F427914

General Info

Members Datasets Scaffolds Average Seq Length
378 209 756 150

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100998489|Ga0070683_1009984892
Length 168
Sequence VDDPVVQPAVDSVIVYDVAMRAALDEARLAHDSGDVPIGAVVLDASGEEVGRGHNVRERDGDPTGHAELVACRRAAQTLGGWRLTGCTLVVTLEPCTMCAGAIVLSRLDRLVFGAFDPKAGAVGSLWDVVRDRRLNHRPEVVTGVLASDCSAQLVAFFASHRAAEPLR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
207 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
208 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
209 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0.53
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 11.64
Rhizosphere 87.57
Stem 0
Stem Tuber 0
Unclassified 0.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100998489 3300005329 Bacteria 803
2 JGI24735J21928_10012231 3300002067 Bacteria 2714
3 JGI25406J46586_10059575 3300003203 Bacteria 1239
4 Ga0070658_10278476 3300005327 Bacteria 1423
5 Ga0070683_100059925 3300005329 Bacteria 3536
6 Ga0070683_100074743 3300005329 Bacteria 3165
7 Ga0070683_100265929 3300005329 Bacteria 1631
8 Ga0070670_100268783 3300005331 Bacteria 1487
9 Ga0068869_100070343 3300005334 Bacteria 2589
10 Ga0068869_101227056 3300005334 Bacteria 660
11 Ga0070682_100100954 3300005337 Bacteria 1904
12 Ga0070660_100044772 3300005339 Bacteria 3386
13 Ga0070660_100156296 3300005339 Bacteria 1836
14 Ga0070687_100055398 3300005343 Bacteria 2070
15 Ga0070661_100043378 3300005344 Bacteria 3285
16 Ga0070692_11070321 3300005345 Bacteria 568
17 Ga0070669_100982973 3300005353 Bacteria 723
18 Ga0070675_100081325 3300005354 Bacteria 2701
19 Ga0070674_100840543 3300005356 Bacteria 796
20 Ga0070673_100321040 3300005364 Bacteria 1368
21 Ga0070673_100799652 3300005364 Bacteria 871
22 Ga0070688_100845418 3300005365 Bacteria 718
23 Ga0070688_100986275 3300005365 Bacteria 668
24 Ga0070659_100065516 3300005366 Bacteria 2877
25 Ga0070701_11302445 3300005438 Bacteria 519
26 Ga0070708_101041250 3300005445 Bacteria 767
27 Ga0070663_100202016 3300005455 Bacteria 1552
28 Ga0070678_100851933 3300005456 Bacteria 830
29 Ga0070662_100309516 3300005457 Bacteria 1285
30 Ga0070681_10066781 3300005458 Bacteria 3565
31 Ga0070681_10286532 3300005458 Bacteria 1557
32 Ga0068867_100869223 3300005459 Bacteria 809
33 Ga0070685_10040511 3300005466 Bacteria 2651
34 Ga0070698_100280703 3300005471 Bacteria 1597
35 Ga0070698_100490089 3300005471 Bacteria 1166
36 Ga0070679_100162713 3300005530 Bacteria 2205
37 Ga0070679_101480849 3300005530 Bacteria 625
38 Ga0070684_100049835 3300005535 Bacteria 3636
39 Ga0070684_100265911 3300005535 Bacteria 1569
40 Ga0070684_100412865 3300005535 Bacteria 1245
41 Ga0070684_100586895 3300005535 Bacteria 1035
42 Ga0070684_101527241 3300005535 Bacteria 629
43 Ga0070697_100037503 3300005536 Bacteria 3917
44 Ga0068853_100063679 3300005539 Bacteria 3194
45 Ga0068853_100661779 3300005539 Bacteria 994
46 Ga0070672_101403910 3300005543 Bacteria 625
47 Ga0070696_100000781 3300005546 Bacteria 20461
48 Ga0070693_100300508 3300005547 Bacteria 1082
49 Ga0070693_101077635 3300005547 Bacteria 612
50 Ga0070665_100001227 3300005548 Bacteria 31181
51 Ga0070665_100717919 3300005548 Bacteria 1012
52 Ga0070665_100907566 3300005548 Bacteria 893
53 Ga0070704_100008774 3300005549 Bacteria 6082
54 Ga0068855_100059449 3300005563 Bacteria 4472
55 Ga0068855_101134313 3300005563 Bacteria 816
56 Ga0068857_100016248 3300005577 Bacteria 6521
57 Ga0068857_100260844 3300005577 Bacteria 1590
58 Ga0068857_100953024 3300005577 Bacteria 824
59 Ga0068854_100484303 3300005578 Bacteria 1039
60 Ga0068856_100099659 3300005614 Bacteria 2897
61 Ga0070702_100492370 3300005615 Bacteria 898
