_bacteria 2728368998 2728754719 264
16 3300027907 Ga0207428_10005748 Ga0207428_100057484 266
17 3300003781 Ga0055536_1029120 Ga0055536_10291202 268
18 3300003794 Ga0055531_10012640 Ga0055531_100126402 268
19 3300005458 Ga0070681_10079005 Ga0070681_100790053 268
20 3300005530 Ga0070679_100145319 Ga0070679_1001453192 268
21 3300009093 Ga0105240_10047723 Ga0105240_100477235 268
22 3300025912 Ga0207707_10018808 Ga0207707_100188086 268
23 3300025913 Ga0207695_10048516 Ga0207695_100485163 268
24 3300048924 Ga0496121_0210919 Ga0496121_0210919_153_959 268
25 3300049568 Ga0501031_0088427 Ga0501031_0088427_260_1066 268
26 3300049569 Ga0501032_0036630 Ga0501032_0036630_1850_2656 268
27 3300049570 Ga0501033_0045105 Ga0501033_0045105_1879_2685 268
28 3300049571 Ga0501034_0195088 Ga0501034_0195088_239_1045 268
29 3300049574 Ga0501038_0082777 Ga0501038_0082777_615_1421 268
30 3300049579 Ga0501043_0061498 Ga0501043_0061498_1500_2306 268
31 3300049581 Ga0501047_0019252 Ga0501047_0019252_3414_4220 268
32 3300049586 Ga0501070_0196923 Ga0501070_0196923_747_1553 268
33 3300049822 Ga0501035_0050467 Ga0501035_0050467_2499_3305 268
34 3300005365 Ga0070688_100047055 Ga0070688_1000470552 269
35 3300005466 Ga0070685_10034043 Ga0070685_100340432 269
36 3300025932 Ga0207690_10002276 Ga0207690_1000227614 269
37 3300037312 Ga0395899_0014093 Ga0395899_0014093_1331_2140 269
38 3300037418 Ga0395900_0127468 Ga0395900_0127468_837_1646 269
39 3300048924 Ga0496121_0072435 Ga0496121_0072435_1191_2000 269
40 3300050511 nmdc:mga08y16_9425_c1 nmdc:mga08y16_9425_c1_8017_8826 269
41 3300005458 Ga0070681_10070761 Ga0070681_100707612 270
42 3300009545 Ga0105237_10146583 Ga0105237_101465834 270
43 3300009551 Ga0105238_10271501 Ga0105238_102715012 270
44 3300025924 Ga0207694_10217097 Ga0207694_102170972 270
45 3300048927 Ga0496124_0001367 Ga0496124_0001367_1171_1986 270
46 3300053153 Ga0500616_0000016 Ga0500616_0000016_277939_278751 270
47 3300005327 Ga0070658_10015529 Ga0070658_100155292 271
48 3300005335 Ga0070666_10000003 Ga0070666_100000034 271
49 3300005344 Ga0070661_100026893 Ga0070661_1000268933 271
50 3300005347 Ga0070668_100027379 Ga0070668_1000273793 271
51 3300005456 Ga0070678_100237631 Ga0070678_1002376312 271
52 3300005548 Ga0070665_100015704 Ga0070665_1000157044 271
53 3300005843 Ga0068860_100062891 Ga0068860_1000628912 271
54 3300009551 Ga0105238_10001572 Ga0105238_100015729 271
55 3300013306 Ga0163162_10003167 Ga0163162_1000316711 271
56 3300025903 Ga0207680_10000006 Ga0207680_10000006149 271
57 3300025909 Ga0207705_10001672 Ga0207705_100016722 271
58 3300025920 Ga0207649_10036746 Ga0207649_100367462 271
59 3300025924 Ga0207694_10003648 Ga0207694_100036482 271
60 3300025972 Ga0207668_10082838 Ga0207668_100828382 271
61 3300028379 Ga0268266_10000043 Ga0268266_10000043184 271
62 3300028381 Ga0268264_10129370 Ga0268264_101293702 271
63 3300044719 Ga0466971_0194855 Ga0466971_0194855_89_904 271
64 3300046471 Ga0495650_0003239 Ga0495650_0003239_1201_2016 271
