F427735

General Info

Members Datasets Scaffolds Average Seq Length
377 179 376 301

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10011270|Ga0265328_100112704
Length 353
Sequence LYALWRIILFRQSSTEPAGRIQAGRGGLKDEAALFVCVLRVRAWVRLNWCLPKSMRERLEYWLVVSVARVLGWMPRGVARLWAGLLAFTVYWVFGRLRRVGERNLEMALPHVAAPERNRILRGVYTHLGWQLVEFCRMTRYTPENSQNWMRTEGLEHYVAAQARGKGVLVITGHLGAWELSSFYHSMMGYPMGMVIRRLDNRRLDAFVNGIRCLHGNYVLHKDDFGRGLLTAMRSGGTVGILMDTNMTPPQGEFVKFFGIPACTATGLAHVARKTGAAVLPGFMLWEPVKKRYVLHFGPEVAIPHTDDVASDILAGTQLCTSAIESWIRLYPDQWLWIHRRWKTRPAGEPPLY

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
179 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 2.12
Rhizosphere 95.23
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10140905 3300003316 Bacteria 1953
2 rootH2_10189815 3300003320 Unclassified 2525
3 rootH2_10250321 3300003320 Bacteria 2918
4 Ga0070658_10022589 3300005327 Bacteria 5048
5 Ga0070683_100000221 3300005329 Bacteria 39014
6 Ga0070670_100001323 3300005331 Bacteria 19785
7 Ga0068869_100001729 3300005334 Bacteria 13041
8 Ga0070666_10046897 3300005335 Bacteria 2900
9 Ga0070666_10062935 3300005335 Bacteria 2514
10 Ga0070682_100222923 3300005337 Bacteria 1343
11 Ga0068868_100000178 3300005338 Bacteria 42328
12 Ga0068868_100073796 3300005338 Bacteria 2724
13 Ga0070661_100008147 3300005344 Bacteria 7229
14 Ga0070661_100042489 3300005344 Bacteria 3318
15 Ga0070671_100002637 3300005355 Bacteria 13890
16 Ga0070667_100001001 3300005367 Bacteria 25878
17 Ga0070714_100348702 3300005435 Bacteria 1390
18 Ga0070663_100006860 3300005455 Bacteria 6891
19 Ga0070663_100033255 3300005455 Bacteria 3561
20 Ga0070681_10000635 3300005458 Bacteria 28906
21 Ga0070681_10094818 3300005458 Bacteria 2933
22 Ga0070681_10114284 3300005458 Bacteria 2638
23 Ga0070681_10136925 3300005458 Bacteria 2379
24 Ga0070679_100001201 3300005530 Bacteria 22781
25 Ga0070679_100006456 3300005530 Bacteria 10925
26 Ga0070679_100211599 3300005530 Bacteria 1903
27 Ga0070684_100000385 3300005535 Bacteria 30647
28 Ga0070684_100001915 3300005535 Bacteria 15258
29 Ga0070684_100007475 3300005535 Bacteria 8497
30 Ga0068853_100000186 3300005539 Bacteria 43771
31 Ga0068853_100000263 3300005539 Bacteria 37029
32 Ga0068853_100008124 3300005539 Bacteria 8421
33 Ga0068853_100015591 3300005539 Bacteria 6243
34 Ga0068853_100092426 3300005539 Bacteria 2662
35 Ga0068853_100133101 3300005539 Bacteria 2227
36 Ga0070665_100012807 3300005548 Bacteria 8447
37 Ga0070665_100146494 3300005548 Bacteria 2364
38 Ga0068855_100001114 3300005563 Bacteria 33409
39 Ga0068855_100009541 3300005563 Bacteria 11721
40 Ga0068855_100030015 3300005563 Bacteria 6503
41 Ga0068855_100047199 3300005563 Bacteria 5089
42 Ga0068855_100048636 3300005563 Bacteria 5004
43 Ga0068855_100403772 3300005563 Bacteria 1497
44 Ga0068855_100426183 3300005563 Bacteria 1450
45 Ga0068857_100000554 3300005577 Bacteria 27268
46 Ga0068857_100002318 3300005577 Bacteria 15469
47 Ga0068857_100044705 3300005577 Bacteria 3929
48 Ga0068857_100299179 3300005577 Bacteria 1483
49 Ga0068854_100001242 3300005578 Bacteria 15301
50 Ga0068854_100019721 3300005578 Unclassified 4550
51 Ga0068854_100438559 3300005578 Unclassified 1088
52 Ga0068856_100001581 3300005614 Bacteria 23844
53 Ga0068856_100001940 3300005614 Bacteria 21548
54 Ga0068856_100047666 3300005614 Bacteria 4222
55 Ga0068856_100474027 3300005614 Bacteria 1272
56 Ga0068852_100000064 3300005616 Bacteria 72630
57 Ga0068852_100038954 3300005616 Unclassified 3998
58 Ga0068852_100047091 3300005616 Bacteria 3676
59 Ga0068852_100495306 3300005616 Unclassified 1216
60 Ga0068859_100007155 3300005617 Bacteria 11327
61 Ga0068864_100001182 3300005618 Bacteria 21726
62 Ga0068864_100094001 3300005618 Bacteria 2649
63 Ga0068851_10010726 3300005834 Bacteria 4282
64 Ga0068851_10026975 3300005834 Unclassified 2827
65 Ga0068851_10129307 3300005834 Bacteria 1364
66 Ga0068863_100001253 3300005841 Bacteria 25297
67 Ga0068863_100244543 3300005841 Bacteria 1732
68 Ga0068858_100043427 3300005842 Bacteria 4168
69 Ga0068860_100003654 3300005843 Bacteria 15831
70 Ga0068860_100237557 3300005843 Bacteria 1772
71 Ga0068862_100093219 3300005844 Bacteria 2626
72 Ga0097621_100000723 3300006237 Bacteria 23132
73 Ga0097621_100114965 3300006237 Bacteria 2277
74 Ga0068871_100000397 3300006358 Bacteria 30356
75 Ga0097620_100007156 3300006931 Bacteria 11327
76 Ga0105240_10000213 3300009093 Bacteria 117084
77 Ga0105240_10000660 3300009093 Bacteria 63654
78 Ga0105240_10000775 3300009093 Bacteria 57940
79 Ga0105240_10005079 3300009093 Bacteria 19725
80 Ga0105240_10014624 3300009093 Bacteria 10707
81 Ga0105240_10036266 3300009093 Bacteria 6345
82 Ga0105240_10101130 3300009093 Unclassified 3507
83 Ga0105240_10131774 3300009093 Bacteria 2998
84 Ga0105240_10232208 3300009093 Unclassified 2143
85 Ga0105245_10000274 3300009098 Bacteria 48955
86 Ga0105247_10003818 3300009101 Bacteria 9749
87 Ga0105241_10000081 3300009174 Bacteria 70908
88 Ga0105241_10000150 3300009174 Bacteria 49793
89 Ga0105241_10200432 3300009174 Bacteria 1667
90 Ga0105248_10003476 3300009177 Bacteria 17493
91 Ga0105248_10411142 3300009177 Bacteria 1523
92 Ga0105237_10002859 3300009545 Bacteria 20999
93 Ga0105237_10022902 3300009545 Bacteria 6406
94 Ga0105237_10064438 3300009545 Bacteria 3661
95 Ga0105238_10000167 3300009551 Bacteria 71039
96 Ga0105238_10001216 3300009551 Bacteria 25926
97 Ga0105238_10002625 3300009551 Bacteria 17930