62 Ga0068852_100252987 3300005616 Bacteria 1688
63 Ga0068859_101219229 3300005617 Bacteria 829
64 Ga0068864_100018787 3300005618 Bacteria 5777
65 Ga0068864_101537059 3300005618 Bacteria 669
66 Ga0068861_100225129 3300005719 Bacteria 1587
67 Ga0068861_100682431 3300005719 Bacteria 952
68 Ga0068861_101456791 3300005719 Bacteria 670
69 Ga0068863_100165653 3300005841 Bacteria 2119
70 Ga0068863_100521590 3300005841 Bacteria 1171
71 Ga0068858_100025923 3300005842 Bacteria 5452
72 Ga0068858_100070164 3300005842 Bacteria 3247
73 Ga0068860_102042224 3300005843 Bacteria 595
74 Ga0068862_100399147 3300005844 Bacteria 1286
75 Ga0068862_100843673 3300005844 Bacteria 897
76 Ga0081539_10000863 3300005985 Bacteria 58055
77 Ga0075365_10278173 3300006038 Bacteria 1177
78 Ga0068871_100489126 3300006358 Bacteria 1108
79 Ga0075430_100064677 3300006846 Bacteria 3073
80 Ga0075431_100003860 3300006847 Bacteria 14572
81 Ga0075431_100055417 3300006847 Bacteria 4089
82 Ga0075431_100171409 3300006847 Bacteria 2229
83 Ga0075431_100320607 3300006847 Bacteria 1563
84 Ga0075433_10016707 3300006852 Bacteria 6059
85 Ga0075433_10108180 3300006852 Bacteria 2466
86 Ga0075434_100008196 3300006871 Bacteria 9695
87 Ga0075434_100436654 3300006871 Bacteria 1330
88 Ga0075429_100266014 3300006880 Bacteria 1501
89 Ga0068865_100757317 3300006881 Bacteria 835
90 Ga0075436_100035271 3300006914 Bacteria 3451
91 Ga0075436_100235850 3300006914 Bacteria 1300
92 Ga0097620_101219181 3300006931 Bacteria 829
93 Ga0075435_100120132 3300007076 Bacteria 2192
94 Ga0075435_100130155 3300007076 Bacteria 2105
95 Ga0075435_100569179 3300007076 Bacteria 982
96 Ga0111539_10590320 3300009094 Bacteria 1294
97 Ga0105245_10135083 3300009098 Bacteria 2317
98 Ga0105245_10306186 3300009098 Bacteria 1561
99 Ga0105245_10363034 3300009098 Bacteria 1438
100 Ga0105245_11538154 3300009098 Bacteria 716
101 Ga0105245_11950911 3300009098 Bacteria 640
102 Ga0114129_10147774 3300009147 Bacteria 3218
103 Ga0114129_11765387 3300009147 Bacteria 753
104 Ga0105243_10230695 3300009148 Bacteria 1642
105 Ga0105243_10520166 3300009148 Bacteria 1131
106 Ga0105241_11972325 3300009174 Bacteria 574
107 Ga0105242_11532148 3300009176 Bacteria 698
108 Ga0105242_12558228 3300009176 Bacteria 559
109 Ga0105248_10118751 3300009177 Bacteria 2983
110 Ga0105248_10187100 3300009177 Bacteria 2333
111 Ga0105248_10446980 3300009177 Bacteria 1456
112 Ga0105238_10286599 3300009551 Bacteria 1629
113 Ga0105238_12268914 3300009551 Bacteria 578
114 Ga0105249_10071434 3300009553 Bacteria 3206
115 Ga0105249_10290843 3300009553 Bacteria 1635
116 Ga0105239_10008568 3300010375 Bacteria 11605
117 Ga0105239_10120462 3300010375 Bacteria 2914
118 Ga0105239_10370965 3300010375 Bacteria 1617
119 Ga0105239_12319821 3300010375 Bacteria 625
120 Ga0105246_10003291 3300011119 Bacteria 9788
121 Ga0157371_10101944 3300013102 Bacteria 2036
122 Ga0157371_10578233 3300013102 Bacteria 834
123 Ga0157371_10925119 3300013102 Bacteria 662
124 Ga0157369_10204037 3300013105 Bacteria 2074
125 Ga0163162_10522552 3300013306 Bacteria 1316
126 Ga0163162_10604763 3300013306 Bacteria 1222
127 Ga0157372_10005885 3300013307 Bacteria 13055
128 Ga0157372_10400982 3300013307 Bacteria 1598
129 Ga0157372_11044427 3300013307 Bacteria 946
130 Ga0157375_10133981 3300013308 Bacteria 2599
131 Ga0157375_10275267 3300013308 Bacteria 1845
132 Ga0157375_11509068 3300013308 Bacteria 793
133 Ga0157375_12041511 3300013308 Bacteria 682
134 Ga0157375_12406439 3300013308 Bacteria 628
135 Ga0163163_10014332 3300014325 Bacteria 7287
136 Ga0163163_10854632 3300014325 Bacteria 973
137 Ga0182008_10056021 3300014497 Bacteria 1949
138 Ga0157377_10056219 3300014745 Bacteria 2234