65 3300046507 Ga0495606_0158311 Ga0495606_0158311_454_1269 271
66 3300048924 Ga0496121_0135655 Ga0496121_0135655_584_1399 271
67 3300048928 Ga0496125_0087585 Ga0496125_0087585_1069_1884 271
68 3300048929 Ga0496126_0023895 Ga0496126_0023895_97_912 271
69 3300053090 Ga0500646_0007088 Ga0500646_0007088_478_1293 271
70 3300021384 Ga0213876_10000497 Ga0213876_100004979 272
71 3300039437 Ga0436365_0107859 Ga0436365_0107859_34211_35029 272
72 3300047320 Ga0495672_0023824 Ga0495672_0023824_2469_3290 272
73 3300048921 Ga0496118_0001387 Ga0496118_0001387_22910_23731 272
74 3300048925 Ga0496122_0024324 Ga0496122_0024324_1965_2786 272
75 3300048926 Ga0496123_0021322 Ga0496123_0021322_2254_3075 272
76 3300048927 Ga0496124_0006158 Ga0496124_0006158_11449_12270 272
77 3300048927 Ga0496124_0033582 Ga0496124_0033582_2792_3613 272
78 3300048929 Ga0496126_0490622 Ga0496126_0490622_67_891 272
79 iso_pu_bacteria 2939611941 2939614596 272
80 3300005458 Ga0070681_10243439 Ga0070681_102434392 273
81 3300005577 Ga0068857_100380822 Ga0068857_1003808221 273
82 3300006847 Ga0075431_100108517 Ga0075431_1001085172 273
83 3300025912 Ga0207707_10326247 Ga0207707_103262472 273
84 3300049571 Ga0501034_0296357 Ga0501034_0296357_293_1129 273
85 3300049741 Ga0501079_0110290 Ga0501079_0110290_967_1803 273
86 3300060353 Ga0501082_0000666 Ga0501082_0000666_6190_7026 273
87 iso_pu_bacteria 2643221672 2644397904 273
88 3300005339 Ga0070660_100012407 Ga0070660_1000124072 274
89 3300005366 Ga0070659_100000593 Ga0070659_1000005934 274
90 3300005436 Ga0070713_100001740 Ga0070713_10000174012 274
91 3300005614 Ga0068856_100044464 Ga0068856_1000444644 274
92 3300015261 Ga0182006_1012365 Ga0182006_10123652 274
93 3300025909 Ga0207705_10007388 Ga0207705_100073882 274
94 3300025919 Ga0207657_10035806 Ga0207657_100358066 274
95 3300025920 Ga0207649_10064586 Ga0207649_100645863 274
96 3300025928 Ga0207700_10032931 Ga0207700_100329312 274
97 3300026078 Ga0207702_10396714 Ga0207702_103967142 274
98 3300037418 Ga0395900_0034113 Ga0395900_0034113_1512_2336 274
99 3300038443 Ga0395901_0007659 Ga0395901_0007659_2006_2830 274
100 3300003791 Ga0055530_10003411 Ga0055530_100034111 275
101 3300005338 Ga0068868_100100000 Ga0068868_1001000002 275
102 3300005435 Ga0070714_100336874 Ga0070714_1003368742 275
103 3300013307 Ga0157372_10171450 Ga0157372_101714502 275
104 3300014969 Ga0157376_10025900 Ga0157376_100259002 275
105 3300015687 Ga0183368_1004 Ga0183368_1004842 275
106 3300025226 Ga0209674_100062 Ga0209674_10006220 275
107 3300028379 Ga0268266_10022489 Ga0268266_100224894 275
108 3300048916 Ga0496113_0058371 Ga0496113_0058371_569_1420 275
109 3300049823 Ga0501044_0476386 Ga0501044_0476386_27_866 275
110 3300053096 Ga0500641_0020558 Ga0500641_0020558_659_1498 275
111 3300005331 Ga0070670_100167524 Ga0070670_1001675243 276
112 3300005344 Ga0070661_100250013 Ga0070661_1002500132 276
113 3300005345 Ga0070692_10000986 Ga0070692_100009867 276
