F427749

General Info

Members Datasets Scaffolds Average Seq Length
377 210 754 327

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0031021|Ga0373947_0031021_1920_2897
Length 325
Sequence MRRREFITLFGGAAATTAWPLTARAQQPERVRRVGVLQGGAADDLVLQAGFDTFLQGLQQLGWIDGRNVRFDRRLGAGDADNIRKHAAELAALAPDVILAGGSTGLGQLLQATRTLPIVFLFVPDPVGSGFVKSLSRPGGNATGFMAFEYSLSAKWLELLKEIAPGVTRAAVLWDPAIPAGIGQFAVIQSVAPSLGVELTPVDVRDVEQDVAAFARSGSGGLIVTASAPTLVHRDLIIALAARHKLPAVYNFRAFVTSGGLISYGANIIDQFRGAAGYVDRILKGEKPADLPVQAPRSMSWSSTSRPPRRWASNCHPHCSPAPTR

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
115 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
116 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
117 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
118 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
121 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 11.14
Rhizosphere 88.06
Stem 0
Stem Tuber 0
Unclassified 7.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0031021 3300035725 Bacteria 3143
2 2214884077 2209111006 Bacteria 7789
3 ARcpr5oldR_c000514 3300000041 Bacteria 4866
4 ARSoilOldRDRAFT_c000042 3300000044 Bacteria 28169
5 JGI24737J22298_10026811 3300001990 Bacteria 1819
6 JGI25405J52794_10005315 3300003911 Bacteria 2318
7 JGI25405J52794_10006873 3300003911 Bacteria 2085
8 Ga0065704_10106349 3300005289 Bacteria 2085
9 Ga0065712_10103155 3300005290 Bacteria 1991
10 Ga0065715_10005534 3300005293 Bacteria 3837
11 Ga0070690_100006516 3300005330 Bacteria 6624
12 Ga0070690_100008074 3300005330 Bacteria 6046
13 Ga0070680_100086958 3300005336 Bacteria 2584
14 Ga0070689_100001597 3300005340 Bacteria 14465
15 Ga0070689_100125191 3300005340 Unclassified 2056
16 Ga0070689_100155779 3300005340 Bacteria 1844
17 Ga0070691_10137256 3300005341 Bacteria 1243
18 Ga0070692_10019042 3300005345 Bacteria 3310
19 Ga0070668_100128129 3300005347 Bacteria 2035
20 Ga0070668_100135065 3300005347 Bacteria 1983
21 Ga0070669_100020474 3300005353 Bacteria 4725
22 Ga0070671_100050258 3300005355 Bacteria 3468
23 Ga0070671_100246483 3300005355 Unclassified 1517
24 Ga0070688_100131801 3300005365 Bacteria 1687
25 Ga0070659_100019929 3300005366 Bacteria 5090
26 Ga0070667_100034902 3300005367 Bacteria 4211
27 Ga0070667_100103219 3300005367 Bacteria 2464
28 Ga0070703_10067154 3300005406 Bacteria 1188
29 Ga0070709_10088159 3300005434 Bacteria 2040
30 Ga0070709_10125072 3300005434 Bacteria 1748
31 Ga0070705_100181004 3300005440 Bacteria 1428
32 Ga0070678_100023403 3300005456 Bacteria 4116
33 Ga0070662_100221171 3300005457 Bacteria 1511
34 Ga0070681_10053887 3300005458 Bacteria 4008
35 Ga0070681_10137857 3300005458 Bacteria 2370
36 Ga0070685_10017394 3300005466 Bacteria 3848
37 Ga0070699_100005058 3300005518 Bacteria 11608
38 Ga0070699_100513651 3300005518 Bacteria 1089
39 Ga0070679_100031347 3300005530 Bacteria 5251
40 Ga0070679_100132492 3300005530 Bacteria 2474
41 Ga0070684_100112113 3300005535 Bacteria 2446
42 Ga0070672_100040878 3300005543 Bacteria 3561
43 Ga0070672_100309724 3300005543 Bacteria 1340
44 Ga0070695_100087309 3300005545 Bacteria 2075
45 Ga0070696_100065848 3300005546 Bacteria 2540
46 Ga0070693_100074892 3300005547 Bacteria 2003
47 Ga0070704_100092776 3300005549 Bacteria 2254
48 Ga0070704_100218313 3300005549 Bacteria 1549
49 Ga0068855_100248317 3300005563 Bacteria 1985
50 Ga0070664_100045408 3300005564 Bacteria 3710
51 Ga0070664_100488739 3300005564 Bacteria 1133
52 Ga0068859_100064191 3300005617 Bacteria 3704
53 Ga0068864_100013954 3300005618 Bacteria 6661
54 Ga0068861_100170641 3300005719 Bacteria 1803
55 Ga0068870_10071085 3300005840 Bacteria 1898