139 Ga0157377_10141293 3300014745 Bacteria 1480
140 Ga0157379_10008077 3300014968 Bacteria 9143
141 Ga0157379_10157331 3300014968 Bacteria 2050
142 Ga0157376_10185454 3300014969 Bacteria 1905
143 Ga0182007_10016194 3300015262 Bacteria 2757
144 Ga0163161_10179058 3300017792 Bacteria 1624
145 Ga0206354_10960699 3300020081 Bacteria 1696
146 Ga0206353_10359518 3300020082 Bacteria 2291
147 Ga0207656_10252619 3300025321 Bacteria 864
148 Ga0207647_10011068 3300025904 Bacteria 6342
149 Ga0207647_10177107 3300025904 Bacteria 1240
150 Ga0207645_10001969 3300025907 Bacteria 16509
151 Ga0207643_10366946 3300025908 Bacteria 906
152 Ga0207705_10147788 3300025909 Bacteria 1759
153 Ga0207707_10111667 3300025912 Bacteria 2390
154 Ga0207660_10282798 3300025917 Bacteria 1317
155 Ga0207662_10060826 3300025918 Bacteria 2266
156 Ga0207657_10052128 3300025919 Bacteria 3553
157 Ga0207649_10257721 3300025920 Bacteria 1259
158 Ga0207652_10143613 3300025921 Bacteria 2135
159 Ga0207652_10506741 3300025921 Bacteria 1086
160 Ga0207681_10619509 3300025923 Bacteria 895
161 Ga0207650_10347072 3300025925 Bacteria 1220
162 Ga0207687_10038486 3300025927 Bacteria 3269
163 Ga0207687_10152830 3300025927 Bacteria 1763
164 Ga0207687_10994686 3300025927 Bacteria 719
165 Ga0207690_10071376 3300025932 Bacteria 2395
166 Ga0207690_10640506 3300025932 Bacteria 870
167 Ga0207706_10265971 3300025933 Bacteria 1497
168 Ga0207709_10370064 3300025935 Bacteria 1087
169 Ga0207670_11249451 3300025936 Bacteria 629
170 Ga0207691_10038556 3300025940 Bacteria 4422
171 Ga0207711_10087586 3300025941 Bacteria 2732
172 Ga0207711_10133291 3300025941 Bacteria 2229
173 Ga0207689_10041102 3300025942 Bacteria 3827
174 Ga0207689_10102673 3300025942 Bacteria 2349
175 Ga0207661_10014324 3300025944 Bacteria 5809
176 Ga0207661_10105416 3300025944 Bacteria 2375
177 Ga0207661_10370044 3300025944 Bacteria 1296
178 Ga0207679_10263421 3300025945 Bacteria 1471
179 Ga0207667_10370515 3300025949 Bacteria 1459
180 Ga0207712_11068884 3300025961 Bacteria 718
181 Ga0207668_10757446 3300025972 Bacteria 857
182 Ga0207640_11467835 3300025981 Bacteria 612
183 Ga0207677_10800600 3300026023 Bacteria 844
184 Ga0207703_10099000 3300026035 Bacteria 2467
185 Ga0207703_11103848 3300026035 Bacteria 762
186 Ga0207678_10160602 3300026067 Bacteria 1919
187 Ga0207708_10074420 3300026075 Bacteria 2603
188 Ga0207702_10251407 3300026078 Bacteria 1660
189 Ga0207641_10738518 3300026088 Bacteria 971
190 Ga0207641_11834546 3300026088 Bacteria 608
191 Ga0207676_10332638 3300026095 Bacteria 1398
192 Ga0207676_11582354 3300026095 Bacteria 653
193 Ga0207674_10080773 3300026116 Bacteria 3254
194 Ga0207674_10085993 3300026116 Bacteria 3139
195 Ga0207674_11051307 3300026116 Bacteria 783
196 Ga0207674_11489756 3300026116 Bacteria 646
197 Ga0207675_100316591 3300026118 Bacteria 1523
198 Ga0207675_100359288 3300026118 Bacteria 1429
199 Ga0207675_100438641 3300026118 Bacteria 1292
200 Ga0207683_10668663 3300026121 Bacteria 962
201 Ga0207698_10135762 3300026142 Bacteria 2110
202 Ga0207698_10458509 3300026142 Bacteria 1232
203 Ga0268266_10015860 3300028379 Bacteria 6447
204 Ga0268266_10873580 3300028379 Bacteria 869
205 Ga0268265_10042211 3300028380 Bacteria 3382
206 Ga0268265_10331627 3300028380 Bacteria 1382
207 Ga0268265_12188548 3300028380 Bacteria 560
208 Ga0268264_10242157 3300028381 Bacteria 1671
209 Ga0265338_10010886 3300028800 Bacteria 10585
210 Ga0265325_10002558 3300031241 Bacteria 12234
211 Ga0265340_10002694 3300031247 Bacteria 10096
212 Ga0265339_10039882 3300031249 Bacteria 2612
213 Ga0265316_10036901 3300031344 Bacteria 3951
214 Ga0265313_10019160 3300031595 Bacteria 3820
