F427719

General Info

Members Datasets Scaffolds Average Seq Length
377 179 377 267

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10016586|Ga0207691_100165863
Length 280
Sequence VHHFDSASRALSARSSEFAPAKLNLALHVRGKLLDGRHAIETIFAFCTDGDRLSGEVVDDGRLELETSGDFARDLGDQNLITMAAIALRAAAGVYAGAALTLDKRLPVAAGLGGGSADAAAALRLLTSIWSIDPAHAEAVAPKLGSDVPACLLSLPMRGEGAGDQLTPADLADLSGTPVLLVNPRVALSTADVFARWDGVDRGPLGYWREGRNDLEAPATALVPQIEAVLAFLATRPGATFSRMSGSGATCFALFDSEGARDNAAHHVPREWWHLATYLR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.12
Rhizosphere 97.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007059 3300001979 Bacteria 4603
2 JGI24740J21852_10023111 3300001979 Bacteria 2129
3 JGI24735J21928_10020098 3300002067 Bacteria 2048
4 JGI24749J21850_1001908 3300002076 Bacteria 2945
5 Ga0065715_10000370 3300005293 Bacteria 13372
6 Ga0070658_10008759 3300005327 Bacteria 8129
7 Ga0070658_10013320 3300005327 Bacteria 6598
8 Ga0070676_10016546 3300005328 Bacteria 4079
9 Ga0070676_10041081 3300005328 Bacteria 2680
10 Ga0070676_10312801 3300005328 Bacteria 1068
11 Ga0070683_100053787 3300005329 Bacteria 3731
12 Ga0070690_100030050 3300005330 Bacteria 3374
13 Ga0070670_100001912 3300005331 Bacteria 17058
14 Ga0070670_100074489 3300005331 Bacteria 2916
15 Ga0070677_10000430 3300005333 Bacteria 14476
16 Ga0070677_10007722 3300005333 Bacteria 3602
17 Ga0068869_100170597 3300005334 Bacteria 1699
18 Ga0070666_10020531 3300005335 Bacteria 4271
19 Ga0070680_100003482 3300005336 Bacteria 11750
20 Ga0070680_100026291 3300005336 Bacteria 4654
21 Ga0068868_100024470 3300005338 Bacteria 4582
22 Ga0068868_100100873 3300005338 Bacteria 2335
23 Ga0070660_100010351 3300005339 Bacteria 6589
24 Ga0070660_100108670 3300005339 Bacteria 2204
25 Ga0070660_100115074 3300005339 Bacteria 2143
26 Ga0070691_10019274 3300005341 Bacteria 3147
27 Ga0070687_100119259 3300005343 Bacteria 1506
28 Ga0070687_100255353 3300005343 Unclassified 1091
29 Ga0070661_100015051 3300005344 Bacteria 5456
30 Ga0070661_100043091 3300005344 Bacteria 3296
31 Ga0070661_100054212 3300005344 Bacteria 2936
32 Ga0070661_100385699 3300005344 Bacteria 1105
33 Ga0070668_100051558 3300005347 Bacteria 3171
34 Ga0070668_100131984 3300005347 Bacteria 2005
35 Ga0070669_100004727 3300005353 Bacteria 9817
36 Ga0070675_100002570 3300005354 Bacteria 13593
37 Ga0070671_100005670 3300005355 Bacteria 9937
38 Ga0070671_100026544 3300005355 Bacteria 4760
39 Ga0070671_100201070 3300005355 Bacteria 1689
40 Ga0070674_100004207 3300005356 Bacteria 8176
41 Ga0070673_100040621 3300005364 Bacteria 3570
42 Ga0070673_100184496 3300005364 Bacteria 1788
43 Ga0070688_100038914 3300005365 Bacteria 2908
44 Ga0070659_100005748 3300005366 Bacteria 8926
45 Ga0070659_100424270 3300005366 Bacteria 1125
46 Ga0070667_100026584 3300005367 Bacteria 4815
47 Ga0070667_100029828 3300005367 Bacteria 4547
48 Ga0070667_100031826 3300005367 Bacteria 4397
49 Ga0070714_100100298 3300005435 Bacteria 2550