98 Ga0105238_10021222 3300009551 Bacteria 6618
99 Ga0105238_10065484 3300009551 Bacteria 3635
100 Ga0105238_10214740 3300009551 Bacteria 1900
101 Ga0105238_10327912 3300009551 Bacteria 1517
102 Ga0105249_10058908 3300009553 Bacteria 3521
103 Ga0105249_10338540 3300009553 Bacteria 1520
104 Ga0105239_10000751 3300010375 Bacteria 45948
105 Ga0105239_10010916 3300010375 Bacteria 10149
106 Ga0105239_10017840 3300010375 Bacteria 7849
107 Ga0105246_10002579 3300011119 Bacteria 10961
108 Ga0157373_10248428 3300013100 Bacteria 1258
109 Ga0157370_10000058 3300013104 Bacteria 117088
110 Ga0157370_10025336 3300013104 Bacteria 5872
111 Ga0157370_10047739 3300013104 Bacteria 4103
112 Ga0157370_10076111 3300013104 Bacteria 3162
113 Ga0157370_10103126 3300013104 Bacteria 2670
114 Ga0157369_10000387 3300013105 Bacteria 58507
115 Ga0157369_10001301 3300013105 Bacteria 31027
116 Ga0157369_10004428 3300013105 Bacteria 16575
117 Ga0157369_10006532 3300013105 Bacteria 13504
118 Ga0157369_10011536 3300013105 Bacteria 10037
119 Ga0157369_10029859 3300013105 Bacteria 6020
120 Ga0157369_10144793 3300013105 Bacteria 2513
121 Ga0157369_10204145 3300013105 Bacteria 2073
122 Ga0157369_10228757 3300013105 Unclassified 1944
123 Ga0157374_10000826 3300013296 Bacteria 27101
124 Ga0157374_10023383 3300013296 Bacteria 5528
125 Ga0157374_10068798 3300013296 Bacteria 3332
126 Ga0157374_10111183 3300013296 Unclassified 2635
127 Ga0157374_10318493 3300013296 Unclassified 1541
128 Ga0157378_10001611 3300013297 Bacteria 20406
129 Ga0157378_10077006 3300013297 Unclassified 3006
130 Ga0157372_10000257 3300013307 Bacteria 58743
131 Ga0157372_10000849 3300013307 Bacteria 33184
132 Ga0157372_10004002 3300013307 Bacteria 15810
133 Ga0157372_10012374 3300013307 Bacteria 9094
134 Ga0157372_10016142 3300013307 Bacteria 8012
135 Ga0157372_10036393 3300013307 Bacteria 5425
136 Ga0157375_10002851 3300013308 Bacteria 14969
137 Ga0157375_10033181 3300013308 Bacteria 4903
138 Ga0163163_10000308 3300014325 Bacteria 48146
139 Ga0157379_10021468 3300014968 Bacteria 5715
140 Ga0157379_10101077 3300014968 Bacteria 2588
141 Ga0157376_10000640 3300014969 Bacteria 22683
142 Ga0157376_10023537 3300014969 Bacteria 4821
143 Ga0213872_10006182 3300021361 Bacteria 6046
144 Ga0213872_10008066 3300021361 Bacteria 5118
145 Ga0213872_10023660 3300021361 Bacteria 2827
146 Ga0209233_1022476 3300025261 Bacteria 1613
147 Ga0207656_10001917 3300025321 Bacteria 6917
148 Ga0207656_10014956 3300025321 Bacteria 2999
149 Ga0207710_10001743 3300025900 Bacteria 10514
150 Ga0207647_10013698 3300025904 Bacteria 5615
151 Ga0207647_10020619 3300025904 Bacteria 4416
152 Ga0207645_10042644 3300025907 Bacteria 2903
153 Ga0207705_10000063 3300025909 Bacteria 145090
154 Ga0207705_10002721 3300025909 Bacteria 13545
155 Ga0207705_10018994 3300025909 Bacteria 4915
156 Ga0207654_10000224 3300025911 Bacteria 34622
157 Ga0207654_10000292 3300025911 Bacteria 30389
158 Ga0207707_10011862 3300025912 Bacteria 7581
159 Ga0207707_10170661 3300025912 Bacteria 1901
160 Ga0207707_10242010 3300025912 Bacteria 1568
161 Ga0207707_10445925 3300025912 Bacteria 1108
162 Ga0207695_10000001 3300025913 Bacteria 2888630
163 Ga0207695_10000162 3300025913 Bacteria 198155
164 Ga0207695_10000191 3300025913 Bacteria 174087
165 Ga0207695_10002532 3300025913 Bacteria 26843
166 Ga0207695_10010880 3300025913 Bacteria 11077
167 Ga0207695_10031584 3300025913 Bacteria 5805
168 Ga0207695_10035989 3300025913 Bacteria 5358
169 Ga0207695_10107636 3300025913 Bacteria 2773
170 Ga0207695_10122239 3300025913 Bacteria 2570
171 Ga0207671_10000155 3300025914 Bacteria 106931
172 Ga0207671_10000179 3300025914 Bacteria 96661
173 Ga0207660_10038990 3300025917 Bacteria 3319
174 Ga0207657_10002973 3300025919 Bacteria 18181
175 Ga0207657_10065694 3300025919 Bacteria 3092
176 Ga0207657_10067065 3300025919 Bacteria 3053
177 Ga0207657_10082608 3300025919 Bacteria 2696
178 Ga0207649_10026966 3300025920 Bacteria 3367
179 Ga0207649_10030749 3300025920 Bacteria 3184
180 Ga0207652_10001006 3300025921 Bacteria 25990
181 Ga0207652_10014554 3300025921 Bacteria 6375
182 Ga0207652_10284633 3300025921 Bacteria 1491
183 Ga0207694_10000097 3300025924 Bacteria 96680
184 Ga0207694_10000142 3300025924 Bacteria 74189
185 Ga0207694_10052021 3300025924 Bacteria 3175
186 Ga0207694_10054061 3300025924 Unclassified 3115
187 Ga0207694_10259487 3300025924 Unclassified 1423
188 Ga0207650_10001581 3300025925 Bacteria 16261
189 Ga0207687_10004308 3300025927 Bacteria 9502
190 Ga0207644_10012625 3300025931 Bacteria 5614
191 Ga0207644_10020685 3300025931 Bacteria 4477
192 Ga0207690_10000741 3300025932 Bacteria 21047
193 Ga0207691_10003685 3300025940 Bacteria 14862
194 Ga0207711_10000032 3300025941 Bacteria 199046
195 Ga0207711_10055890 3300025941 Bacteria 3390
196 Ga0207689_10001093 3300025942 Bacteria 26126
197 Ga0207661_10001127 3300025944 Bacteria 17835
198 Ga0207661_10041308 3300025944 Bacteria 3630
199 Ga0207661_10054119 3300025944 Bacteria 3214
200 Ga0207661_10541958 3300025944 Bacteria 1065
201 Ga0207667_10000199 3300025949 Bacteria 87200
202 Ga0207667_10001180 3300025949 Bacteria 32820
203 Ga0207667_10002453 3300025949 Bacteria 23179
204 Ga0207667_10015021 3300025949 Bacteria 8808
205 Ga0207667_10081052 3300025949 Bacteria 3362
206 Ga0207667_10125445 3300025949 Bacteria 2644
207 Ga0207667_10361109 3300025949 Bacteria 1481