215 Ga0265314_10104387 3300031711 Bacteria 1815
216 Ga0265342_10041312 3300031712 Bacteria 2793
217 Ga0316576_10158205 3300031727 Bacteria 1708
218 Ga0316578_10097184 3300031728 Bacteria 1764
219 Ga0307409_100209883 3300031995 Bacteria 1749
220 Ga0307409_100778563 3300031995 Bacteria 963
221 Ga0307416_101156318 3300032002 Bacteria 879
222 Ga0451789_0758600 3300041443 Bacteria 635
223 Ga0451577_0457534 3300042876 Bacteria 1159
224 Ga0451577_0989932 3300042876 Bacteria 755
225 Ga0466969_0031945 3300044656 Bacteria 2678
226 Ga0466966_0058303 3300044684 Bacteria 2440
227 Ga0466961_0013963 3300044693 Bacteria 5147
228 Ga0466963_0008853 3300044694 Bacteria 6040
229 Ga0466963_0019278 3300044694 Bacteria 4276
230 Ga0466963_0045703 3300044694 Bacteria 2885
231 Ga0466963_0088486 3300044694 Bacteria 2107
232 Ga0466963_0095624 3300044694 Bacteria 2028
233 Ga0466963_0122038 3300044694 Bacteria 1794
234 Ga0466963_0764582 3300044694 Bacteria 681
235 Ga0466963_0837757 3300044694 Bacteria 648
236 Ga0466964_0008672 3300044706 Bacteria 3823
237 Ga0466970_0357240 3300044765 Bacteria 829
238 Ga0466957_0178349 3300044842 Bacteria 1386
239 Ga0466959_0114161 3300045049 Bacteria 1925
240 Ga0466959_0338597 3300045049 Bacteria 1026
241 Ga0451576_0021764 3300045051 Bacteria 6959
242 Ga0451576_0350009 3300045051 Bacteria 1547
243 Ga0451576_0566050 3300045051 Bacteria 1194
244 Ga0466958_0546039 3300045836 Bacteria 753
245 Ga0466967_0119268 3300045976 Bacteria 2435
246 Ga0466967_0141975 3300045976 Bacteria 2237
247 Ga0466967_0286917 3300045976 Bacteria 1580
248 Ga0466967_0691809 3300045976 Bacteria 1009
249 Ga0466967_0796810 3300045976 Bacteria 938
250 Ga0466967_0924598 3300045976 Bacteria 868
251 Ga0466967_1384219 3300045976 Bacteria 701
252 Ga0495629_0186433 3300046459 Bacteria 1437
253 Ga0495641_0309312 3300046461 Bacteria 713
254 Ga0495582_0074865 3300046473 Bacteria 1875
255 Ga0495633_0424525 3300046558 Bacteria 601
256 Ga0495658_0054615 3300046683 Bacteria 2273
257 Ga0495614_0158284 3300048089 Bacteria 1013
258 Ga0496100_0225614 3300048903 Bacteria 1376
259 Ga0496100_0279800 3300048903 Bacteria 1243
260 Ga0496100_0295931 3300048903 Bacteria 1210
261 Ga0496101_0080959 3300048904 Bacteria 2400
262 Ga0496101_0099581 3300048904 Bacteria 2173
263 Ga0496101_0224833 3300048904 Bacteria 1457
264 Ga0496102_0012558 3300048905 Bacteria 7336
265 Ga0496102_0189035 3300048905 Bacteria 1940
266 Ga0496102_0320404 3300048905 Bacteria 1460
267 Ga0496102_0724057 3300048905 Bacteria 918
268 Ga0496103_0343274 3300048906 Bacteria 960
269 Ga0496103_0757754 3300048906 Bacteria 614
270 Ga0496104_0019408 3300048907 Bacteria 6219
271 Ga0496105_0030143 3300048908 Bacteria 4444
272 Ga0496105_0414709 3300048908 Bacteria 1067
273 Ga0496105_0530285 3300048908 Bacteria 921
274 Ga0496107_0014131 3300048910 Bacteria 5588
275 Ga0496107_1051716 3300048910 Bacteria 589
276 Ga0496108_0106330 3300048911 Bacteria 2396
277 Ga0496109_0006561 3300048912 Bacteria 9797
278 Ga0496109_0045062 3300048912 Bacteria 4002
279 Ga0496109_0055010 3300048912 Bacteria 3630
280 Ga0496110_0074201 3300048913 Bacteria 3020
281 Ga0496110_0693634 3300048913 Bacteria 919
282 Ga0496110_0988716 3300048913 Bacteria 749
283 Ga0496111_0006590 3300048914 Bacteria 7553
284 Ga0496111_0290885 3300048914 Bacteria 1211
285 Ga0496111_0916166 3300048914 Bacteria 631
286 Ga0496111_1006278 3300048914 Bacteria 597
287 Ga0496112_0786569 3300048915 Bacteria 877
288 Ga0496112_0828496 3300048915 Bacteria 849
289 Ga0496113_0109004 3300048916 Bacteria 2153
290 Ga0496113_0162630 3300048916 Bacteria 1765
291 Ga0496113_1278845 3300048916 Bacteria 571
292 Ga0496114_0003516 3300048917 Bacteria 12024