50 Ga0070701_10008008 3300005438 Bacteria 4544
51 Ga0070705_100169686 3300005440 Bacteria 1467
52 Ga0070663_100015918 3300005455 Bacteria 4869
53 Ga0070663_100018631 3300005455 Bacteria 4556
54 Ga0070663_100134770 3300005455 Bacteria 1879
55 Ga0070663_100136259 3300005455 Bacteria 1870
56 Ga0070678_100043761 3300005456 Bacteria 3192
57 Ga0070678_100492678 3300005456 Unclassified 1080
58 Ga0070662_100001494 3300005457 Bacteria 14387
59 Ga0070662_100192347 3300005457 Bacteria 1614
60 Ga0070662_100205991 3300005457 Bacteria 1563
61 Ga0070662_100240439 3300005457 Bacteria 1452
62 Ga0070662_100316825 3300005457 Bacteria 1271
63 Ga0070681_10007779 3300005458 Bacteria 10478
64 Ga0070681_10599421 3300005458 Bacteria 1016
65 Ga0068867_100025668 3300005459 Bacteria 4229
66 Ga0068867_100279971 3300005459 Bacteria 1367
67 Ga0070679_100490117 3300005530 Bacteria 1173
68 Ga0070684_100009366 3300005535 Bacteria 7710
69 Ga0068853_100021692 3300005539 Bacteria 5358
70 Ga0068853_100038037 3300005539 Bacteria 4097
71 Ga0068853_100119528 3300005539 Bacteria 2349
72 Ga0070672_100001865 3300005543 Bacteria 13165
73 Ga0070672_100095546 3300005543 Bacteria 2403
74 Ga0070665_100013752 3300005548 Bacteria 8144
75 Ga0070665_100103745 3300005548 Bacteria 2846
76 Ga0070665_100583489 3300005548 Bacteria 1131
77 Ga0070704_100131850 3300005549 Bacteria 1938
78 Ga0070664_100004639 3300005564 Bacteria 11031
79 Ga0070664_100005105 3300005564 Bacteria 10536
80 Ga0070664_100024952 3300005564 Bacteria 4954
81 Ga0070664_100049560 3300005564 Bacteria 3552
82 Ga0068857_100014587 3300005577 Bacteria 6855
83 Ga0068854_100009383 3300005578 Bacteria 6318
84 Ga0068854_100057755 3300005578 Bacteria 2799
85 Ga0068854_100142226 3300005578 Bacteria 1842
86 Ga0068854_100231797 3300005578 Bacteria 1466
87 Ga0068856_100053274 3300005614 Bacteria 3989
88 Ga0068856_100084778 3300005614 Bacteria 3148
89 Ga0068852_100011308 3300005616 Bacteria 6714
90 Ga0068852_100017152 3300005616 Bacteria 5674
91 Ga0068852_100044261 3300005616 Bacteria 3779
92 Ga0068852_100159078 3300005616 Bacteria 2107
93 Ga0068852_100272397 3300005616 Bacteria 1629
94 Ga0068859_100023440 3300005617 Bacteria 6193
95 Ga0068859_100059253 3300005617 Bacteria 3857
96 Ga0068864_100022334 3300005618 Bacteria 5305
97 Ga0068864_100051759 3300005618 Bacteria 3538
98 Ga0068864_100058612 3300005618 Bacteria 3329
99 Ga0068864_100223266 3300005618 Bacteria 1739
100 Ga0068861_100479648 3300005719 Bacteria 1120
101 Ga0068851_10016793 3300005834 Bacteria 3507
102 Ga0068863_100177214 3300005841 Bacteria 2046
103 Ga0068863_100454547 3300005841 Bacteria 1257
104 Ga0068858_100430987 3300005842 Bacteria 1269
105 Ga0068860_100102948 3300005843 Bacteria 2725
106 Ga0068860_100126561 3300005843 Bacteria 2449
107 Ga0068860_100217294 3300005843 Bacteria 1855
108 Ga0068860_100406029 3300005843 Bacteria 1348
109 Ga0068862_100006881 3300005844 Bacteria 9430