56 Ga0068863_100287984 3300005841 Bacteria 1592
57 Ga0068860_100232211 3300005843 Bacteria 1793
58 Ga0068862_100029947 3300005844 Bacteria 4586
59 Ga0081455_10001454 3300005937 Bacteria 29316
60 Ga0081455_10003945 3300005937 Bacteria 16855
61 Ga0081455_10013667 3300005937 Bacteria 7997
62 Ga0081455_10051658 3300005937 Bacteria 3525
63 Ga0081455_10057731 3300005937 Bacteria 3288
64 Ga0081455_10093115 3300005937 Bacteria 2437
65 Ga0081455_10144899 3300005937 Bacteria 1839
66 Ga0081538_10035259 3300005981 Bacteria 3289
67 Ga0070712_100022067 3300006175 Bacteria 4189
68 Ga0075428_100095684 3300006844 Bacteria 3237
69 Ga0075428_100329426 3300006844 Bacteria 1640
70 Ga0075430_100029679 3300006846 Bacteria 4641
71 Ga0075430_100050044 3300006846 Bacteria 3525
72 Ga0075430_100080619 3300006846 Bacteria 2726
73 Ga0075431_100086737 3300006847 Bacteria 3230
74 Ga0075433_10267593 3300006852 Bacteria 1515
75 Ga0075434_100088994 3300006871 Bacteria 3089
76 Ga0075429_100063803 3300006880 Bacteria 3209
77 Ga0097620_100064188 3300006931 Bacteria 3704
78 Ga0111539_10014164 3300009094 Bacteria 9957
79 Ga0111539_10098341 3300009094 Bacteria 3437
80 Ga0111539_10103305 3300009094 Bacteria 3345
81 Ga0105245_10172307 3300009098 Bacteria 2062
82 Ga0105247_10024552 3300009101 Unclassified 3634
83 Ga0114129_10154662 3300009147 Bacteria 3137
84 Ga0114129_10169450 3300009147 Bacteria 2978
85 Ga0114129_10618946 3300009147 Bacteria 1401
86 Ga0114129_10637158 3300009147 Bacteria 1377
87 Ga0114129_10719346 3300009147 Bacteria 1281
88 Ga0105241_10110505 3300009174 Bacteria 2199
89 Ga0105248_10373163 3300009177 Bacteria 1606
90 Ga0105249_10003992 3300009553 Bacteria 12734
91 Ga0105239_10116710 3300010375 Bacteria 2962
92 Ga0105239_10244154 3300010375 Bacteria 2016
93 Ga0105239_10319982 3300010375 Unclassified 1749
94 Ga0105246_10205123 3300011119 Unclassified 1535
95 Ga0163162_10104904 3300013306 Bacteria 2921
96 Ga0163162_10311272 3300013306 Bacteria 1707
97 Ga0157372_10544052 3300013307 Bacteria 1354
98 Ga0157375_10100639 3300013308 Bacteria 2971
99 Ga0157375_10648704 3300013308 Bacteria 1212
100 Ga0163163_10099138 3300014325 Bacteria 2935
101 Ga0157380_10040940 3300014326 Bacteria 3613
102 Ga0182008_10064689 3300014497 Bacteria 1800
103 Ga0157377_10218528 3300014745 Bacteria 1219
104 Ga0157379_10042403 3300014968 Unclassified 4063
105 Ga0157379_10051106 3300014968 Bacteria 3692
106 Ga0157379_10269400 3300014968 Bacteria 1548
107 Ga0157376_10101896 3300014969 Bacteria 2510
108 Ga0157376_10238770 3300014969 Unclassified 1692
109 Ga0157376_10507653 3300014969 Bacteria 1186
110 Ga0163161_10363876 3300017792 Bacteria 1152
111 Ga0213874_10030814 3300021377 Bacteria 1548
112 Ga0207666_1003448 3300025271 Bacteria 1946
113 Ga0207653_10070366 3300025885 Bacteria 1195
114 Ga0207692_10024305 3300025898 Bacteria 2815
115 Ga0207692_10028047 3300025898 Bacteria 2658
116 Ga0207692_10075409 3300025898 Bacteria 1789
117 Ga0207680_10199674 3300025903 Bacteria 1362
118 Ga0207699_10100851 3300025906 Bacteria 1832
119 Ga0207699_10270685 3300025906 Bacteria 1177
120 Ga0207707_10014329 3300025912 Bacteria 6904
121 Ga0207693_10020192 3300025915 Bacteria 5299
122 Ga0207693_10086010 3300025915 Bacteria 2463
123 Ga0207663_10080297 3300025916 Bacteria 2132
124 Ga0207660_10071017 3300025917 Bacteria 2532
125 Ga0207660_10080065 3300025917 Bacteria 2398
126 Ga0207662_10124662 3300025918 Bacteria 1619
127 Ga0207657_10171938 3300025919 Bacteria 1755
128 Ga0207652_10013861 3300025921 Bacteria 6523
129 Ga0207650_10023333 3300025925 Bacteria 4385
130 Ga0207659_10116875 3300025926 Bacteria 2037