293 Ga0496114_0027985 3300048917 Bacteria 4622
294 Ga0496114_0084121 3300048917 Bacteria 2693
295 Ga0496114_0130034 3300048917 Bacteria 2174
296 Ga0496114_0931768 3300048917 Bacteria 750
297 Ga0496114_1341967 3300048917 Bacteria 602
298 Ga0496115_0010285 3300048918 Bacteria 6984
299 Ga0496115_0258162 3300048918 Bacteria 1433
300 Ga0496115_0305852 3300048918 Bacteria 1302
301 Ga0501034_0005747 3300049571 Bacteria 13490
302 Ga0501034_0068876 3300049571 Bacteria 3549
303 Ga0501036_1699185 3300049572 Bacteria 509
304 Ga0501038_0749920 3300049574 Bacteria 728
305 Ga0501039_0304213 3300049575 Bacteria 1254
306 Ga0501039_1387427 3300049575 Bacteria 541
307 Ga0501040_0317383 3300049576 Bacteria 1114
308 Ga0501040_0382365 3300049576 Bacteria 1010
309 Ga0501041_0258513 3300049577 Bacteria 1095
310 Ga0501043_0770920 3300049579 Bacteria 698
311 Ga0501047_0285279 3300049581 Bacteria 1495
312 Ga0501047_1037958 3300049581 Bacteria 633
313 Ga0501067_0000402 3300049583 Bacteria 23631
314 Ga0501067_0001135 3300049583 Bacteria 14417
315 Ga0501067_0101961 3300049583 Bacteria 1595
316 Ga0501068_0008463 3300049584 Bacteria 5725
317 Ga0501068_0025748 3300049584 Bacteria 3462
318 Ga0501069_0004087 3300049585 Bacteria 7528
319 Ga0501069_0007638 3300049585 Bacteria 5672
320 Ga0501069_0022064 3300049585 Bacteria 3460
321 Ga0501069_0037861 3300049585 Bacteria 2661
322 Ga0501069_0075318 3300049585 Bacteria 1895
323 Ga0501070_0002663 3300049586 Bacteria 15583
324 Ga0501070_0004379 3300049586 Bacteria 12135
325 Ga0501070_0007935 3300049586 Bacteria 8992
326 Ga0501070_0115457 3300049586 Bacteria 2217
327 Ga0501070_0880894 3300049586 Bacteria 699
328 Ga0501071_0001586 3300049587 Bacteria 13311
329 Ga0501072_0024511 3300049588 Bacteria 4694
330 Ga0501072_0293902 3300049588 Bacteria 1291
331 Ga0501073_0001251 3300049589 Bacteria 18591
332 Ga0501073_0023434 3300049589 Bacteria 4432
333 Ga0501074_0006403 3300049590 Bacteria 8503
334 Ga0501074_0008967 3300049590 Bacteria 7256
335 Ga0501074_0018197 3300049590 Bacteria 5104
336 Ga0501075_0202759 3300049591 Bacteria 1513
337 Ga0501077_0000580 3300049593 Bacteria 22152
338 Ga0501077_0039256 3300049593 Bacteria 3015
339 Ga0501079_0012773 3300049741 Bacteria 6415
340 Ga0501079_0131670 3300049741 Bacteria 1946
341 Ga0501079_0528865 3300049741 Bacteria 927
342 Ga0501079_0827494 3300049741 Bacteria 729
343 Ga0501080_0002196 3300049742 Bacteria 16954
344 Ga0501080_0002243 3300049742 Bacteria 16800
345 Ga0501080_0280547 3300049742 Bacteria 1515
346 Ga0501081_0053409 3300049743 Bacteria 2790
347 Ga0501081_0281210 3300049743 Bacteria 1218
348 Ga0501083_0023094 3300049744 Bacteria 4316
349 Ga0501083_0086851 3300049744 Bacteria 2068
350 Ga0501044_0351338 3300049823 Bacteria 1394
351 nmdc:mga05p37_103321_c1 3300050507 Bacteria 3508
352 nmdc:mga05p37_505522_c1 3300050507 Bacteria 1386
353 nmdc:mga09592_519572_c1 3300050508 Bacteria 1024
354 nmdc:mga0qj67_123441_c1 3300050509 Bacteria 2095
355 nmdc:mga0qj67_163683_c1 3300050509 Bacteria 1806
356 nmdc:mga06r32_15592_c1 3300050510 Bacteria 6904
357 nmdc:mga06r32_217819_c1 3300050510 Bacteria 1897
358 nmdc:mga06r32_310748_c1 3300050510 Bacteria 1562
359 nmdc:mga0n895_432644_c1 3300050512 Bacteria 1330
360 nmdc:mga0n895_71306_c1 3300050512 Bacteria 3445
361 nmdc:mga0n895_723977_c1 3300050512 Bacteria 990
362 nmdc:mga0rr50_1220303_c1 3300050513 Unclassified 639
363 nmdc:mga0rr50_384876_c1 3300050513 Bacteria 1183
364 nmdc:mga08x19_585076_c1 3300050514 Bacteria 791
365 nmdc:mga08x19_75435_c1 3300050514 Bacteria 2205
366 nmdc:mga0a205_176793_c1 3300050515 Bacteria 2030
367 nmdc:mga0a205_60112_c1 3300050515 Bacteria 3670