208 Ga0207712_10085609 3300025961 Bacteria 2307
209 Ga0207668_10159530 3300025972 Bacteria 1756
210 Ga0207640_10000007 3300025981 Bacteria 303287
211 Ga0207640_10013215 3300025981 Unclassified 4727
212 Ga0207640_10154379 3300025981 Unclassified 1690
213 Ga0207658_10004610 3300025986 Bacteria 9559
214 Ga0207677_10000244 3300026023 Bacteria 42077
215 Ga0207703_10200953 3300026035 Bacteria 1771
216 Ga0207639_10000036 3300026041 Bacteria 148421
217 Ga0207639_10000203 3300026041 Bacteria 44979
218 Ga0207639_10042347 3300026041 Unclassified 3412
219 Ga0207639_10097519 3300026041 Bacteria 2367
220 Ga0207639_10117576 3300026041 Bacteria 2179
221 Ga0207678_10001489 3300026067 Bacteria 21481
222 Ga0207678_10011598 3300026067 Bacteria 7742
223 Ga0207678_10052694 3300026067 Bacteria 3509
224 Ga0207702_10001408 3300026078 Bacteria 24015
225 Ga0207702_10003193 3300026078 Bacteria 15153
226 Ga0207702_10004619 3300026078 Bacteria 12201
227 Ga0207702_10028254 3300026078 Bacteria 4661
228 Ga0207702_10252542 3300026078 Bacteria 1657
229 Ga0207641_10223157 3300026088 Bacteria 1748
230 Ga0207676_10001460 3300026095 Bacteria 17570
231 Ga0207676_10031990 3300026095 Bacteria 3960
232 Ga0207674_10003903 3300026116 Bacteria 18139
233 Ga0207674_10005905 3300026116 Bacteria 14497
234 Ga0207674_10040456 3300026116 Bacteria 4828
235 Ga0207698_10000070 3300026142 Bacteria 68316
236 Ga0207698_10080935 3300026142 Bacteria 2619
237 Ga0207698_10256661 3300026142 Unclassified 1603
238 Ga0207698_10444156 3300026142 Unclassified 1250
239 Ga0268266_10060390 3300028379 Bacteria 3268
240 Ga0268266_10116832 3300028379 Bacteria 2370
241 Ga0268264_10000676 3300028381 Bacteria 39823
242 Ga0268264_10394241 3300028381 Bacteria 1329
243 Ga0265318_10022895 3300028577 Bacteria 2494
244 Ga0265338_10006060 3300028800 Bacteria 15525
245 Ga0265338_10006860 3300028800 Bacteria 14344
246 Ga0265338_10036389 3300028800 Bacteria 4712
247 Ga0265338_10071637 3300028800 Unclassified 2964
248 Ga0265330_10000165 3300031235 Bacteria 52643
249 Ga0265330_10000282 3300031235 Bacteria 37369
250 Ga0265330_10007037 3300031235 Bacteria 5517
251 Ga0265328_10011270 3300031239 Bacteria 3578
252 Ga0265320_10035494 3300031240 Bacteria 2527
253 Ga0265325_10001044 3300031241 Bacteria 19970
254 Ga0265325_10005986 3300031241 Bacteria 7442
255 Ga0265325_10015676 3300031241 Bacteria 4255
256 Ga0265340_10014729 3300031247 Bacteria 4079
257 Ga0265340_10048455 3300031247 Bacteria 2066
258 Ga0265340_10074775 3300031247 Bacteria 1601
259 Ga0265339_10004532 3300031249 Bacteria 9459
260 Ga0265339_10005159 3300031249 Bacteria 8756
261 Ga0265339_10012505 3300031249 Bacteria 5180
262 Ga0265339_10020815 3300031249 Bacteria 3827
263 Ga0265339_10024122 3300031249 Bacteria 3509
264 Ga0265331_10061230 3300031250 Bacteria 1777
265 Ga0265331_10122512 3300031250 Bacteria 1188
266 Ga0265316_10004030 3300031344 Bacteria 14708
267 Ga0265316_10008062 3300031344 Bacteria 9828
268 Ga0265316_10008902 3300031344 Bacteria 9267
269 Ga0265316_10016965 3300031344 Bacteria 6305
270 Ga0265316_10225260 3300031344 Bacteria 1382
271 Ga0265313_10004686 3300031595 Bacteria 10329
272 Ga0265313_10007598 3300031595 Bacteria 7361
273 Ga0265313_10029408 3300031595 Bacteria 2843
274 Ga0265314_10000326 3300031711 Bacteria 67045
275 Ga0265314_10005571 3300031711 Bacteria 11321
276 Ga0265342_10000710 3300031712 Bacteria 34500
277 Ga0265342_10002570 3300031712 Bacteria 15568
278 Ga0265342_10040480 3300031712 Bacteria 2826
279 Ga0265342_10056319 3300031712 Bacteria 2330
280 Ga0265342_10131885 3300031712 Bacteria 1399
281 Ga0316576_10233322 3300031727 Unclassified 1383
282 Ga0373937_0006912 3300036401 Bacteria 9795
283 Ga0373937_0252718 3300036401 Bacteria 1662
284 Ga0436360_0078417 3300039438 Bacteria 6908
285 Ga0436360_1111225 3300039438 Unclassified 1277
286 Ga0436361_0244027 3300039447 Bacteria 1228
287 Ga0436361_0493893 3300039447 Bacteria 5368
288 Ga0436361_0526805 3300039447 Bacteria 15522
289 Ga0436361_0533922 3300039447 Bacteria 24051
290 Ga0466966_0128959 3300044684 Bacteria 1550
291 Ga0466963_0117723 3300044694 Bacteria 1826
292 Ga0466959_0132883 3300045049 Bacteria 1763
293 Ga0466958_0028959 3300045836 Bacteria 3286
294 Ga0495592_0163051 3300046454 Bacteria 1532
295 Ga0495629_0109568 3300046459 Bacteria 1925
296 Ga0495653_0073438 3300046463 Bacteria 2552
297 Ga0495580_0058194 3300046472 Bacteria 2719
298 Ga0495580_0121084 3300046472 Bacteria 1817
299 Ga0495582_0005540 3300046473 Bacteria 7032
300 Ga0495582_0171084 3300046473 Bacteria 1237
301 Ga0495662_0004645 3300046476 Bacteria 6893
302 Ga0495664_0005770 3300046477 Bacteria 6812
303 Ga0495664_0032645 3300046477 Bacteria 3056
304 Ga0495594_0001032 3300046499 Bacteria 14508
305 Ga0495594_0014306 3300046499 Bacteria 4154
306 Ga0495594_0019612 3300046499 Bacteria 3595
307 Ga0495596_0028383 3300046500 Bacteria 2247
308 Ga0495583_0014662 3300046506 Bacteria 4311
309 Ga0495606_0022357 3300046507 Bacteria 4609
310 Ga0495618_0105042 3300046514 Bacteria 1809
311 Ga0495628_0022178 3300046516 Bacteria 5218
312 Ga0495644_0000455 3300046523 Bacteria 17730
313 Ga0495665_0044166 3300046531 Bacteria 2369
314 Ga0495640_0017870 3300046533 Bacteria 5272
315 Ga0495586_0032081 3300046535 Bacteria 2816
316 Ga0495587_0077609 3300046536 Bacteria 1928
317 Ga0495645_0018724 3300046543 Unclassified 4979
318 Ga0495645_0108207 3300046543 Bacteria 1969
319 Ga0495645_0146323 3300046543 Bacteria 1645