131 Ga0207659_10236994 3300025926 Bacteria 1474
132 Ga0207644_10208731 3300025931 Unclassified 1543
133 Ga0207690_10062796 3300025932 Bacteria 2531
134 Ga0207706_10027907 3300025933 Bacteria 5046
135 Ga0207670_10001422 3300025936 Bacteria 12580
136 Ga0207670_10146416 3300025936 Bacteria 1747
137 Ga0207665_10114482 3300025939 Bacteria 1899
138 Ga0207665_10149624 3300025939 Unclassified 1671
139 Ga0207691_10068369 3300025940 Bacteria 3209
140 Ga0207691_10077455 3300025940 Bacteria 2996
141 Ga0207679_10034102 3300025945 Unclassified 3589
142 Ga0207667_10109836 3300025949 Bacteria 2845
143 Ga0207667_10353058 3300025949 Bacteria 1499
144 Ga0207712_10044188 3300025961 Bacteria 3078
145 Ga0207668_10098661 3300025972 Bacteria 2165
146 Ga0207640_10328635 3300025981 Bacteria 1220
147 Ga0207658_10013820 3300025986 Bacteria 5524
148 Ga0207658_10251863 3300025986 Unclassified 1501
149 Ga0207639_10203521 3300026041 Bacteria 1700
150 Ga0207678_10179414 3300026067 Bacteria 1808
151 Ga0207708_10156619 3300026075 Bacteria 1796
152 Ga0207676_10009798 3300026095 Bacteria 6814
153 Ga0207675_100147088 3300026118 Bacteria 2241
154 Ga0207675_100201157 3300026118 Bacteria 1913
155 Ga0207683_10010338 3300026121 Bacteria 7959
156 Ga0209998_10004313 3300027717 Bacteria 3028
157 Ga0207428_10053565 3300027907 Bacteria 3217
158 Ga0207428_10107799 3300027907 Bacteria 2146
159 Ga0268266_10244178 3300028379 Unclassified 1658
160 Ga0268265_10179121 3300028380 Bacteria 1820
161 Ga0268264_10223370 3300028381 Bacteria 1735
162 Ga0268264_10587506 3300028381 Bacteria 1096
163 Ga0265325_10014547 3300031241 Bacteria 4442
164 Ga0373930_0000608 3300034816 Bacteria 4959
165 Ga0373948_0000406 3300034817 Bacteria 5314
166 Ga0373950_0004399 3300034818 Bacteria 2064
167 Ga0373959_0004006 3300034820 Bacteria 2359
168 Ga0373938_0001145 3300034957 Bacteria 4268
169 Ga0373929_0000714 3300035085 Bacteria 6434
170 Ga0373944_0010626 3300035089 Bacteria 2511
171 Ga0373951_0002070 3300035091 Bacteria 5141
172 Ga0373952_0003786 3300035092 Bacteria 2736
173 Ga0373923_0002351 3300035111 Bacteria 5801
174 Ga0373932_0025053 3300035112 Bacteria 1611
175 Ga0373936_0032222 3300035113 Bacteria 2072
176 Ga0373936_0121290 3300035113 Bacteria 1117
177 Ga0373941_0001052 3300035115 Bacteria 5727
178 Ga0373945_0006443 3300035116 Bacteria 3786
179 Ga0373953_0103899 3300035117 Bacteria 1197
180 Ga0373956_0091885 3300035119 Bacteria 1401
181 Ga0373943_0000264 3300035170 Bacteria 21556
182 Ga0373943_0007873 3300035170 Bacteria 4783
183 Ga0373943_0028407 3300035170 Bacteria 2635
184 Ga0373946_0004994 3300035171 Bacteria 4776
185 Ga0373946_0011506 3300035171 Bacteria 3303
186 Ga0373955_0201346 3300035172 Bacteria 1185
187 Ga0373942_0001258 3300035207 Bacteria 6639
188 Ga0373961_0000927 3300035241 Bacteria 9772
189 Ga0373962_0000369 3300035242 Bacteria 9881
190 Ga0373924_0024492 3300035410 Bacteria 2378
191 Ga0373931_0009271 3300035691 Bacteria 4701
192 Ga0373931_0113387 3300035691 Unclassified 1541
193 Ga0373935_0018179 3300035692 Bacteria 4273
194 Ga0373935_0028029 3300035692 Unclassified 3481
195 Ga0373927_0028025 3300035695 Bacteria 3675
196 Ga0373927_0113284 3300035695 Bacteria 1768
197 Ga0373927_0126476 3300035695 Bacteria 1668
198 Ga0373933_0005789 3300035724 Bacteria 6722
199 Ga0373947_0012014 3300035725 Bacteria 4959
200 Ga0373947_0020999 3300035725 Bacteria 3777
201 Ga0373947_0073971 3300035725 Unclassified 2095
202 Ga0373947_0088937 3300035725 Bacteria 1923
203 Ga0373947_0178059 3300035725 Bacteria 1383
204 Ga0373947_0324233 3300035725 Bacteria 1030