114 3300005354 Ga0070675_100029678 Ga0070675_1000296785 276
115 3300005364 Ga0070673_100171105 Ga0070673_1001711052 276
116 3300005435 Ga0070714_100000034 Ga0070714_10000003492 276
117 3300005618 Ga0068864_100255878 Ga0068864_1002558782 276
118 3300005841 Ga0068863_100514924 Ga0068863_1005149241 276
119 3300006237 Ga0097621_100163236 Ga0097621_1001632362 276
120 3300009545 Ga0105237_10067755 Ga0105237_100677552 276
121 3300013297 Ga0157378_10081869 Ga0157378_100818692 276
122 3300025903 Ga0207680_10144556 Ga0207680_101445563 276
123 3300025925 Ga0207650_10139625 Ga0207650_101396253 276
124 3300025929 Ga0207664_10000021 Ga0207664_10000021131 276
125 3300025940 Ga0207691_10093734 Ga0207691_100937342 276
126 3300026023 Ga0207677_10283635 Ga0207677_102836351 276
127 3300026095 Ga0207676_10208646 Ga0207676_102086463 276
128 3300048925 Ga0496122_0002577 Ga0496122_0002577_4949_5791 276
129 3300048926 Ga0496123_0003337 Ga0496123_0003337_16868_17710 276
130 3300049581 Ga0501047_0417180 Ga0501047_0417180_107_1003 276
131 3300049823 Ga0501044_0189049 Ga0501044_0189049_1061_1891 276
132 iso_pu_bacteria 2513020051 2513231793 276
133 3300002741 JGI25157J39369_1000957 JGI25157J39369_10009579 277
134 3300003761 Ga0055535_1001249 Ga0055535_100124913 277
135 3300003762 Ga0055542_1000104 Ga0055542_10001047 277
136 3300005334 Ga0068869_100028117 Ga0068869_1000281172 277
137 3300005457 Ga0070662_100021678 Ga0070662_1000216784 277
138 3300005563 Ga0068855_100144591 Ga0068855_1001445913 277
139 3300005577 Ga0068857_100318967 Ga0068857_1003189672 277
140 3300005616 Ga0068852_100199520 Ga0068852_1001995203 277
141 3300006353 Ga0075370_10009465 Ga0075370_100094653 277
142 3300006852 Ga0075433_10002930 Ga0075433_100029309 277
143 3300006871 Ga0075434_100003273 Ga0075434_10000327310 277
144 3300009036 Ga0105244_10000965 Ga0105244_100009655 277
145 3300009148 Ga0105243_10001682 Ga0105243_1000168211 277
146 3300009174 Ga0105241_10270214 Ga0105241_102702142 277
147 3300015261 Ga0182006_1001032 Ga0182006_100103212 277
148 3300015262 Ga0182007_10000366 Ga0182007_1000036624 277
149 3300025228 Ga0209672_100742 Ga0209672_10074214 277
150 3300025233 Ga0209437_102895 Ga0209437_1028952 277
151 3300025242 Ga0209258_100045 Ga0209258_100045210 277
152 3300025250 Ga0209026_1000163 Ga0209026_100016316 277
153 3300025254 Ga0209148_1000052 Ga0209148_1000052210 277
154 3300025256 Ga0209759_1000622 Ga0209759_100062216 277
155 3300025256 Ga0209759_1013180 Ga0209759_10131803 277
156 3300025261 Ga0209233_1019238 Ga0209233_10192382 277
157 3300025292 Ga0209676_1001525 Ga0209676_100152513 277
158 3300025298 Ga0209050_1001232 Ga0209050_100123225 277
159 3300025303 Ga0209051_1000500 Ga0209051_10005005 277
160 3300025304 Ga0209257_1000226 Ga0209257_100022639 277
161 3300025728 Ga0207655_1002684 Ga0207655_10026844 277
162 3300025911 Ga0207654_10166575 Ga0207654_101665751 277
163 3300025933 Ga0207706_10003793 Ga0207706_100037933 277
164 3300025935 Ga0207709_10001360 Ga0207709_1000136011 277