320 Ga0495622_0006633 3300046557 Bacteria 5365
321 Ga0495667_0033767 3300046559 Bacteria 3423
322 Ga0495668_0169556 3300046616 Bacteria 1196
323 Ga0495634_0010370 3300046642 Bacteria 6828
324 Ga0495625_0000525 3300046660 Bacteria 56458
325 Ga0495625_0013601 3300046660 Bacteria 6530
326 Ga0495635_0131150 3300046663 Bacteria 1708
327 Ga0495588_0181307 3300046674 Bacteria 1113
328 Ga0495646_0028443 3300046680 Bacteria 3499
329 Ga0495669_0001023 3300046684 Bacteria 11664
330 Ga0495669_0029697 3300046684 Bacteria 2398
331 Ga0495624_0197245 3300046690 Bacteria 1223
332 Ga0495649_0016709 3300046694 Bacteria 4156
333 Ga0495600_0002008 3300046809 Bacteria 11433
334 Ga0495600_0178010 3300046809 Bacteria 1371
335 Ga0495581_0018625 3300047315 Bacteria 4032
336 Ga0495604_0172084 3300047317 Bacteria 1522
337 Ga0495674_0043493 3300047319 Bacteria 3997
338 Ga0495676_0015339 3300047321 Bacteria 6826
339 Ga0495680_0014906 3300047322 Bacteria 6719
340 Ga0495675_0002232 3300047444 Bacteria 11566
341 Ga0495673_0058597 3300047469 Bacteria 1659
342 Ga0495686_0074063 3300047472 Bacteria 2090
343 Ga0495614_0000546 3300048089 Bacteria 15588
344 Ga0495614_0018547 3300048089 Bacteria 3014
345 Ga0496102_0045350 3300048905 Bacteria 3992
346 Ga0496104_0186052 3300048907 Bacteria 1987
347 Ga0496105_0032041 3300048908 Bacteria 4311
348 Ga0496105_0206614 3300048908 Bacteria 1602
349 Ga0496107_0002459 3300048910 Bacteria 12019
350 Ga0496114_0102308 3300048917 Bacteria 2447
351 Ga0496115_0007526 3300048918 Bacteria 8019
352 Ga0496115_0049605 3300048918 Bacteria 3361
353 Ga0496126_0000010 3300048929 Bacteria 744888
354 Ga0496126_0001423 3300048929 Bacteria 37784
355 Ga0496126_0018398 3300048929 Bacteria 6924
356 Ga0501032_0008291 3300049569 Bacteria 7572
357 Ga0501033_0014745 3300049570 Bacteria 5933
358 Ga0501034_0067330 3300049571 Bacteria 3594
359 Ga0501036_0009896 3300049572 Bacteria 7851
360 Ga0501037_0026749 3300049573 Bacteria 4263
361 Ga0501037_0060489 3300049573 Bacteria 2763
362 Ga0501038_0002628 3300049574 Bacteria 16799
363 Ga0501038_0234421 3300049574 Bacteria 1459
364 Ga0501039_0054510 3300049575 Bacteria 3095
365 Ga0501043_0004348 3300049579 Bacteria 11527
366 Ga0501046_0000520 3300049580 Bacteria 38045
367 Ga0501047_0000409 3300049581 Bacteria 48120
368 Ga0501047_0438974 3300049581 Bacteria 1136
369 Ga0501048_0076156 3300049582 Bacteria 2368
370 Ga0501035_0003523 3300049822 Bacteria 14959
371 Ga0501035_0160986 3300049822 Bacteria 1942
372 Ga0501044_0075770 3300049823 Bacteria 3416
373 Ga0495601_0038081 3300053077 Unclassified 3007
374 Ga0500651_0000004 3300053093 Bacteria 389879
375 Ga0500595_000043 3300053119 Bacteria 93122
376 Ga0500595_007721 3300053119 Bacteria 4447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10189815 rootH2_101898152 280
2 3300048918 Ga0496115_0049605 Ga0496115_0049605_188_1087 284
3 3300046472 Ga0495580_0121084 Ga0495580_0121084_808_1707 285
4 3300046473 Ga0495582_0171084 Ga0495582_0171084_262_1161 285
5 3300048907 Ga0496104_0186052 Ga0496104_0186052_523_1422 285
6 3300048908 Ga0496105_0032041 Ga0496105_0032041_133_1032 285
7 3300048910 Ga0496107_0002459 Ga0496107_0002459_5351_6250 285
8 3300048917 Ga0496114_0102308 Ga0496114_0102308_1204_2103 285
9 3300048918 Ga0496115_0007526 Ga0496115_0007526_1191_2090 285
10 3300003320 rootH2_10250321 rootH2_102503212 287
11 3300005530 Ga0070679_100001201 Ga0070679_10000120115 287
12 3300025921 Ga0207652_10001006 Ga0207652_1000100615 287
13 3300049581 Ga0501047_0438974 Ga0501047_0438974_49_912 287
14 3300005458 Ga0070681_10136925 Ga0070681_101369252 290
15 3300005539 Ga0068853_100000263 Ga0068853_1000002632 290
16 3300005563 Ga0068855_100426183 Ga0068855_1004261832 290
17 3300025261 Ga0209233_1022476 Ga0209233_10224762 290
18 3300025912 Ga0207707_10170661 Ga0207707_101706612 290
19 3300025913 Ga0207695_10031584 Ga0207695_100315843 290
20 3300025919 Ga0207657_10065694 Ga0207657_100656942 290
21 3300025919 Ga0207657_10067065 Ga0207657_100670653 290
22 3300025949 Ga0207667_10081052 Ga0207667_100810522 290
23 3300026067 Ga0207678_10052694 Ga0207678_100526942 290
24 3300048929 Ga0496126_0001423 Ga0496126_0001423_3712_4587 290
25 3300025913 Ga0207695_10107636 Ga0207695_101076362 291
26 3300026067 Ga0207678_10011598 Ga0207678_100115987 291
27 3300009551 Ga0105238_10214740 Ga0105238_102147402 295
28 3300013105 Ga0157369_10006532 Ga0157369_1000653211 295
29 3300026078 Ga0207702_10252542 Ga0207702_102525422 295
30 3300036401 Ga0373937_0252718 Ga0373937_0252718_568_1455 295
31 3300046454 Ga0495592_0163051 Ga0495592_0163051_148_1035 295
32 3300046543 Ga0495645_0146323 Ga0495645_0146323_71_958 295
33 3300046809 Ga0495600_0178010 Ga0495600_0178010_156_1043 295
34 3300049573 Ga0501037_0060489 Ga0501037_0060489_1573_2460 295
35 3300049823 Ga0501044_0075770 Ga0501044_0075770_921_1808 295
36 3300053093 Ga0500651_0000004 Ga0500651_0000004_371209_372096 295
37 3300025909 Ga0207705_10000063 Ga0207705_1000006326 296
38 3300025904 Ga0207647_10013698 Ga0207647_100136984 298
39 3300046507 Ga0495606_0022357 Ga0495606_0022357_106_1035 298
40 3300046616 Ga0495668_0169556 Ga0495668_0169556_230_1159 298
41 3300005327 Ga0070658_10022589 Ga0070658_100225892 299
42 3300005329 Ga0070683_100000221 Ga0070683_1000002216 299
43 3300005331 Ga0070670_100001323 Ga0070670_10000132316 299
44 3300005334 Ga0068869_100001729 Ga0068869_1000017295 299