368 Ga0501084_0014424 3300054114 Bacteria 6548
369 Ga0501084_0583666 3300054114 Bacteria 944
370 Ga0501084_0986833 3300054114 Bacteria 708
371 Ga0501082_0003022 3300060353 Bacteria 14697
372 Ga0501082_0797701 3300060353 Bacteria 826
373 Ga0501082_1514600 3300060353 Bacteria 586
374 Ga0530510_0698796 3300061734 Bacteria 773
375 Ga0530510_1421808 3300061734 Bacteria 532
376 2793983067 2791355406 Bacteria 11364898
377 2990089008 2990088156 Bacteria 6657676
378 8048361148 8048356638 Bacteria 11044339
379 Ga0070683_100998489
380 JGI24735J21928_10012231
381 JGI25406J46586_10059575
382 Ga0070658_10278476
383 Ga0070683_100059925
384 Ga0070683_100074743
385 Ga0070683_100265929
386 Ga0070670_100268783
387 Ga0068869_100070343
388 Ga0068869_101227056
389 Ga0070682_100100954
390 Ga0070660_100044772
391 Ga0070660_100156296
392 Ga0070687_100055398
393 Ga0070661_100043378
394 Ga0070692_11070321
395 Ga0070669_100982973
396 Ga0070675_100081325
397 Ga0070674_100840543
398 Ga0070673_100321040
399 Ga0070673_100799652
400 Ga0070688_100845418
401 Ga0070688_100986275
402 Ga0070659_100065516
403 Ga0070701_11302445
404 Ga0070708_101041250
405 Ga0070663_100202016
406 Ga0070678_100851933
407 Ga0070662_100309516
408 Ga0070681_10066781
409 Ga0070681_10286532
410 Ga0068867_100869223
411 Ga0070685_10040511
412 Ga0070698_100280703
413 Ga0070698_100490089
414 Ga0070679_100162713
415 Ga0070679_101480849
416 Ga0070684_100049835
417 Ga0070684_100265911
418 Ga0070684_100412865
419 Ga0070684_100586895
420 Ga0070684_101527241
421 Ga0070697_100037503
422 Ga0068853_100063679
423 Ga0068853_100661779
424 Ga0070672_101403910
425 Ga0070696_100000781
426 Ga0070693_100300508
427 Ga0070693_101077635
428 Ga0070665_100001227
429 Ga0070665_100717919
430 Ga0070665_100907566
431 Ga0070704_100008774
432 Ga0068855_100059449
433 Ga0068855_101134313
434 Ga0068857_100016248
435 Ga0068857_100260844
436 Ga0068857_100953024
437 Ga0068854_100484303
438 Ga0068856_100099659
439 Ga0070702_100492370
440 Ga0068852_100252987
441 Ga0068859_101219229
442 Ga0068864_100018787
443 Ga0068864_101537059
444 Ga0068861_100225129
445 Ga0068861_100682431
446 Ga0068861_101456791
447 Ga0068863_100165653
448 Ga0068863_100521590
449 Ga0068858_100025923
450 Ga0068858_100070164
451 Ga0068860_102042224
452 Ga0068862_100399147
453 Ga0068862_100843673
454 Ga0081539_10000863
455 Ga0075365_10278173
456 Ga0068871_100489126
457 Ga0075430_100064677
458 Ga0075431_100003860
459 Ga0075431_100055417
460 Ga0075431_100171409
461 Ga0075431_100320607
462 Ga0075433_10016707
463 Ga0075433_10108180
464 Ga0075434_100008196
465 Ga0075434_100436654
466 Ga0075429_100266014
467 Ga0068865_100757317
468 Ga0075436_100035271
469 Ga0075436_100235850
470 Ga0097620_101219181
471 Ga0075435_100120132
472 Ga0075435_100130155
473 Ga0075435_100569179
474 Ga0111539_10590320
475 Ga0105245_10135083
476 Ga0105245_10306186
477 Ga0105245_10363034
478 Ga0105245_11538154
479 Ga0105245_11950911
480 Ga0114129_10147774
481 Ga0114129_11765387
482 Ga0105243_10230695
483 Ga0105243_10520166
484 Ga0105241_11972325
485 Ga0105242_11532148
486 Ga0105242_12558228
487 Ga0105248_10118751
488 Ga0105248_10187100
489 Ga0105248_10446980
490 Ga0105238_10286599
491 Ga0105238_12268914
492 Ga0105249_10071434
493 Ga0105249_10290843
494 Ga0105239_10008568
495 Ga0105239_10120462
496 Ga0105239_10370965
497 Ga0105239_12319821
498 Ga0105246_10003291
499 Ga0157371_10101944
500 Ga0157371_10578233
501 Ga0157371_10925119
502 Ga0157369_10204037
503 Ga0163162_10522552
504 Ga0163162_10604763
505 Ga0157372_10005885
506 Ga0157372_10400982
507 Ga0157372_11044427
508 Ga0157375_10133981
509 Ga0157375_10275267
510 Ga0157375_11509068
511 Ga0157375_12041511