205 Ga0373937_0010664 3300036401 Bacteria 8035
206 Ga0373937_0070150 3300036401 Bacteria 3232
207 Ga0373937_0100368 3300036401 Bacteria 2686
208 Ga0373937_0126943 3300036401 Bacteria 2380
209 Ga0373937_0129297 3300036401 Bacteria 2358
210 Ga0373925_0053109 3300037068 Bacteria 3028
211 Ga0373925_0164903 3300037068 Bacteria 1747
212 Ga0373925_0216388 3300037068 Unclassified 1528
213 Ga0373925_0236070 3300037068 Unclassified 1463
214 Ga0373925_0266882 3300037068 Bacteria 1376
215 Ga0373925_0268096 3300037068 Bacteria 1373
216 Ga0395901_0099632 3300038443 Bacteria 3047
217 Ga0436363_1559627 3300039450 Bacteria 3237
218 Ga0451577_0048589 3300042876 Bacteria 3790
219 Ga0451576_0247916 3300045051 Bacteria 1861
220 Ga0495592_0023335 3300046454 Bacteria 4705
221 Ga0495592_0157034 3300046454 Bacteria 1568
222 Ga0495603_0036379 3300046455 Bacteria 2956
223 Ga0495603_0044023 3300046455 Unclassified 2664
224 Ga0495603_0052784 3300046455 Bacteria 2413
225 Ga0495629_0002055 3300046459 Bacteria 15654
226 Ga0495629_0008551 3300046459 Bacteria 7536
227 Ga0495629_0045682 3300046459 Bacteria 3073
228 Ga0495629_0085103 3300046459 Bacteria 2206
229 Ga0495629_0136235 3300046459 Bacteria 1709
230 Ga0495651_0127942 3300046462 Bacteria 1858
231 Ga0495651_0165838 3300046462 Bacteria 1578
232 Ga0495651_0229647 3300046462 Bacteria 1279
233 Ga0495653_0004185 3300046463 Bacteria 11679
234 Ga0495653_0138660 3300046463 Bacteria 1713
235 Ga0495580_0050422 3300046472 Bacteria 2943
236 Ga0495582_0011382 3300046473 Unclassified 4902
237 Ga0495582_0014962 3300046473 Bacteria 4266
238 Ga0495582_0138889 3300046473 Unclassified 1376
239 Ga0495639_0005751 3300046475 Bacteria 5335
240 Ga0495639_0033749 3300046475 Bacteria 2286
241 Ga0495639_0057286 3300046475 Bacteria 1780
242 Ga0495662_0003135 3300046476 Bacteria 8337
243 Ga0495662_0026923 3300046476 Bacteria 2777
244 Ga0495664_0001919 3300046477 Bacteria 11064
245 Ga0495664_0007970 3300046477 Bacteria 5898
246 Ga0495664_0013278 3300046477 Bacteria 4671
247 Ga0495618_0005843 3300046514 Bacteria 7480
248 Ga0495618_0036297 3300046514 Bacteria 3093
249 Ga0495618_0045585 3300046514 Bacteria 2766
250 Ga0495618_0076676 3300046514 Bacteria 2130
251 Ga0495630_0025542 3300046517 Bacteria 4370
252 Ga0495630_0121724 3300046517 Bacteria 1979
253 Ga0495631_0039804 3300046518 Bacteria 2084
254 Ga0495652_0215500 3300046529 Bacteria 1446
255 Ga0495665_0034274 3300046531 Bacteria 2714
256 Ga0495665_0085738 3300046531 Bacteria 1655
257 Ga0495665_0100214 3300046531 Bacteria 1520
258 Ga0495640_0001275 3300046533 Bacteria 19760
259 Ga0495640_0291863 3300046533 Bacteria 1014
260 Ga0495586_0036172 3300046535 Bacteria 2650
261 Ga0495587_0051886 3300046536 Bacteria 2422
262 Ga0495645_0024726 3300046543 Bacteria 4358
263 Ga0495667_0067319 3300046559 Bacteria 2340
264 Ga0495667_0150215 3300046559 Bacteria 1500
265 Ga0495667_0293666 3300046559 Bacteria 1030
266 Ga0495634_0007556 3300046642 Bacteria 8151
267 Ga0495634_0012999 3300046642 Bacteria 6023
268 Ga0495634_0054215 3300046642 Bacteria 2684
269 Ga0495635_0001332 3300046663 Bacteria 16434
270 Ga0495599_0012841 3300046678 Bacteria 5169
271 Ga0495599_0129940 3300046678 Bacteria 1564
272 Ga0495646_0091103 3300046680 Bacteria 1760
273 Ga0495647_0017496 3300046681 Bacteria 2537
274 Ga0495658_0051960 3300046683 Bacteria 2322
275 Ga0495658_0081087 3300046683 Bacteria 1904
276 Ga0495613_0070575 3300046689 Bacteria 2547
277 Ga0495613_0146624 3300046689 Unclassified 1684
278 Ga0495613_0187291 3300046689 Bacteria 1464
279 Ga0495624_0186241 3300046690 Bacteria 1263
280 Ga0495600_0003788 3300046809 Bacteria 8953