45 3300005335 Ga0070666_10062935 Ga0070666_100629352 299
46 3300005337 Ga0070682_100222923 Ga0070682_1002229231 299
47 3300005338 Ga0068868_100000178 Ga0068868_1000001786 299
48 3300005338 Ga0068868_100073796 Ga0068868_1000737962 299
49 3300005344 Ga0070661_100008147 Ga0070661_1000081472 299
50 3300005344 Ga0070661_100042489 Ga0070661_1000424894 299
51 3300005355 Ga0070671_100002637 Ga0070671_1000026376 299
52 3300005367 Ga0070667_100001001 Ga0070667_10000100118 299
53 3300005435 Ga0070714_100348702 Ga0070714_1003487022 299
54 3300005458 Ga0070681_10000635 Ga0070681_1000063527 299
55 3300005458 Ga0070681_10094818 Ga0070681_100948182 299
56 3300005458 Ga0070681_10114284 Ga0070681_101142842 299
57 3300005530 Ga0070679_100006456 Ga0070679_1000064568 299
58 3300005530 Ga0070679_100211599 Ga0070679_1002115992 299
59 3300005535 Ga0070684_100000385 Ga0070684_10000038523 299
60 3300005535 Ga0070684_100001915 Ga0070684_10000191512 299
61 3300005535 Ga0070684_100007475 Ga0070684_1000074754 299
62 3300005539 Ga0068853_100000186 Ga0068853_10000018634 299
63 3300005539 Ga0068853_100015591 Ga0068853_1000155912 299
64 3300005539 Ga0068853_100092426 Ga0068853_1000924262 299
65 3300005539 Ga0068853_100133101 Ga0068853_1001331014 299
66 3300005548 Ga0070665_100146494 Ga0070665_1001464942 299
67 3300005563 Ga0068855_100001114 Ga0068855_10000111424 299
68 3300005563 Ga0068855_100009541 Ga0068855_1000095412 299
69 3300005563 Ga0068855_100030015 Ga0068855_1000300155 299
70 3300005563 Ga0068855_100048636 Ga0068855_1000486362 299
71 3300005563 Ga0068855_100403772 Ga0068855_1004037722 299
72 3300005577 Ga0068857_100000554 Ga0068857_10000055416 299
73 3300005577 Ga0068857_100002318 Ga0068857_1000023189 299
74 3300005577 Ga0068857_100299179 Ga0068857_1002991792 299
75 3300005578 Ga0068854_100019721 Ga0068854_1000197213 299
76 3300005578 Ga0068854_100438559 Ga0068854_1004385591 299
77 3300005614 Ga0068856_100001581 Ga0068856_10000158119 299
78 3300005614 Ga0068856_100001940 Ga0068856_1000019406 299
79 3300005614 Ga0068856_100047666 Ga0068856_1000476664 299
80 3300005614 Ga0068856_100474027 Ga0068856_1004740272 299
81 3300005616 Ga0068852_100000064 Ga0068852_10000006445 299
82 3300005616 Ga0068852_100038954 Ga0068852_1000389544 299
83 3300005616 Ga0068852_100047091 Ga0068852_1000470913 299
84 3300005617 Ga0068859_100007155 Ga0068859_1000071557 299
85 3300005618 Ga0068864_100001182 Ga0068864_1000011829 299
86 3300005834 Ga0068851_10010726 Ga0068851_100107264 299
87 3300005834 Ga0068851_10026975 Ga0068851_100269753 299
88 3300005841 Ga0068863_100001253 Ga0068863_10000125318 299
89 3300005842 Ga0068858_100043427 Ga0068858_1000434273 299
90 3300005843 Ga0068860_100003654 Ga0068860_1000036546 299
91 3300005843 Ga0068860_100237557 Ga0068860_1002375571 299
92 3300005844 Ga0068862_100093219 Ga0068862_1000932192 299
93 3300006237 Ga0097621_100000723 Ga0097621_10000072317 299
94 3300006358 Ga0068871_100000397 Ga0068871_10000039724 299
95 3300006931 Ga0097620_100007156 Ga0097620_1000071567 299
96 3300009093 Ga0105240_10000213 Ga0105240_1000021342 299
97 3300009093 Ga0105240_10000660 Ga0105240_100006606 299
98 3300009093 Ga0105240_10000775 Ga0105240_1000077525 299
99 3300009093 Ga0105240_10014624 Ga0105240_100146246 299
100 3300009093 Ga0105240_10036266 Ga0105240_100362664 299
101 3300009093 Ga0105240_10101130 Ga0105240_101011302 299
102 3300009093 Ga0105240_10232208 Ga0105240_102322082 299
103 3300009098 Ga0105245_10000274 Ga0105245_1000027434 299
104 3300009101 Ga0105247_10003818 Ga0105247_100038185 299
105 3300009174 Ga0105241_10000081 Ga0105241_1000008127 299
106 3300009174 Ga0105241_10000150 Ga0105241_100001508 299
107 3300009174 Ga0105241_10200432 Ga0105241_102004321 299
108 3300009177 Ga0105248_10003476 Ga0105248_1000347614 299
109 3300009545 Ga0105237_10002859 Ga0105237_100028592 299
110 3300009551 Ga0105238_10000167 Ga0105238_100001678 299
111 3300009551 Ga0105238_10001216 Ga0105238_100012168 299
112 3300009551 Ga0105238_10002625 Ga0105238_100026258 299
113 3300009551 Ga0105238_10021222 Ga0105238_100212226 299
114 3300009551 Ga0105238_10065484 Ga0105238_100654842 299
115 3300009551 Ga0105238_10327912 Ga0105238_103279122 299
116 3300009553 Ga0105249_10058908 Ga0105249_100589083 299
117 3300009553 Ga0105249_10338540 Ga0105249_103385401 299
118 3300010375 Ga0105239_10000751 Ga0105239_1000075132 299
119 3300010375 Ga0105239_10010916 Ga0105239_100109167 299
120 3300010375 Ga0105239_10017840 Ga0105239_1001784010 299
121 3300011119 Ga0105246_10002579 Ga0105246_100025797 299
122 3300013100 Ga0157373_10248428 Ga0157373_102484281 299
123 3300013104 Ga0157370_10000058 Ga0157370_1000005842 299
124 3300013105 Ga0157369_10000387 Ga0157369_1000038742 299
125 3300013105 Ga0157369_10001301 Ga0157369_1000130119 299
126 3300013105 Ga0157369_10011536 Ga0157369_100115368 299
127 3300013105 Ga0157369_10029859 Ga0157369_100298592 299
128 3300013105 Ga0157369_10144793 Ga0157369_101447933 299
129 3300013105 Ga0157369_10204145 Ga0157369_102041452 299
130 3300013105 Ga0157369_10228757 Ga0157369_102287572 299
131 3300013296 Ga0157374_10000826 Ga0157374_100008266 299
132 3300013296 Ga0157374_10023383 Ga0157374_100233835 299
133 3300013296 Ga0157374_10068798 Ga0157374_100687982 299
134 3300013296 Ga0157374_10111183 Ga0157374_101111833 299
135 3300013296 Ga0157374_10318493 Ga0157374_103184932 299
136 3300013297 Ga0157378_10001611 Ga0157378_1000161113 299