110 Ga0068862_100008099 3300005844 Bacteria 8696
111 Ga0068862_100048076 3300005844 Bacteria 3642
112 Ga0097621_100297181 3300006237 Bacteria 1425
113 Ga0068871_100017020 3300006358 Bacteria 5490
114 Ga0075428_100139177 3300006844 Bacteria 2638
115 Ga0075433_10059602 3300006852 Bacteria 3339
116 Ga0068865_100012328 3300006881 Bacteria 5377
117 Ga0068865_100066306 3300006881 Bacteria 2546
118 Ga0097620_100023440 3300006931 Bacteria 6193
119 Ga0097620_100059254 3300006931 Bacteria 3857
120 Ga0105240_10041798 3300009093 Bacteria 5846
121 Ga0111539_10041388 3300009094 Bacteria 5540
122 Ga0105245_10003796 3300009098 Bacteria 13436
123 Ga0105245_10058496 3300009098 Bacteria 3470
124 Ga0105245_10159328 3300009098 Bacteria 2140
125 Ga0105245_10172600 3300009098 Bacteria 2060
126 Ga0105241_10115936 3300009174 Bacteria 2151
127 Ga0105242_10060809 3300009176 Bacteria 3105
128 Ga0105248_10024379 3300009177 Bacteria 6727
129 Ga0105237_10034968 3300009545 Bacteria 5085
130 Ga0105238_10011752 3300009551 Bacteria 8825
131 Ga0105238_10035054 3300009551 Bacteria 5104
132 Ga0105249_10012562 3300009553 Bacteria 7465
133 Ga0105249_10146720 3300009553 Bacteria 2267
134 Ga0105239_10166072 3300010375 Bacteria 2468
135 Ga0105246_10079935 3300011119 Bacteria 2326
136 Ga0157373_10013649 3300013100 Bacteria 5957
137 Ga0157373_10016531 3300013100 Bacteria 5380
138 Ga0157373_10239881 3300013100 Bacteria 1281
139 Ga0157371_10066835 3300013102 Bacteria 2545
140 Ga0157370_10018022 3300013104 Bacteria 7107
141 Ga0157369_10057400 3300013105 Bacteria 4200
142 Ga0157369_10533238 3300013105 Bacteria 1214
143 Ga0157374_10158695 3300013296 Bacteria 2202
144 Ga0163162_10055501 3300013306 Bacteria 3988
145 Ga0163162_10409322 3300013306 Bacteria 1489
146 Ga0157372_10029222 3300013307 Bacteria 6017
147 Ga0157375_10169609 3300013308 Bacteria 2329
148 Ga0157375_10392549 3300013308 Bacteria 1554
149 Ga0163163_10065730 3300014325 Bacteria 3601
150 Ga0157380_10001232 3300014326 Bacteria 16609
151 Ga0157380_10411220 3300014326 Bacteria 1287
152 Ga0157380_10664813 3300014326 Bacteria 1041
153 Ga0182008_10173726 3300014497 Bacteria 1088
154 Ga0157377_10009183 3300014745 Bacteria 4842
155 Ga0157376_10006900 3300014969 Bacteria 8044
156 Ga0197907_10854725 3300020069 Bacteria 2214
157 Ga0207697_10003347 3300025315 Bacteria 7971
158 Ga0207697_10005604 3300025315 Bacteria 5812
159 Ga0207656_10012915 3300025321 Bacteria 3181
160 Ga0207656_10014270 3300025321 Bacteria 3056
161 Ga0207682_10001260 3300025893 Bacteria 11713
162 Ga0207682_10005004 3300025893 Bacteria 5436
163 Ga0207642_10039499 3300025899 Bacteria 2051
164 Ga0207688_10022485 3300025901 Bacteria 3450
165 Ga0207680_10279527 3300025903 Bacteria 1159
166 Ga0207647_10007040 3300025904 Bacteria 8156
167 Ga0207647_10184677 3300025904 Bacteria 1210
168 Ga0207645_10014115 3300025907 Bacteria 5353
169 Ga0207643_10036646 3300025908 Bacteria 2751
170 Ga0207705_10013751 3300025909 Bacteria 5838