281 Ga0495581_0040706 3300047315 Bacteria 2688
282 Ga0495581_0195152 3300047315 Bacteria 1184
283 Ga0495604_0070832 3300047317 Bacteria 2639
284 Ga0495674_0000957 3300047319 Bacteria 27612
285 Ga0495674_0048368 3300047319 Bacteria 3763
286 Ga0495674_0068222 3300047319 Bacteria 3078
287 Ga0495674_0071911 3300047319 Bacteria 2984
288 Ga0495674_0355683 3300047319 Bacteria 1188
289 Ga0495676_0068504 3300047321 Bacteria 2742
290 Ga0495676_0070165 3300047321 Bacteria 2700
291 Ga0495676_0305401 3300047321 Bacteria 1072
292 Ga0495676_0320652 3300047321 Bacteria 1041
293 Ga0495680_0034789 3300047322 Bacteria 4064
294 Ga0495680_0046071 3300047322 Bacteria 3440
295 Ga0495675_0065265 3300047444 Bacteria 2302
296 Ga0495684_0020514 3300047471 Bacteria 5094
297 Ga0495684_0096019 3300047471 Unclassified 2243
298 Ga0495684_0152581 3300047471 Bacteria 1726
299 Ga0495593_0008509 3300047673 Bacteria 5966
300 Ga0495593_0091496 3300047673 Bacteria 1566
301 Ga0495593_0116006 3300047673 Bacteria 1365
302 Ga0495602_0133100 3300048088 Bacteria 1979
303 Ga0496100_0120570 3300048903 Bacteria 1834
304 Ga0496102_0070023 3300048905 Unclassified 3220
305 Ga0496104_0003903 3300048907 Bacteria 12908
306 Ga0496104_0019503 3300048907 Bacteria 6206
307 Ga0496104_0040843 3300048907 Bacteria 4349
308 Ga0496104_0077115 3300048907 Bacteria 3175
309 Ga0496104_0110116 3300048907 Bacteria 2640
310 Ga0496104_0550230 3300048907 Bacteria 1065
311 Ga0496105_0126823 3300048908 Bacteria 2104
312 Ga0496105_0193180 3300048908 Bacteria 1664
313 Ga0496106_0054203 3300048909 Bacteria 3029
314 Ga0496106_0063533 3300048909 Bacteria 2806
315 Ga0496106_0240524 3300048909 Unclassified 1446
316 Ga0496107_0137612 3300048910 Unclassified 1804
317 Ga0496107_0201500 3300048910 Bacteria 1479
318 Ga0496108_0035229 3300048911 Bacteria 4160
319 Ga0496108_0038728 3300048911 Bacteria 3972
320 Ga0496108_0206844 3300048911 Bacteria 1703
321 Ga0496108_0334829 3300048911 Unclassified 1320
322 Ga0496109_0002458 3300048912 Bacteria 15526
323 Ga0496109_0037044 3300048912 Bacteria 4406
324 Ga0496109_0072033 3300048912 Unclassified 3173
325 Ga0496109_0110446 3300048912 Bacteria 2556
326 Ga0496109_0217537 3300048912 Bacteria 1796
327 Ga0496109_0306452 3300048912 Bacteria 1498
328 Ga0496109_0569941 3300048912 Bacteria 1067
329 Ga0496110_0077656 3300048913 Bacteria 2954
330 Ga0496110_0199230 3300048913 Bacteria 1819
331 Ga0496110_0291181 3300048913 Bacteria 1487
332 Ga0496111_0043556 3300048914 Bacteria 3226
333 Ga0496111_0099504 3300048914 Unclassified 2136
334 Ga0496111_0226784 3300048914 Bacteria 1388
335 Ga0496112_0000554 3300048915 Bacteria 25663
336 Ga0496112_0032767 3300048915 Bacteria 5045
337 Ga0496112_0080006 3300048915 Bacteria 3232
338 Ga0496112_0104605 3300048915 Bacteria 2801
339 Ga0496113_0057661 3300048916 Bacteria 2919
340 Ga0496113_0120140 3300048916 Bacteria 2053
341 Ga0496114_0138145 3300048917 Unclassified 2108
342 Ga0496115_0001086 3300048918 Bacteria 19681
343 Ga0496115_0006597 3300048918 Bacteria 8506
344 Ga0496115_0413746 3300048918 Bacteria 1093
345 nmdc:mga0k408_116888_c1 3300050493 Bacteria 1578
346 nmdc:mga05p37_364753_c1 3300050507 Bacteria 1697
347 nmdc:mga05p37_496457_c1 3300050507 Unclassified 1402
348 nmdc:mga09592_57739_c1 3300050508 Bacteria 3281
349 nmdc:mga0qj67_124623_c1 3300050509 Bacteria 2085
350 nmdc:mga0qj67_66331_c1 3300050509 Bacteria 2875
351 nmdc:mga06r32_68765_c1 3300050510 Bacteria 3422
352 nmdc:mga06r32_71532_c1 3300050510 Bacteria 3357
353 nmdc:mga08y16_550_c1 3300050511 Bacteria 34754
354 nmdc:mga08y16_89031_c1 3300050511 Bacteria 3217