137 3300013297 Ga0157378_10077006 Ga0157378_100770063 299
138 3300013307 Ga0157372_10000257 Ga0157372_1000025742 299
139 3300013307 Ga0157372_10000849 Ga0157372_1000084924 299
140 3300013307 Ga0157372_10004002 Ga0157372_100040029 299
141 3300013307 Ga0157372_10016142 Ga0157372_100161425 299
142 3300013307 Ga0157372_10036393 Ga0157372_100363932 299
143 3300013308 Ga0157375_10002851 Ga0157375_1000285111 299
144 3300013308 Ga0157375_10033181 Ga0157375_100331812 299
145 3300014325 Ga0163163_10000308 Ga0163163_100003088 299
146 3300014968 Ga0157379_10021468 Ga0157379_100214685 299
147 3300014968 Ga0157379_10101077 Ga0157379_101010772 299
148 3300014969 Ga0157376_10000640 Ga0157376_100006406 299
149 3300014969 Ga0157376_10023537 Ga0157376_100235374 299
150 3300021361 Ga0213872_10006182 Ga0213872_100061821 299
151 3300021361 Ga0213872_10008066 Ga0213872_100080664 299
152 3300021361 Ga0213872_10023660 Ga0213872_100236602 299
153 3300025321 Ga0207656_10001917 Ga0207656_100019176 299
154 3300025900 Ga0207710_10001743 Ga0207710_100017436 299
155 3300025907 Ga0207645_10042644 Ga0207645_100426443 299
156 3300025911 Ga0207654_10000224 Ga0207654_1000022427 299
157 3300025911 Ga0207654_10000292 Ga0207654_1000029221 299
158 3300025912 Ga0207707_10011862 Ga0207707_100118628 299
159 3300025912 Ga0207707_10242010 Ga0207707_102420102 299
160 3300025912 Ga0207707_10445925 Ga0207707_104459251 299
161 3300025913 Ga0207695_10000162 Ga0207695_1000016288 299
162 3300025913 Ga0207695_10000191 Ga0207695_1000019191 299
163 3300025913 Ga0207695_10002532 Ga0207695_1000253221 299
164 3300025913 Ga0207695_10010880 Ga0207695_100108806 299
165 3300025913 Ga0207695_10035989 Ga0207695_100359892 299
166 3300025913 Ga0207695_10122239 Ga0207695_101222392 299
167 3300025914 Ga0207671_10000155 Ga0207671_1000015579 299
168 3300025914 Ga0207671_10000179 Ga0207671_1000017965 299
169 3300025917 Ga0207660_10038990 Ga0207660_100389903 299
170 3300025919 Ga0207657_10082608 Ga0207657_100826082 299
171 3300025920 Ga0207649_10026966 Ga0207649_100269663 299
172 3300025921 Ga0207652_10014554 Ga0207652_100145542 299
173 3300025921 Ga0207652_10284633 Ga0207652_102846332 299
174 3300025924 Ga0207694_10000097 Ga0207694_100000978 299
175 3300025924 Ga0207694_10000142 Ga0207694_1000014213 299
176 3300025924 Ga0207694_10052021 Ga0207694_100520212 299
177 3300025924 Ga0207694_10054061 Ga0207694_100540613 299
178 3300025924 Ga0207694_10259487 Ga0207694_102594871 299
179 3300025925 Ga0207650_10001581 Ga0207650_100015818 299
180 3300025927 Ga0207687_10004308 Ga0207687_100043087 299
181 3300025931 Ga0207644_10012625 Ga0207644_100126256 299
182 3300025940 Ga0207691_10003685 Ga0207691_1000368510 299
183 3300025941 Ga0207711_10055890 Ga0207711_100558903 299
184 3300025942 Ga0207689_10001093 Ga0207689_1000109310 299
185 3300025944 Ga0207661_10001127 Ga0207661_100011276 299
186 3300025944 Ga0207661_10041308 Ga0207661_100413083 299
187 3300025944 Ga0207661_10054119 Ga0207661_100541192 299
188 3300025944 Ga0207661_10541958 Ga0207661_105419581 299
189 3300025949 Ga0207667_10000199 Ga0207667_1000019926 299
190 3300025949 Ga0207667_10001180 Ga0207667_1000118020 299
191 3300025949 Ga0207667_10002453 Ga0207667_1000245317 299
192 3300025949 Ga0207667_10015021 Ga0207667_100150217 299
193 3300025949 Ga0207667_10125445 Ga0207667_101254452 299
194 3300025949 Ga0207667_10361109 Ga0207667_103611091 299
195 3300025961 Ga0207712_10085609 Ga0207712_100856092 299
196 3300025972 Ga0207668_10159530 Ga0207668_101595302 299
197 3300025981 Ga0207640_10013215 Ga0207640_100132152 299
198 3300025981 Ga0207640_10154379 Ga0207640_101543792 299
199 3300025986 Ga0207658_10004610 Ga0207658_100046105 299
200 3300026023 Ga0207677_10000244 Ga0207677_1000024415 299
201 3300026035 Ga0207703_10200953 Ga0207703_102009532 299
202 3300026041 Ga0207639_10000203 Ga0207639_1000020334 299
203 3300026041 Ga0207639_10042347 Ga0207639_100423472 299
204 3300026041 Ga0207639_10097519 Ga0207639_100975193 299
205 3300026041 Ga0207639_10117576 Ga0207639_101175762 299
206 3300026078 Ga0207702_10001408 Ga0207702_1000140814 299
207 3300026078 Ga0207702_10003193 Ga0207702_100031936 299
208 3300026078 Ga0207702_10004619 Ga0207702_100046198 299
209 3300026078 Ga0207702_10028254 Ga0207702_100282544 299
210 3300026095 Ga0207676_10001460 Ga0207676_1000146015 299
211 3300026116 Ga0207674_10003903 Ga0207674_1000390313 299
212 3300026116 Ga0207674_10005905 Ga0207674_100059057 299
213 3300026142 Ga0207698_10000070 Ga0207698_100000703 299
214 3300026142 Ga0207698_10256661 Ga0207698_102566613 299
215 3300028379 Ga0268266_10116832 Ga0268266_101168322 299
216 3300028381 Ga0268264_10000676 Ga0268264_1000067621 299
217 3300028381 Ga0268264_10394241 Ga0268264_103942412 299
218 3300028577 Ga0265318_10022895 Ga0265318_100228952 299
219 3300028800 Ga0265338_10006060 Ga0265338_1000606013 299
220 3300028800 Ga0265338_10006860 Ga0265338_1000686011 299
221 3300028800 Ga0265338_10036389 Ga0265338_100363894 299
222 3300028800 Ga0265338_10071637 Ga0265338_100716373 299
223 3300031235 Ga0265330_10000165 Ga0265330_1000016540 299
224 3300031235 Ga0265330_10000282 Ga0265330_1000028211 299
225 3300031235 Ga0265330_10007037 Ga0265330_100070376 299
226 3300031240 Ga0265320_10035494 Ga0265320_100354942 299
227 3300031241 Ga0265325_10001044 Ga0265325_1000104411 299
228 3300031241 Ga0265325_10005986 Ga0265325_100059866 299