171 Ga0207705_10034707 3300025909 Bacteria 3608
172 Ga0207705_10052239 3300025909 Bacteria 2942
173 Ga0207705_10216204 3300025909 Bacteria 1454
174 Ga0207707_10056606 3300025912 Bacteria 3412
175 Ga0207707_10399756 3300025912 Bacteria 1180
176 Ga0207695_10024793 3300025913 Bacteria 6734
177 Ga0207695_10275508 3300025913 Bacteria 1577
178 Ga0207671_10058845 3300025914 Bacteria 2849
179 Ga0207660_10012572 3300025917 Bacteria 5544
180 Ga0207660_10017082 3300025917 Bacteria 4815
181 Ga0207657_10002976 3300025919 Bacteria 18168
182 Ga0207657_10011586 3300025919 Bacteria 8747
183 Ga0207657_10016273 3300025919 Bacteria 7177
184 Ga0207657_10020766 3300025919 Bacteria 6198
185 Ga0207649_10002986 3300025920 Bacteria 9319
186 Ga0207649_10097384 3300025920 Bacteria 1940
187 Ga0207652_10188989 3300025921 Bacteria 1852
188 Ga0207652_10357899 3300025921 Bacteria 1317
189 Ga0207652_10447007 3300025921 Bacteria 1165
190 Ga0207681_10000980 3300025923 Bacteria 18650
191 Ga0207681_10341162 3300025923 Bacteria 1197
192 Ga0207694_10019750 3300025924 Bacteria 5096
193 Ga0207694_10327980 3300025924 Bacteria 1264
194 Ga0207650_10000537 3300025925 Bacteria 30997
195 Ga0207650_10032747 3300025925 Bacteria 3760
196 Ga0207650_10102570 3300025925 Bacteria 2205
197 Ga0207650_10129722 3300025925 Bacteria 1972
198 Ga0207659_10002931 3300025926 Bacteria 10163
199 Ga0207659_10130595 3300025926 Bacteria 1938
200 Ga0207687_10348334 3300025927 Unclassified 1206
201 Ga0207687_10388134 3300025927 Bacteria 1146
202 Ga0207644_10067505 3300025931 Bacteria 2606
203 Ga0207690_10005072 3300025932 Bacteria 7778
204 Ga0207690_10011855 3300025932 Bacteria 5212
205 Ga0207690_10194661 3300025932 Bacteria 1535
206 Ga0207690_10573327 3300025932 Bacteria 919
207 Ga0207706_10000415 3300025933 Bacteria 45662
208 Ga0207706_10004027 3300025933 Bacteria 13904
209 Ga0207706_10088338 3300025933 Bacteria 2725
210 Ga0207706_10265119 3300025933 Bacteria 1499
211 Ga0207686_10059227 3300025934 Bacteria 2418
212 Ga0207669_10004417 3300025937 Bacteria 6189
213 Ga0207669_10039435 3300025937 Bacteria 2729
214 Ga0207669_10054331 3300025937 Bacteria 2419
215 Ga0207704_10154056 3300025938 Bacteria 1626
216 Ga0207704_10301839 3300025938 Bacteria 1227
217 Ga0207691_10006421 3300025940 Bacteria 11361
218 Ga0207691_10016586 3300025940 Bacteria 6992
219 Ga0207711_10023918 3300025941 Bacteria 5113
220 Ga0207711_10585925 3300025941 Bacteria 1040
221 Ga0207661_10054698 3300025944 Bacteria 3198
222 Ga0207679_10011209 3300025945 Bacteria 5793
223 Ga0207679_10022262 3300025945 Bacteria 4313
224 Ga0207667_10014151 3300025949 Bacteria 9107
225 Ga0207667_10054377 3300025949 Bacteria 4211
226 Ga0207667_10352217 3300025949 Bacteria 1501
227 Ga0207651_10017730 3300025960 Bacteria 4214
228 Ga0207651_10178213 3300025960 Bacteria 1683
229 Ga0207651_10457886 3300025960 Bacteria 1095
230 Ga0207712_10049689 3300025961 Bacteria 2924