165 3300025945 Ga0207679_10151343 Ga0207679_101513432 277
166 3300026116 Ga0207674_10187729 Ga0207674_101877292 277
167 3300037312 Ga0395899_0000195 Ga0395899_0000195_82080_82979 277
168 3300037418 Ga0395900_0000018 Ga0395900_0000018_287832_288731 277
169 3300037466 Ga0395898_0000533 Ga0395898_0000533_5926_6825 277
170 3300044656 Ga0466969_0007795 Ga0466969_0007795_4569_5402 277
171 3300044693 Ga0466961_0000604 Ga0466961_0000604_10619_11452 277
172 3300044693 Ga0466961_0002253 Ga0466961_0002253_3234_4067 277
173 3300044706 Ga0466964_0013932 Ga0466964_0013932_813_1646 277
174 3300044765 Ga0466970_0004966 Ga0466970_0004966_3631_4464 277
175 3300044765 Ga0466970_0087287 Ga0466970_0087287_625_1458 277
176 3300044765 Ga0466970_0146329 Ga0466970_0146329_224_1057 277
177 3300044842 Ga0466957_0028063 Ga0466957_0028063_1585_2418 277
178 3300045049 Ga0466959_0000043 Ga0466959_0000043_10465_11298 277
179 3300045049 Ga0466959_0022058 Ga0466959_0022058_3596_4429 277
180 3300045049 Ga0466959_0072838 Ga0466959_0072838_458_1291 277
181 3300048905 Ga0496102_0308511 Ga0496102_0308511_41_874 277
182 3300048920 Ga0496117_0012218 Ga0496117_0012218_2498_3331 277
183 3300048924 Ga0496121_0089146 Ga0496121_0089146_1526_2359 277
184 3300048928 Ga0496125_0110753 Ga0496125_0110753_379_1212 277
185 3300049570 Ga0501033_0090089 Ga0501033_0090089_1357_2190 277
186 3300049581 Ga0501047_0010397 Ga0501047_0010397_1776_2609 277
187 3300050496 nmdc:mga07m45_55718_c1 nmdc:mga07m45_55718_c1_773_1606 277
188 3300050512 nmdc:mga0n895_24554_c1 nmdc:mga0n895_24554_c1_1197_2042 277
189 3300050515 nmdc:mga0a205_16818_c1 nmdc:mga0a205_16818_c1_427_1272 277
190 3300061719 Ga0466962_0044622 Ga0466962_0044622_553_1386 277
191 3300002705 JGI25156J39149_1008470 JGI25156J39149_10084702 278
192 3300002737 JGI25162J39368_1000066 JGI25162J39368_100006697 278
193 3300002741 JGI25157J39369_1000050 JGI25157J39369_100005097 278
194 3300002771 JGI25163J39215_1000603 JGI25163J39215_10006039 278
195 3300002772 JGI25164J39214_1000056 JGI25164J39214_10000569 278
196 3300003214 JGI25165J46597_1000009 JGI25165J46597_100000997 278
197 3300003751 Ga0055538_1001542 Ga0055538_10015425 278
198 3300003761 Ga0055535_1000045 Ga0055535_100004597 278
199 3300003762 Ga0055542_1000010 Ga0055542_10000108 278
200 3300003762 Ga0055542_1000079 Ga0055542_100007997 278
201 3300003763 Ga0055529_1000122 Ga0055529_10001229 278
202 3300003775 Ga0055524_1017622 Ga0055524_10176222 278
203 3300005344 Ga0070661_100022871 Ga0070661_1000228713 278
204 3300005445 Ga0070708_100253288 Ga0070708_1002532882 278
205 3300005455 Ga0070663_100265764 Ga0070663_1002657642 278
206 3300005843 Ga0068860_100384073 Ga0068860_1003840732 278
207 3300006852 Ga0075433_10003186 Ga0075433_1000318610 278
208 3300006871 Ga0075434_100000852 Ga0075434_10000085222 278
209 3300007076 Ga0075435_100007756 Ga0075435_1000077562 278
210 3300025224 Ga0209784_100013 Ga0209784_100013398 278
211 3300025228 Ga0209672_100310 Ga0209672_10031021 278