229 3300031241 Ga0265325_10015676 Ga0265325_100156764 299
230 3300031247 Ga0265340_10014729 Ga0265340_100147293 299
231 3300031247 Ga0265340_10048455 Ga0265340_100484552 299
232 3300031247 Ga0265340_10074775 Ga0265340_100747752 299
233 3300031249 Ga0265339_10004532 Ga0265339_100045322 299
234 3300031249 Ga0265339_10005159 Ga0265339_100051597 299
235 3300031249 Ga0265339_10012505 Ga0265339_100125054 299
236 3300031249 Ga0265339_10020815 Ga0265339_100208152 299
237 3300031249 Ga0265339_10024122 Ga0265339_100241224 299
238 3300031250 Ga0265331_10061230 Ga0265331_100612302 299
239 3300031250 Ga0265331_10122512 Ga0265331_101225122 299
240 3300031344 Ga0265316_10004030 Ga0265316_1000403015 299
241 3300031344 Ga0265316_10008062 Ga0265316_100080624 299
242 3300031344 Ga0265316_10008902 Ga0265316_100089023 299
243 3300031344 Ga0265316_10016965 Ga0265316_100169654 299
244 3300031344 Ga0265316_10225260 Ga0265316_102252601 299
245 3300031595 Ga0265313_10004686 Ga0265313_100046868 299
246 3300031595 Ga0265313_10007598 Ga0265313_100075986 299
247 3300031595 Ga0265313_10029408 Ga0265313_100294082 299
248 3300031711 Ga0265314_10000326 Ga0265314_1000032625 299
249 3300031711 Ga0265314_10005571 Ga0265314_100055712 299
250 3300031712 Ga0265342_10000710 Ga0265342_1000071022 299
251 3300031712 Ga0265342_10002570 Ga0265342_100025707 299
252 3300031712 Ga0265342_10040480 Ga0265342_100404803 299
253 3300031712 Ga0265342_10056319 Ga0265342_100563193 299
254 3300031712 Ga0265342_10131885 Ga0265342_101318852 299
255 3300036401 Ga0373937_0006912 Ga0373937_0006912_1660_2559 299
256 3300039438 Ga0436360_0078417 Ga0436360_0078417_3400_4299 299
257 3300039447 Ga0436361_0244027 Ga0436361_0244027_123_1022 299
258 3300039447 Ga0436361_0493893 Ga0436361_0493893_244_1143 299
259 3300039447 Ga0436361_0526805 Ga0436361_0526805_12318_13220 299
260 3300039447 Ga0436361_0533922 Ga0436361_0533922_16395_17294 299
261 3300044684 Ga0466966_0128959 Ga0466966_0128959_168_1070 299
262 3300044694 Ga0466963_0117723 Ga0466963_0117723_263_1165 299
263 3300045049 Ga0466959_0132883 Ga0466959_0132883_25_927 299
264 3300045836 Ga0466958_0028959 Ga0466958_0028959_2119_3021 299
265 3300046536 Ga0495587_0077609 Ga0495587_0077609_45_947 299
266 3300046543 Ga0495645_0018724 Ga0495645_0018724_2826_3728 299
267 3300046684 Ga0495669_0029697 Ga0495669_0029697_691_1593 299
268 3300047317 Ga0495604_0172084 Ga0495604_0172084_538_1440 299
269 3300048905 Ga0496102_0045350 Ga0496102_0045350_166_1068 299
270 3300048908 Ga0496105_0206614 Ga0496105_0206614_250_1149 299
271 3300053077 Ga0495601_0038081 Ga0495601_0038081_2049_2951 299
272 3300031727 Ga0316576_10233322 Ga0316576_102333221 300
273 3300046459 Ga0495629_0109568 Ga0495629_0109568_964_1899 300
274 3300046463 Ga0495653_0073438 Ga0495653_0073438_465_1400 300
275 3300046472 Ga0495580_0058194 Ga0495580_0058194_837_1772 300
276 3300046473 Ga0495582_0005540 Ga0495582_0005540_5977_6912 300
277 3300046476 Ga0495662_0004645 Ga0495662_0004645_3701_4636 300
278 3300046477 Ga0495664_0005770 Ga0495664_0005770_3304_4239 300
279 3300046499 Ga0495594_0001032 Ga0495594_0001032_11222_12157 300
280 3300046516 Ga0495628_0022178 Ga0495628_0022178_2866_3801 300
281 3300046531 Ga0495665_0044166 Ga0495665_0044166_429_1364 300
282 3300046533 Ga0495640_0017870 Ga0495640_0017870_1312_2247 300
283 3300046535 Ga0495586_0032081 Ga0495586_0032081_1064_1999 300
284 3300046559 Ga0495667_0033767 Ga0495667_0033767_1171_2106 300
285 3300046642 Ga0495634_0010370 Ga0495634_0010370_4741_5676 300
286 3300046674 Ga0495588_0181307 Ga0495588_0181307_142_1077 300
287 3300046680 Ga0495646_0028443 Ga0495646_0028443_1751_2686 300
288 3300046690 Ga0495624_0197245 Ga0495624_0197245_275_1210 300
289 3300046809 Ga0495600_0002008 Ga0495600_0002008_121_1056 300
290 3300047315 Ga0495581_0018625 Ga0495581_0018625_1475_2410 300
291 3300047319 Ga0495674_0043493 Ga0495674_0043493_1312_2247 300
292 3300047321 Ga0495676_0015339 Ga0495676_0015339_225_1160 300
293 3300047322 Ga0495680_0014906 Ga0495680_0014906_3333_4268 300
294 3300047444 Ga0495675_0002232 Ga0495675_0002232_7011_7946 300
295 3300048089 Ga0495614_0000546 Ga0495614_0000546_9258_10193 300
296 3300005548 Ga0070665_100012807 Ga0070665_1000128077 301
297 3300005618 Ga0068864_100094001 Ga0068864_1000940012 301
298 3300005834 Ga0068851_10129307 Ga0068851_101293072 301
299 3300005841 Ga0068863_100244543 Ga0068863_1002445432 301
300 3300006237 Ga0097621_100114965 Ga0097621_1001149652 301
301 3300025931 Ga0207644_10020685 Ga0207644_100206855 301
302 3300026088 Ga0207641_10223157 Ga0207641_102231572 301
303 3300026095 Ga0207676_10031990 Ga0207676_100319904 301
304 3300028379 Ga0268266_10060390 Ga0268266_100603902 301
305 3300039438 Ga0436360_1111225 Ga0436360_1111225_284_1195 301
306 3300025913 Ga0207695_10000001 Ga0207695_10000001686 302
307 3300025941 Ga0207711_10000032 Ga0207711_100000327 302
308 3300048929 Ga0496126_0018398 Ga0496126_0018398_2409_3323 302
309 3300013104 Ga0157370_10076111 Ga0157370_100761113 304
310 3300005563 Ga0068855_100047199 Ga0068855_1000471995 305
311 3300005577 Ga0068857_100044705 Ga0068857_1000447052 305
312 3300025321 Ga0207656_10014956 Ga0207656_100149562 305
313 3300025909 Ga0207705_10018994 Ga0207705_100189941 305
314 3300025920 Ga0207649_10030749 Ga0207649_100307492 305
315 3300026116 Ga0207674_10040456 Ga0207674_100404562 305
316 3300026142 Ga0207698_10080935 Ga0207698_100809352 305