355 nmdc:mga0n895_53380_c1 3300050512 Plasmid 3971
356 nmdc:mga0n895_99970_c1 3300050512 Bacteria 2909
357 nmdc:mga0a205_48554_c1 3300050515 Bacteria 4096
358 Ga0495601_0004345 3300053077 Bacteria 8188
359 Ga0495601_0004567 3300053077 Bacteria 8007
360 Ga0495601_0010364 3300053077 Bacteria 5544
361 Ga0495601_0122926 3300053077 Bacteria 1687
362 Ga0495612_0000781 3300053078 Bacteria 12931
363 Ga0495612_0017130 3300053078 Bacteria 2902
364 Ga0495612_0104852 3300053078 Bacteria 1206
365 Ga0495655_0008772 3300053083 Bacteria 1935
366 Ga0495655_0046208 3300053083 Bacteria 1134
367 Ga0495595_0001657 3300053084 Bacteria 8708
368 Ga0495595_0021663 3300053084 Bacteria 2810
369 Ga0495619_0000048 3300053085 Bacteria 102117
370 Ga0495619_0000447 3300053085 Bacteria 27798
371 Ga0495619_0004666 3300053085 Bacteria 8729
372 Ga0495619_0006642 3300053085 Bacteria 7322
373 Ga0495619_0022541 3300053085 Bacteria 4031
374 Ga0495619_0029656 3300053085 Bacteria 3536
375 Ga0495619_0047367 3300053085 Bacteria 2830
376 Ga0495619_0062074 3300053085 Bacteria 2487
377 Ga0495619_0296695 3300053085 Bacteria 1120
378 Ga0373947_0031021
379 2214884077
380 ARcpr5oldR_c000514
381 ARSoilOldRDRAFT_c000042
382 JGI24737J22298_10026811
383 JGI25405J52794_10005315
384 JGI25405J52794_10006873
385 Ga0065704_10106349
386 Ga0065712_10103155
387 Ga0065715_10005534
388 Ga0070690_100006516
389 Ga0070690_100008074
390 Ga0070680_100086958
391 Ga0070689_100001597
392 Ga0070689_100125191
393 Ga0070689_100155779
394 Ga0070691_10137256
395 Ga0070692_10019042
396 Ga0070668_100128129
397 Ga0070668_100135065
398 Ga0070669_100020474
399 Ga0070671_100050258
400 Ga0070671_100246483
401 Ga0070688_100131801
402 Ga0070659_100019929
403 Ga0070667_100034902
404 Ga0070667_100103219
405 Ga0070703_10067154
406 Ga0070709_10088159
407 Ga0070709_10125072
408 Ga0070705_100181004
409 Ga0070678_100023403
410 Ga0070662_100221171
411 Ga0070681_10053887
412 Ga0070681_10137857
413 Ga0070685_10017394
414 Ga0070699_100005058
415 Ga0070699_100513651
416 Ga0070679_100031347
417 Ga0070679_100132492
418 Ga0070684_100112113
419 Ga0070672_100040878
420 Ga0070672_100309724
421 Ga0070695_100087309
422 Ga0070696_100065848
423 Ga0070693_100074892
424 Ga0070704_100092776
425 Ga0070704_100218313
426 Ga0068855_100248317
427 Ga0070664_100045408
428 Ga0070664_100488739
429 Ga0068859_100064191
430 Ga0068864_100013954
431 Ga0068861_100170641
432 Ga0068870_10071085
433 Ga0068863_100287984
434 Ga0068860_100232211
435 Ga0068862_100029947
436 Ga0081455_10001454
437 Ga0081455_10003945
438 Ga0081455_10013667
439 Ga0081455_10051658
440 Ga0081455_10057731
441 Ga0081455_10093115
442 Ga0081455_10144899
443 Ga0081538_10035259
444 Ga0070712_100022067
445 Ga0075428_100095684
446 Ga0075428_100329426
447 Ga0075430_100029679
448 Ga0075430_100050044
449 Ga0075430_100080619
450 Ga0075431_100086737
451 Ga0075433_10267593
452 Ga0075434_100088994
453 Ga0075429_100063803
454 Ga0097620_100064188
455 Ga0111539_10014164
456 Ga0111539_10098341
457 Ga0111539_10103305
458 Ga0105245_10172307
459 Ga0105247_10024552
460 Ga0114129_10154662
461 Ga0114129_10169450
462 Ga0114129_10618946
463 Ga0114129_10637158
464 Ga0114129_10719346
465 Ga0105241_10110505
466 Ga0105248_10373163
467 Ga0105249_10003992
468 Ga0105239_10116710
469 Ga0105239_10244154
470 Ga0105239_10319982
471 Ga0105246_10205123
472 Ga0163162_10104904
473 Ga0163162_10311272
474 Ga0157372_10544052
475 Ga0157375_10100639
476 Ga0157375_10648704
477 Ga0163163_10099138
478 Ga0157380_10040940
479 Ga0182008_10064689
480 Ga0157377_10218528
481 Ga0157379_10042403
482 Ga0157379_10051106
483 Ga0157379_10269400