212 3300025231 Ga0207427_100030 Ga0207427_100030199 278
213 3300025231 Ga0207427_101033 Ga0207427_1010337 278
214 3300025233 Ga0209437_100012 Ga0209437_100012649 278
215 3300025233 Ga0209437_101008 Ga0209437_1010087 278
216 3300025242 Ga0209258_100019 Ga0209258_100019140 278
217 3300025242 Ga0209258_102051 Ga0209258_1020514 278
218 3300025246 Ga0209646_1000349 Ga0209646_10003492 278
219 3300025250 Ga0209026_1000015 Ga0209026_1000015293 278
220 3300025250 Ga0209026_1000741 Ga0209026_10007412 278
221 3300025254 Ga0209148_1000001 Ga0209148_10000012160 278
222 3300025254 Ga0209148_1000005 Ga0209148_1000005336 278
223 3300025256 Ga0209759_1000367 Ga0209759_100036727 278
224 3300025261 Ga0209233_1000002 Ga0209233_1000002140 278
225 3300025272 Ga0209455_1000027 Ga0209455_1000027406 278
226 3300025272 Ga0209455_1008104 Ga0209455_10081044 278
227 3300025292 Ga0209676_1001985 Ga0209676_10019854 278
228 3300025294 Ga0209025_1039304 Ga0209025_10393042 278
229 3300025295 Ga0209564_1021836 Ga0209564_10218362 278
230 3300025298 Ga0209050_1005137 Ga0209050_10051372 278
231 3300025304 Ga0209257_1003014 Ga0209257_10030146 278
232 3300026067 Ga0207678_10122149 Ga0207678_101221492 278
233 3300026067 Ga0207678_10199378 Ga0207678_101993782 278
234 3300028381 Ga0268264_10660438 Ga0268264_106604381 278
235 3300046460 Ga0495638_0000009 Ga0495638_0000009_44557_45423 278
236 3300046460 Ga0495638_0000087 Ga0495638_0000087_135424_136290 278
237 3300046471 Ga0495650_0000502 Ga0495650_0000502_43749_44615 278
238 3300046542 Ga0495597_0123573 Ga0495597_0123573_168_1010 278
239 3300046557 Ga0495622_0128026 Ga0495622_0128026_25_891 278
240 3300046660 Ga0495625_0011514 Ga0495625_0011514_3282_4148 278
241 3300048918 Ga0496115_0059468 Ga0496115_0059468_949_1800 278
242 3300048929 Ga0496126_0024025 Ga0496126_0024025_1294_2160 278
243 3300050512 nmdc:mga0n895_1486_c1 nmdc:mga0n895_1486_c1_9632_10468 278
244 3300050513 nmdc:mga0rr50_5456_c1 nmdc:mga0rr50_5456_c1_574_1410 278
245 3300050515 nmdc:mga0a205_367569_c1 nmdc:mga0a205_367569_c1_144_980 278
246 iso_pu_bacteria 2884411467 2884414679 278
247 iso_pu_bacteria 2928963466 2928963582 278
248 3300005354 Ga0070675_100173037 Ga0070675_1001730372 279
249 3300005436 Ga0070713_100103880 Ga0070713_1001038804 279
250 3300005459 Ga0068867_100047608 Ga0068867_1000476082 279
251 3300025907 Ga0207645_10162931 Ga0207645_101629312 279
252 3300025937 Ga0207669_10000912 Ga0207669_1000091211 279
253 3300028380 Ga0268265_10366456 Ga0268265_103664562 279
254 3300031548 Ga0307408_100165849 Ga0307408_1001658492 279
255 3300053139 Ga0500568_0001190 Ga0500568_0001190_10884_11774 279
256 3300005347 Ga0070668_100028593 Ga0070668_1000285932 280
257 3300005367 Ga0070667_100195808 Ga0070667_1001958082 280
258 3300005547 Ga0070693_100061222 Ga0070693_1000612223 280
259 3300005548 Ga0070665_100145145 Ga0070665_1001451452 280
260 3300005548 Ga0070665_100000053 Ga0070665_100000053195 281
261 3300025291 Ga0209675_1020573 Ga0209675_10205732 281