512 Ga0157375_12406439
513 Ga0163163_10014332
514 Ga0163163_10854632
515 Ga0182008_10056021
516 Ga0157377_10056219
517 Ga0157377_10141293
518 Ga0157379_10008077
519 Ga0157379_10157331
520 Ga0157376_10185454
521 Ga0182007_10016194
522 Ga0163161_10179058
523 Ga0206354_10960699
524 Ga0206353_10359518
525 Ga0207656_10252619
526 Ga0207647_10011068
527 Ga0207647_10177107
528 Ga0207645_10001969
529 Ga0207643_10366946
530 Ga0207705_10147788
531 Ga0207707_10111667
532 Ga0207660_10282798
533 Ga0207662_10060826
534 Ga0207657_10052128
535 Ga0207649_10257721
536 Ga0207652_10143613
537 Ga0207652_10506741
538 Ga0207681_10619509
539 Ga0207650_10347072
540 Ga0207687_10038486
541 Ga0207687_10152830
542 Ga0207687_10994686
543 Ga0207690_10071376
544 Ga0207690_10640506
545 Ga0207706_10265971
546 Ga0207709_10370064
547 Ga0207670_11249451
548 Ga0207691_10038556
549 Ga0207711_10087586
550 Ga0207711_10133291
551 Ga0207689_10041102
552 Ga0207689_10102673
553 Ga0207661_10014324
554 Ga0207661_10105416
555 Ga0207661_10370044
556 Ga0207679_10263421
557 Ga0207667_10370515
558 Ga0207712_11068884
559 Ga0207668_10757446
560 Ga0207640_11467835
561 Ga0207677_10800600
562 Ga0207703_10099000
563 Ga0207703_11103848
564 Ga0207678_10160602
565 Ga0207708_10074420
566 Ga0207702_10251407
567 Ga0207641_10738518
568 Ga0207641_11834546
569 Ga0207676_10332638
570 Ga0207676_11582354
571 Ga0207674_10080773
572 Ga0207674_10085993
573 Ga0207674_11051307
574 Ga0207674_11489756
575 Ga0207675_100316591
576 Ga0207675_100359288
577 Ga0207675_100438641
578 Ga0207683_10668663
579 Ga0207698_10135762
580 Ga0207698_10458509
581 Ga0268266_10015860
582 Ga0268266_10873580
583 Ga0268265_10042211
584 Ga0268265_10331627
585 Ga0268265_12188548
586 Ga0268264_10242157
587 Ga0265338_10010886
588 Ga0265325_10002558
589 Ga0265340_10002694
590 Ga0265339_10039882
591 Ga0265316_10036901
592 Ga0265313_10019160
593 Ga0265314_10104387
594 Ga0265342_10041312
595 Ga0316576_10158205
596 Ga0316578_10097184
597 Ga0307409_100209883
598 Ga0307409_100778563
599 Ga0307416_101156318
600 Ga0451789_0758600
601 Ga0451577_0457534
602 Ga0451577_0989932
603 Ga0466969_0031945
604 Ga0466966_0058303
605 Ga0466961_0013963
606 Ga0466963_0008853
607 Ga0466963_0019278
608 Ga0466963_0045703
609 Ga0466963_0088486
610 Ga0466963_0095624
611 Ga0466963_0122038
612 Ga0466963_0764582
613 Ga0466963_0837757
614 Ga0466964_0008672
615 Ga0466970_0357240
616 Ga0466957_0178349
617 Ga0466959_0114161
618 Ga0466959_0338597
619 Ga0451576_0021764
620 Ga0451576_0350009
621 Ga0451576_0566050
622 Ga0466958_0546039
623 Ga0466967_0119268
624 Ga0466967_0141975
625 Ga0466967_0286917
626 Ga0466967_0691809
627 Ga0466967_0796810
628 Ga0466967_0924598
629 Ga0466967_1384219
630 Ga0495629_0186433
631 Ga0495641_0309312
632 Ga0495582_0074865
633 Ga0495633_0424525
634 Ga0495658_0054615
635 Ga0495614_0158284
636 Ga0496100_0225614
637 Ga0496100_0279800
638 Ga0496100_0295931
639 Ga0496101_0080959
640 Ga0496101_0099581
641 Ga0496101_0224833
642 Ga0496102_0012558
643 Ga0496102_0189035
644 Ga0496102_0320404
645 Ga0496102_0724057
646 Ga0496103_0343274
647 Ga0496103_0757754
648 Ga0496104_0019408
649 Ga0496105_0030143
650 Ga0496105_0414709
651 Ga0496105_0530285
652 Ga0496107_0014131
653 Ga0496107_1051716
654 Ga0496108_0106330
655 Ga0496109_0006561
656 Ga0496109_0045062
657 Ga0496109_0055010
658 Ga0496110_0074201
659 Ga0496110_0693634
660 Ga0496110_0988716
661 Ga0496111_0006590
662 Ga0496111_0290885
663 Ga0496111_0916166
664 Ga0496111_1006278
665 Ga0496112_0786569
666 Ga0496112_0828496
667 Ga0496113_0109004
668 Ga0496113_0162630
669 Ga0496113_1278845
670 Ga0496114_0003516
671 Ga0496114_0027985
672 Ga0496114_0084121