484 Ga0157376_10101896
485 Ga0157376_10238770
486 Ga0157376_10507653
487 Ga0163161_10363876
488 Ga0213874_10030814
489 Ga0207666_1003448
490 Ga0207653_10070366
491 Ga0207692_10024305
492 Ga0207692_10028047
493 Ga0207692_10075409
494 Ga0207680_10199674
495 Ga0207699_10100851
496 Ga0207699_10270685
497 Ga0207707_10014329
498 Ga0207693_10020192
499 Ga0207693_10086010
500 Ga0207663_10080297
501 Ga0207660_10071017
502 Ga0207660_10080065
503 Ga0207662_10124662
504 Ga0207657_10171938
505 Ga0207652_10013861
506 Ga0207650_10023333
507 Ga0207659_10116875
508 Ga0207659_10236994
509 Ga0207644_10208731
510 Ga0207690_10062796
511 Ga0207706_10027907
512 Ga0207670_10001422
513 Ga0207670_10146416
514 Ga0207665_10114482
515 Ga0207665_10149624
516 Ga0207691_10068369
517 Ga0207691_10077455
518 Ga0207679_10034102
519 Ga0207667_10109836
520 Ga0207667_10353058
521 Ga0207712_10044188
522 Ga0207668_10098661
523 Ga0207640_10328635
524 Ga0207658_10013820
525 Ga0207658_10251863
526 Ga0207639_10203521
527 Ga0207678_10179414
528 Ga0207708_10156619
529 Ga0207676_10009798
530 Ga0207675_100147088
531 Ga0207675_100201157
532 Ga0207683_10010338
533 Ga0209998_10004313
534 Ga0207428_10053565
535 Ga0207428_10107799
536 Ga0268266_10244178
537 Ga0268265_10179121
538 Ga0268264_10223370
539 Ga0268264_10587506
540 Ga0265325_10014547
541 Ga0373930_0000608
542 Ga0373948_0000406
543 Ga0373950_0004399
544 Ga0373959_0004006
545 Ga0373938_0001145
546 Ga0373929_0000714
547 Ga0373944_0010626
548 Ga0373951_0002070
549 Ga0373952_0003786
550 Ga0373923_0002351
551 Ga0373932_0025053
552 Ga0373936_0032222
553 Ga0373936_0121290
554 Ga0373941_0001052
555 Ga0373945_0006443
556 Ga0373953_0103899
557 Ga0373956_0091885
558 Ga0373943_0000264
559 Ga0373943_0007873
560 Ga0373943_0028407
561 Ga0373946_0004994
562 Ga0373946_0011506
563 Ga0373955_0201346
564 Ga0373942_0001258
565 Ga0373961_0000927
566 Ga0373962_0000369
567 Ga0373924_0024492
568 Ga0373931_0009271
569 Ga0373931_0113387
570 Ga0373935_0018179
571 Ga0373935_0028029
572 Ga0373927_0028025
573 Ga0373927_0113284
574 Ga0373927_0126476
575 Ga0373933_0005789
576 Ga0373947_0012014
577 Ga0373947_0020999
578 Ga0373947_0073971
579 Ga0373947_0088937
580 Ga0373947_0178059
581 Ga0373947_0324233
582 Ga0373937_0010664
583 Ga0373937_0070150
584 Ga0373937_0100368
585 Ga0373937_0126943
586 Ga0373937_0129297
587 Ga0373925_0053109
588 Ga0373925_0164903
589 Ga0373925_0216388
590 Ga0373925_0236070
591 Ga0373925_0266882
592 Ga0373925_0268096
593 Ga0395901_0099632
594 Ga0436363_1559627
595 Ga0451577_0048589
596 Ga0451576_0247916
597 Ga0495592_0023335
598 Ga0495592_0157034
599 Ga0495603_0036379
600 Ga0495603_0044023
601 Ga0495603_0052784
602 Ga0495629_0002055
603 Ga0495629_0008551
604 Ga0495629_0045682
605 Ga0495629_0085103
606 Ga0495629_0136235
607 Ga0495651_0127942
608 Ga0495651_0165838
609 Ga0495651_0229647
610 Ga0495653_0004185
611 Ga0495653_0138660
612 Ga0495580_0050422
613 Ga0495582_0011382
614 Ga0495582_0014962
615 Ga0495582_0138889
616 Ga0495639_0005751
617 Ga0495639_0033749
618 Ga0495639_0057286
619 Ga0495662_0003135
620 Ga0495662_0026923
621 Ga0495664_0001919
622 Ga0495664_0007970
623 Ga0495664_0013278
624 Ga0495618_0005843
625 Ga0495618_0036297
626 Ga0495618_0045585
627 Ga0495618_0076676
628 Ga0495630_0025542
629 Ga0495630_0121724
630 Ga0495631_0039804
631 Ga0495652_0215500
632 Ga0495665_0034274
633 Ga0495665_0085738
634 Ga0495665_0100214
635 Ga0495640_0001275
636 Ga0495640_0291863
637 Ga0495586_0036172
638 Ga0495587_0051886
639 Ga0495645_0024726
640 Ga0495667_0067319
641 Ga0495667_0150215
642 Ga0495667_0293666
643 Ga0495634_0007556