262 3300025292 Ga0209676_1002999 Ga0209676_10029992 281
263 3300025294 Ga0209025_1006876 Ga0209025_10068762 281
264 3300025297 Ga0209758_1023740 Ga0209758_10237402 281
265 3300025299 Ga0209256_1003680 Ga0209256_10036806 281
266 3300025299 Ga0209256_1005300 Ga0209256_10053002 281
267 3300025304 Ga0209257_1003029 Ga0209257_10030296 281
268 3300025304 Ga0209257_1003109 Ga0209257_10031098 281
269 3300028379 Ga0268266_10000001 Ga0268266_10000001192 281
270 3300044656 Ga0466969_0002600 Ga0466969_0002600_5103_5990 281
271 3300044684 Ga0466966_0010573 Ga0466966_0010573_3482_4369 281
272 3300044693 Ga0466961_0020645 Ga0466961_0020645_1581_2468 281
273 3300045049 Ga0466959_0038750 Ga0466959_0038750_491_1378 281
274 3300046692 Ga0495671_0000960 Ga0495671_0000960_1386_2249 281
275 3300049579 Ga0501043_0045570 Ga0501043_0045570_45_890 281
276 3300005366 Ga0070659_100135308 Ga0070659_1001353082 282
277 3300005539 Ga0068853_100237650 Ga0068853_1002376502 282
278 3300006237 Ga0097621_100692030 Ga0097621_1006920301 282
279 3300028573 Ga0265334_10000007 Ga0265334_10000007171 282
280 3300028573 Ga0265334_10052889 Ga0265334_100528892 282
281 3300028577 Ga0265318_10006899 Ga0265318_100068994 282
282 3300028800 Ga0265338_10016888 Ga0265338_100168883 282
283 3300028800 Ga0265338_10026108 Ga0265338_100261083 282
284 3300031235 Ga0265330_10005636 Ga0265330_100056364 282
285 3300031238 Ga0265332_10004025 Ga0265332_100040253 282
286 3300031239 Ga0265328_10009270 Ga0265328_100092703 282
287 3300031240 Ga0265320_10026643 Ga0265320_100266434 282
288 3300031242 Ga0265329_10010048 Ga0265329_100100483 282
289 3300031249 Ga0265339_10034691 Ga0265339_100346913 282
290 3300031250 Ga0265331_10013886 Ga0265331_100138863 282
291 3300031344 Ga0265316_10027799 Ga0265316_100277993 282
292 3300031595 Ga0265313_10000113 Ga0265313_1000011346 282
293 3300031595 Ga0265313_10016497 Ga0265313_100164973 282
294 3300031711 Ga0265314_10005592 Ga0265314_100055926 282
295 3300031712 Ga0265342_10009894 Ga0265342_100098944 282
296 3300009148 Ga0105243_10001101 Ga0105243_100011013 283
297 3300025935 Ga0207709_10005021 Ga0207709_100050214 283
298 3300044658 Ga0466972_0000292 Ga0466972_0000292_618_1472 283
299 3300044765 Ga0466970_0003438 Ga0466970_0003438_4488_5342 283
300 3300048927 Ga0496124_0074128 Ga0496124_0074128_1495_2379 283
301 3300013307 Ga0157372_10150697 Ga0157372_101506972 284
302 3300053093 Ga0500651_0020700 Ga0500651_0020700_1094_1963 284
303 3300005347 Ga0070668_100019535 Ga0070668_1000195352 285
304 3300005617 Ga0068859_100000070 Ga0068859_10000007053 285
305 3300005841 Ga0068863_100192248 Ga0068863_1001922483 285
306 3300005843 Ga0068860_100315018 Ga0068860_1003150182 285
307 3300005843 Ga0068860_100561265 Ga0068860_1005612651 285
308 3300005844 Ga0068862_100007143 Ga0068862_1000071435 285
309 3300006931 Ga0097620_100000070 Ga0097620_10000007053 285
310 3300009101 Ga0105247_10186256 Ga0105247_101862562 285
311 3300010375 Ga0105239_10018850 Ga0105239_100188504 285