231 Ga0207712_10085588 3300025961 Bacteria 2308
232 Ga0207668_10001025 3300025972 Bacteria 16716
233 Ga0207668_10087397 3300025972 Bacteria 2280
234 Ga0207668_10109279 3300025972 Bacteria 2071
235 Ga0207668_10111464 3300025972 Bacteria 2054
236 Ga0207668_10248304 3300025972 Bacteria 1444
237 Ga0207640_10003332 3300025981 Bacteria 8655
238 Ga0207640_10009141 3300025981 Bacteria 5535
239 Ga0207640_10145199 3300025981 Bacteria 1735
240 Ga0207640_10243261 3300025981 Bacteria 1392
241 Ga0207640_10402570 3300025981 Bacteria 1115
242 Ga0207658_10001752 3300025986 Bacteria 16336
243 Ga0207658_10021251 3300025986 Bacteria 4502
244 Ga0207658_10520227 3300025986 Bacteria 1062
245 Ga0207677_10004923 3300026023 Bacteria 7211
246 Ga0207677_10261363 3300026023 Unclassified 1411
247 Ga0207703_10002285 3300026035 Bacteria 16709
248 Ga0207639_10002465 3300026041 Bacteria 12409
249 Ga0207639_10396623 3300026041 Bacteria 1242
250 Ga0207678_10016862 3300026067 Bacteria 6413
251 Ga0207678_10167688 3300026067 Bacteria 1875
252 Ga0207678_10475773 3300026067 Bacteria 1087
253 Ga0207702_10021273 3300026078 Bacteria 5368
254 Ga0207641_10414749 3300026088 Bacteria 1295
255 Ga0207648_10003316 3300026089 Bacteria 16906
256 Ga0207648_10003663 3300026089 Bacteria 16080
257 Ga0207648_10045770 3300026089 Bacteria 3837
258 Ga0207676_10145910 3300026095 Bacteria 2032
259 Ga0207676_10166986 3300026095 Bacteria 1913
260 Ga0207676_10305558 3300026095 Bacteria 1454
261 Ga0207674_10001374 3300026116 Bacteria 31441
262 Ga0207675_100005627 3300026118 Bacteria 11998
263 Ga0207683_10002725 3300026121 Bacteria 15428
264 Ga0207683_10006055 3300026121 Bacteria 10355
265 Ga0207683_10054989 3300026121 Bacteria 3491
266 Ga0207683_10091544 3300026121 Bacteria 2709
267 Ga0207683_10259742 3300026121 Bacteria 1586
268 Ga0207698_10008759 3300026142 Bacteria 6417
269 Ga0207698_10014237 3300026142 Bacteria 5281
270 Ga0207698_10089741 3300026142 Bacteria 2511
271 Ga0207698_10448408 3300026142 Bacteria 1245
272 Ga0207698_10530222 3300026142 Bacteria 1151
273 Ga0207428_10172169 3300027907 Bacteria 1639
274 Ga0268266_10020608 3300028379 Bacteria 5617
275 Ga0268265_10002664 3300028380 Bacteria 13238
276 Ga0268265_10012275 3300028380 Bacteria 5806
277 Ga0268265_10118260 3300028380 Bacteria 2178
278 Ga0268264_10017043 3300028381 Bacteria 5949
279 Ga0268264_10069400 3300028381 Bacteria 2980
280 Ga0268264_10073602 3300028381 Bacteria 2900
281 Ga0268264_10226028 3300028381 Bacteria 1725
282 Ga0268264_10250653 3300028381 Bacteria 1645
283 Ga0307408_100038799 3300031548 Bacteria 3362
284 Ga0307408_100209281 3300031548 Bacteria 1584
285 Ga0307408_100240622 3300031548 Bacteria 1487
286 Ga0307405_10006410 3300031731 Bacteria 5786
287 Ga0307405_10083241 3300031731 Bacteria 2097
288 Ga0307405_10096635 3300031731 Bacteria 1970
289 Ga0307405_10231923 3300031731 Bacteria 1361
290 Ga0307413_10058691 3300031824 Bacteria 2360
291 Ga0307413_10067269 3300031824 Bacteria 2239