644 Ga0495634_0012999
645 Ga0495634_0054215
646 Ga0495635_0001332
647 Ga0495599_0012841
648 Ga0495599_0129940
649 Ga0495646_0091103
650 Ga0495647_0017496
651 Ga0495658_0051960
652 Ga0495658_0081087
653 Ga0495613_0070575
654 Ga0495613_0146624
655 Ga0495613_0187291
656 Ga0495624_0186241
657 Ga0495600_0003788
658 Ga0495581_0040706
659 Ga0495581_0195152
660 Ga0495604_0070832
661 Ga0495674_0000957
662 Ga0495674_0048368
663 Ga0495674_0068222
664 Ga0495674_0071911
665 Ga0495674_0355683
666 Ga0495676_0068504
667 Ga0495676_0070165
668 Ga0495676_0305401
669 Ga0495676_0320652
670 Ga0495680_0034789
671 Ga0495680_0046071
672 Ga0495675_0065265
673 Ga0495684_0020514
674 Ga0495684_0096019
675 Ga0495684_0152581
676 Ga0495593_0008509
677 Ga0495593_0091496
678 Ga0495593_0116006
679 Ga0495602_0133100
680 Ga0496100_0120570
681 Ga0496102_0070023
682 Ga0496104_0003903
683 Ga0496104_0019503
684 Ga0496104_0040843
685 Ga0496104_0077115
686 Ga0496104_0110116
687 Ga0496104_0550230
688 Ga0496105_0126823
689 Ga0496105_0193180
690 Ga0496106_0054203
691 Ga0496106_0063533
692 Ga0496106_0240524
693 Ga0496107_0137612
694 Ga0496107_0201500
695 Ga0496108_0035229
696 Ga0496108_0038728
697 Ga0496108_0206844
698 Ga0496108_0334829
699 Ga0496109_0002458
700 Ga0496109_0037044
701 Ga0496109_0072033
702 Ga0496109_0110446
703 Ga0496109_0217537
704 Ga0496109_0306452
705 Ga0496109_0569941
706 Ga0496110_0077656
707 Ga0496110_0199230
708 Ga0496110_0291181
709 Ga0496111_0043556
710 Ga0496111_0099504
711 Ga0496111_0226784
712 Ga0496112_0000554
713 Ga0496112_0032767
714 Ga0496112_0080006
715 Ga0496112_0104605
716 Ga0496113_0057661
717 Ga0496113_0120140
718 Ga0496114_0138145
719 Ga0496115_0001086
720 Ga0496115_0006597
721 Ga0496115_0413746
722 nmdc:mga0k408_116888_c1
723 nmdc:mga05p37_364753_c1
724 nmdc:mga05p37_496457_c1
725 nmdc:mga09592_57739_c1
726 nmdc:mga0qj67_124623_c1
727 nmdc:mga0qj67_66331_c1
728 nmdc:mga06r32_68765_c1
729 nmdc:mga06r32_71532_c1
730 nmdc:mga08y16_550_c1
731 nmdc:mga08y16_89031_c1
732 nmdc:mga0n895_53380_c1
733 nmdc:mga0n895_99970_c1
734 nmdc:mga0a205_48554_c1
735 Ga0495601_0004345
736 Ga0495601_0004567
737 Ga0495601_0010364
738 Ga0495601_0122926
739 Ga0495612_0000781
740 Ga0495612_0017130
741 Ga0495612_0104852
742 Ga0495655_0008772
743 Ga0495655_0046208
744 Ga0495595_0001657
745 Ga0495595_0021663
746 Ga0495619_0000048
747 Ga0495619_0000447
748 Ga0495619_0004666
749 Ga0495619_0006642
750 Ga0495619_0022541
751 Ga0495619_0029656
752 Ga0495619_0047367
753 Ga0495619_0062074
754 Ga0495619_0296695

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

38

301

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9273 27 327
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9244 27 327
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9232 27 326
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9173 27 326
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9164 31 327
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8912 150 327 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8853 29 143 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8742 150 326 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8739 150 327 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8519 150 326 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9844 222 328
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.9829 221 328
AF-A0A4V1KUC4-F1-model_v4 ABC transporter substrate-binding protein 0.9794 221 328
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9755 222 328
AF-A0A537SF60-F1-model_v4 ABC transporter substrate-binding protein 0.9753 28 328

Map