312 3300025972 Ga0207668_10024567 Ga0207668_100245672 285
313 3300026088 Ga0207641_10345221 Ga0207641_103452211 285
314 3300028380 Ga0268265_10014094 Ga0268265_100140945 285
315 3300028381 Ga0268264_10123363 Ga0268264_101233632 285
316 3300005355 Ga0070671_100043805 Ga0070671_1000438052 286
317 3300005364 Ga0070673_100255225 Ga0070673_1002552252 286
318 3300025903 Ga0207680_10162743 Ga0207680_101627432 286
319 3300026116 Ga0207674_10135218 Ga0207674_101352182 286
320 3300048918 Ga0496115_0050579 Ga0496115_0050579_951_1811 286
321 3300049590 Ga0501074_0204380 Ga0501074_0204380_445_1305 286
322 3300049823 Ga0501044_0299473 Ga0501044_0299473_393_1253 286
323 3300025928 Ga0207700_10419914 Ga0207700_104199142 287
324 3300005458 Ga0070681_10103830 Ga0070681_101038302 289
325 3300005539 Ga0068853_100043299 Ga0068853_1000432992 289
326 3300005577 Ga0068857_100094626 Ga0068857_1000946264 289
327 3300025912 Ga0207707_10034717 Ga0207707_100347172 289
328 3300026041 Ga0207639_10151263 Ga0207639_101512632 289
329 3300026116 Ga0207674_10076579 Ga0207674_100765794 289
330 3300044842 Ga0466957_0134376 Ga0466957_0134376_407_1276 289
331 3300002705 JGI25156J39149_1003785 JGI25156J39149_10037855 290
332 3300002737 JGI25162J39368_1000993 JGI25162J39368_100099319 290
333 3300002741 JGI25157J39369_1002364 JGI25157J39369_10023645 290
334 3300002772 JGI25164J39214_1000061 JGI25164J39214_100006134 290
335 3300003214 JGI25165J46597_1000151 JGI25165J46597_100015160 290
336 3300003752 Ga0055539_1008077 Ga0055539_10080771 290
337 3300003759 Ga0055525_1000122 Ga0055525_1000122114 290
338 3300003760 Ga0055527_1000213 Ga0055527_100021326 290
339 3300003760 Ga0055527_1000392 Ga0055527_100039210 290
340 3300003760 Ga0055527_1000624 Ga0055527_10006241 290
341 3300003760 Ga0055527_1006024 Ga0055527_10060243 290
342 3300003761 Ga0055535_1000466 Ga0055535_100046629 290
343 3300003761 Ga0055535_1001389 Ga0055535_100138911 290
344 3300003761 Ga0055535_1001715 Ga0055535_10017158 290
345 3300003762 Ga0055542_1000370 Ga0055542_100037033 290
346 3300003762 Ga0055542_1000971 Ga0055542_10009717 290
347 3300003762 Ga0055542_1001011 Ga0055542_100101117 290
348 3300003762 Ga0055542_1001591 Ga0055542_10015911 290
349 3300003763 Ga0055529_1000140 Ga0055529_100014067 290
350 3300003763 Ga0055529_1001222 Ga0055529_10012228 290
351 3300003763 Ga0055529_1001688 Ga0055529_10016884 290
352 3300005339 Ga0070660_100078244 Ga0070660_1000782442 290
353 3300005458 Ga0070681_10280873 Ga0070681_102808731 290
354 3300005614 Ga0068856_100007807 Ga0068856_1000078079 290
355 3300025226 Ga0209674_100053 Ga0209674_10005352 290
356 3300025226 Ga0209674_101247 Ga0209674_1012476 290
357 3300025228 Ga0209672_100009 Ga0209672_100009327 290
358 3300025228 Ga0209672_100056 Ga0209672_100056189 290
359 3300025228 Ga0209672_100107 Ga0209672_10010761 290
360 3300025230 Ga0209563_100077 Ga0209563_1000776 290
361 3300025231 Ga0207427_100021 Ga0207427_100021312 290