317 iso_pu_bacteria 2884215851 2884216269 305
318 3300005335 Ga0070666_10046897 Ga0070666_100468973 306
319 3300046499 Ga0495594_0019612 Ga0495594_0019612_1889_2827 308
320 3300046514 Ga0495618_0105042 Ga0495618_0105042_193_1128 308
321 3300046543 Ga0495645_0108207 Ga0495645_0108207_834_1769 308
322 3300046557 Ga0495622_0006633 Ga0495622_0006633_4160_5098 308
323 3300046663 Ga0495635_0131150 Ga0495635_0131150_498_1433 308
324 3300047472 Ga0495686_0074063 Ga0495686_0074063_22_966 308
325 3300048089 Ga0495614_0018547 Ga0495614_0018547_1681_2619 308
326 3300003316 rootH1_10140905 rootH1_101409052 309
327 3300005455 Ga0070663_100006860 Ga0070663_1000068602 309
328 3300005455 Ga0070663_100033255 Ga0070663_1000332553 309
329 3300005539 Ga0068853_100008124 Ga0068853_1000081245 309
330 3300005578 Ga0068854_100001242 Ga0068854_1000012423 309
331 3300005616 Ga0068852_100495306 Ga0068852_1004953061 309
332 3300009093 Ga0105240_10005079 Ga0105240_100050791 309
333 3300009093 Ga0105240_10131774 Ga0105240_101317742 309
334 3300009177 Ga0105248_10411142 Ga0105248_104111422 309
335 3300009545 Ga0105237_10022902 Ga0105237_100229022 309
336 3300009545 Ga0105237_10064438 Ga0105237_100644382 309
337 3300013104 Ga0157370_10025336 Ga0157370_100253365 309
338 3300013104 Ga0157370_10047739 Ga0157370_100477394 309
339 3300013104 Ga0157370_10103126 Ga0157370_101031262 309
340 3300013105 Ga0157369_10004428 Ga0157369_100044286 309
341 3300013307 Ga0157372_10012374 Ga0157372_100123748 309
342 3300025904 Ga0207647_10020619 Ga0207647_100206192 309
343 3300025909 Ga0207705_10002721 Ga0207705_100027219 309
344 3300025919 Ga0207657_10002973 Ga0207657_1000297318 309
345 3300025932 Ga0207690_10000741 Ga0207690_100007413 309
346 3300025981 Ga0207640_10000007 Ga0207640_1000000714 309
347 3300026041 Ga0207639_10000036 Ga0207639_100000362 309
348 3300026067 Ga0207678_10001489 Ga0207678_100014892 309
349 3300026142 Ga0207698_10444156 Ga0207698_104441561 309
350 3300031239 Ga0265328_10011270 Ga0265328_100112704 309
351 3300046477 Ga0495664_0032645 Ga0495664_0032645_799_1746 309
352 3300046499 Ga0495594_0014306 Ga0495594_0014306_1101_2045 309
353 3300046500 Ga0495596_0028383 Ga0495596_0028383_966_1910 309
354 3300046506 Ga0495583_0014662 Ga0495583_0014662_35_979 309
355 3300046523 Ga0495644_0000455 Ga0495644_0000455_14140_15084 309
356 3300046660 Ga0495625_0000525 Ga0495625_0000525_10832_11776 309
357 3300046660 Ga0495625_0013601 Ga0495625_0013601_3771_4715 309
358 3300046684 Ga0495669_0001023 Ga0495669_0001023_9991_10935 309
359 3300046694 Ga0495649_0016709 Ga0495649_0016709_1511_2440 309
360 3300047469 Ga0495673_0058597 Ga0495673_0058597_174_1118 309
361 3300048929 Ga0496126_0000010 Ga0496126_0000010_142087_143031 309
362 3300049569 Ga0501032_0008291 Ga0501032_0008291_4893_5837 309
363 3300049570 Ga0501033_0014745 Ga0501033_0014745_391_1335 309
364 3300049571 Ga0501034_0067330 Ga0501034_0067330_2261_3205 309
365 3300049572 Ga0501036_0009896 Ga0501036_0009896_6559_7503 309
366 3300049573 Ga0501037_0026749 Ga0501037_0026749_390_1334 309
367 3300049574 Ga0501038_0002628 Ga0501038_0002628_1823_2767 309
368 3300049574 Ga0501038_0234421 Ga0501038_0234421_284_1228 309
369 3300049575 Ga0501039_0054510 Ga0501039_0054510_1756_2700 309
370 3300049579 Ga0501043_0004348 Ga0501043_0004348_270_1214 309
371 3300049580 Ga0501046_0000520 Ga0501046_0000520_6842_7786 309
372 3300049581 Ga0501047_0000409 Ga0501047_0000409_37063_38007 309
373 3300049582 Ga0501048_0076156 Ga0501048_0076156_220_1164 309
374 3300049822 Ga0501035_0003523 Ga0501035_0003523_3741_4685 309
375 3300049822 Ga0501035_0160986 Ga0501035_0160986_963_1907 309
376 3300053119 Ga0500595_000043 Ga0500595_000043_58306_59250 309
377 3300053119 Ga0500595_007721 Ga0500595_007721_663_1607 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03279

Lip_A_acyltrans

Bacterial lipid A biosynthesis acyltransferase

52

344

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8689 56 291
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.8128 30 302
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8023 56 291
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.7928 21 302
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.7167 21 302
ID Description Score Start End Superfamily
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6586 107 237 3.40.50.2000
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6489 116 237 3.40.1010.10
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6278 107 237 3.40.50.2000
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6074 118 237 3.40.50.2000
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.5937 116 237 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A6L4Z5D5-F1-model_v4 Lipid A biosynthesis lauroyl acyltransferase 0.9843 12 221 GO:0005886
GO:0009247
GO:0016746
AF-A0A2V9YDF0-F1-model_v4 Lipid A biosynthesis acyltransferase 0.9812 103 309 GO:0005886
GO:0009247
GO:0016746
AF-A0A7W0XF88-F1-model_v4 Lysophospholipid acyltransferase family protein 0.9761 7 308 GO:0005886
GO:0009247
GO:0016746
AF-A0A2V8YSI0-F1-model_v4 Lipid A biosynthesis acyltransferase 0.9743 125 309 GO:0005886
GO:0009247
GO:0016746
AF-A0A1F8X958-F1-model_v4 Lipid A biosynthesis acyltransferase 0.9731 22 305 GO:0005886
GO:0009247
GO:0016746

Feature Viewer

pLDDT pTM Quality
93.04 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map