673 Ga0496114_0130034
674 Ga0496114_0931768
675 Ga0496114_1341967
676 Ga0496115_0010285
677 Ga0496115_0258162
678 Ga0496115_0305852
679 Ga0501034_0005747
680 Ga0501034_0068876
681 Ga0501036_1699185
682 Ga0501038_0749920
683 Ga0501039_0304213
684 Ga0501039_1387427
685 Ga0501040_0317383
686 Ga0501040_0382365
687 Ga0501041_0258513
688 Ga0501043_0770920
689 Ga0501047_0285279
690 Ga0501047_1037958
691 Ga0501067_0000402
692 Ga0501067_0001135
693 Ga0501067_0101961
694 Ga0501068_0008463
695 Ga0501068_0025748
696 Ga0501069_0004087
697 Ga0501069_0007638
698 Ga0501069_0022064
699 Ga0501069_0037861
700 Ga0501069_0075318
701 Ga0501070_0002663
702 Ga0501070_0004379
703 Ga0501070_0007935
704 Ga0501070_0115457
705 Ga0501070_0880894
706 Ga0501071_0001586
707 Ga0501072_0024511
708 Ga0501072_0293902
709 Ga0501073_0001251
710 Ga0501073_0023434
711 Ga0501074_0006403
712 Ga0501074_0008967
713 Ga0501074_0018197
714 Ga0501075_0202759
715 Ga0501077_0000580
716 Ga0501077_0039256
717 Ga0501079_0012773
718 Ga0501079_0131670
719 Ga0501079_0528865
720 Ga0501079_0827494
721 Ga0501080_0002196
722 Ga0501080_0002243
723 Ga0501080_0280547
724 Ga0501081_0053409
725 Ga0501081_0281210
726 Ga0501083_0023094
727 Ga0501083_0086851
728 Ga0501044_0351338
729 nmdc:mga05p37_103321_c1
730 nmdc:mga05p37_505522_c1
731 nmdc:mga09592_519572_c1
732 nmdc:mga0qj67_123441_c1
733 nmdc:mga0qj67_163683_c1
734 nmdc:mga06r32_15592_c1
735 nmdc:mga06r32_217819_c1
736 nmdc:mga06r32_310748_c1
737 nmdc:mga0n895_432644_c1
738 nmdc:mga0n895_71306_c1
739 nmdc:mga0n895_723977_c1
740 nmdc:mga0rr50_1220303_c1
741 nmdc:mga0rr50_384876_c1
742 nmdc:mga08x19_585076_c1
743 nmdc:mga08x19_75435_c1
744 nmdc:mga0a205_176793_c1
745 nmdc:mga0a205_60112_c1
746 Ga0501084_0014424
747 Ga0501084_0583666
748 Ga0501084_0986833
749 Ga0501082_0003022
750 Ga0501082_0797701
751 Ga0501082_1514600
752 Ga0530510_0698796
753 Ga0530510_1421808
754 2793983067
755 2990089008
756 8048361148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

15

115

0.97

PF14437

MafB19-deam

MafB19-like deaminase

16

162

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e2r-assembly1.cif.gz_A crystal structure of tadac-1.14 0.9814 16 158
6vpc-assembly1.cif.gz_F structure of the spcas9 dna adenine base editor - abe8e 0.9566 17 159
1z3a-assembly1.cif.gz_B crystal structure of trna adenosine deaminase tada from escherichia coli 0.9548 16 163
8e2r-assembly1.cif.gz_A crystal structure of tadac-1.14 0.9547 16 158
3ocq-assembly1.cif.gz_A-2 crystal structure of trna-specific adenosine deaminase from salmonella enterica 0.9542 16 159
ID Description Score Start End Superfamily
af_A0A1D6PV52_1_75_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9801 57 114 3.40.140.10
2b3jA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9552 14 164 3.40.140.10
1z3aA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.953 16 163 3.40.140.10
2nx8A00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9466 13 162 3.40.140.10
af_O69719_1_151_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.944 16 162 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A451DBW7-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9783 13 163 GO:0002100
GO:0008270
GO:0052717
AF-J2YXH7-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9646 13 161 GO:0002100
GO:0008270
GO:0052717
AF-J0XBW0-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9643 13 161 GO:0002100
GO:0008270
GO:0052717
AF-J1LS20-F1-model_v4 tRNA(adenine(34)) deaminase (EC 3.5.4.33) 0.9642 14 161 GO:0002100
GO:0008270
GO:0052717
AF-A0A7Y9H1P0-F1-model_v4 tRNA-specific adenosine deaminase (EC 3.5.4.33) 0.9641 16 163 GO:0002100
GO:0008270
GO:0052717

Map