362 3300025233 Ga0209437_100150 Ga0209437_10015070 290
363 3300025242 Ga0209258_100011 Ga0209258_100011317 290
364 3300025242 Ga0209258_100096 Ga0209258_100096189 290
365 3300025242 Ga0209258_100299 Ga0209258_10029946 290
366 3300025246 Ga0209646_1000553 Ga0209646_10005534 290
367 3300025250 Ga0209026_1000856 Ga0209026_100085617 290
368 3300025253 Ga0209677_105064 Ga0209677_1050643 290
369 3300025254 Ga0209148_1000013 Ga0209148_1000013317 290
370 3300025254 Ga0209148_1000101 Ga0209148_1000101189 290
371 3300025254 Ga0209148_1000205 Ga0209148_100020566 290
372 3300025256 Ga0209759_1003043 Ga0209759_10030433 290
373 3300025261 Ga0209233_1000023 Ga0209233_1000023310 290
374 3300025272 Ga0209455_1000012 Ga0209455_1000012317 290
375 3300025272 Ga0209455_1000081 Ga0209455_100008144 290
376 3300025272 Ga0209455_1000094 Ga0209455_1000094189 290
377 3300025919 Ga0207657_10108932 Ga0207657_101089322 290
378 3300026078 Ga0207702_10001103 Ga0207702_1000110322 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

44

247

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oj7-assembly1.cif.gz_A sirtuin 4 orthologue from xenopus tropicalis in complex with adp-ribose 0.9303 7 269
5ojn-assembly1.cif.gz_A sirtuin 4 from xenopus tropicalis in complex with thioacetyl-adp-ribose 0.8985 7 269
2h4f-assembly1.cif.gz_A sir2-p53 peptide-nad+ 0.8984 12 272
2h4h-assembly1.cif.gz_A sir2 h116y mutant-p53 peptide-nad 0.8975 13 272
3jr3-assembly1.cif.gz_A sir2 bound to acetylated peptide 0.8948 13 272
ID Description Score Start End Superfamily
af_A4I0H7_7_302_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9356 21 270 3.40.50.1220
af_F1QHM6_40_305_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9291 13 268 3.40.50.1220
af_Q20481_13_287_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9152 15 269 3.40.50.1220
3jwpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9085 14 270 3.40.50.1220
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.8922 14 270 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A4Q3K749-F1-model_v4 deleted 0.9913 13 270
AF-Q7VX46-F1-model_v4 NAD-dependent protein deacetylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9894 13 268 GO:0005737
GO:0008270
GO:0032041
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A3N6NW75-F1-model_v4 NAD-dependent protein deacetylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.989 13 270 GO:0005737
GO:0008270
GO:0032041
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A1E4PJ04-F1-model_v4 NAD-dependent protein deacetylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9857 14 271 GO:0005737
GO:0008270
GO:0032041
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A4Q8LBT0-F1-model_v4 NAD-dependent protein deacetylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9849 13 275 GO:0005737
GO:0008270
GO:0032041
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222

Feature Viewer

pLDDT pTM Quality
89.51 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map