292 Ga0307413_10079261 3300031824 Bacteria 2099
293 Ga0307413_10116274 3300031824 Bacteria 1801
294 Ga0307410_10018037 3300031852 Bacteria 4255
295 Ga0307410_10282415 3300031852 Bacteria 1303
296 Ga0307410_10357608 3300031852 Bacteria 1168
297 Ga0307410_10387993 3300031852 Bacteria 1125
298 Ga0307406_10007147 3300031901 Bacteria 6184
299 Ga0307406_10073463 3300031901 Bacteria 2249
300 Ga0307406_10122698 3300031901 Bacteria 1809
301 Ga0307406_10124308 3300031901 Bacteria 1799
302 Ga0307406_10204124 3300031901 Bacteria 1457
303 Ga0307407_10003932 3300031903 Bacteria 6203
304 Ga0307407_10022929 3300031903 Bacteria 3248
305 Ga0307407_10031419 3300031903 Bacteria 2875
306 Ga0307407_10341561 3300031903 Bacteria 1057
307 Ga0307412_10043475 3300031911 Bacteria 2925
308 Ga0307412_10117246 3300031911 Bacteria 1911
309 Ga0307409_100017544 3300031995 Bacteria 4776
310 Ga0307409_100071372 3300031995 Bacteria 2761
311 Ga0307409_100096516 3300031995 Bacteria 2439
312 Ga0307409_100272586 3300031995 Bacteria 1559
313 Ga0307409_100588291 3300031995 Bacteria 1098
314 Ga0307409_100592003 3300031995 Unclassified 1095
315 Ga0307416_100018282 3300032002 Bacteria 4933
316 Ga0307416_100053576 3300032002 Bacteria 3237
317 Ga0307416_100108995 3300032002 Bacteria 2434
318 Ga0307416_100181491 3300032002 Bacteria 1973
319 Ga0307416_100201263 3300032002 Bacteria 1890
320 Ga0307416_100297325 3300032002 Bacteria 1602
321 Ga0307414_10049847 3300032004 Bacteria 2897
322 Ga0307414_10114420 3300032004 Bacteria 2061
323 Ga0307414_10132973 3300032004 Bacteria 1934
324 Ga0307414_10150983 3300032004 Bacteria 1833
325 Ga0307414_10251046 3300032004 Bacteria 1470
326 Ga0307411_10015293 3300032005 Bacteria 4304
327 Ga0307411_10015390 3300032005 Bacteria 4295
328 Ga0307411_10018070 3300032005 Bacteria 4036
329 Ga0307415_100028381 3300032126 Bacteria 3559
330 Ga0307415_100034428 3300032126 Bacteria 3298
331 Ga0307415_100052758 3300032126 Bacteria 2767
332 Ga0307415_100055739 3300032126 Bacteria 2706
333 Ga0307415_100059713 3300032126 Bacteria 2631
334 Ga0373931_0034411 3300035691 Bacteria 2630
335 Ga0395899_0040723 3300037312 Bacteria 3474
336 Ga0395899_0096667 3300037312 Bacteria 2135
337 Ga0395899_0130997 3300037312 Bacteria 1790
338 Ga0395900_0018045 3300037418 Bacteria 7203
339 Ga0395900_0306173 3300037418 Unclassified 1573
340 Ga0395898_0019810 3300037466 Bacteria 6841
341 Ga0395905_0005612 3300037471 Bacteria 12773
342 Ga0395905_0061034 3300037471 Bacteria 3525
343 Ga0395905_0159350 3300037471 Bacteria 2121
344 Ga0395905_0178515 3300037471 Bacteria 1993
345 Ga0395905_0431229 3300037471 Bacteria 1215
346 Ga0395901_0047669 3300038443 Bacteria 4448
347 Ga0395901_0072620 3300038443 Bacteria 3587
348 Ga0395901_0353161 3300038443 Bacteria 1517
349 Ga0395901_0436685 3300038443 Bacteria 1340
350 Ga0439445_0000177 3300042004 Bacteria 11327
351 Ga0466969_0117109 3300044656 Bacteria 1243
352 Ga0466972_0124463 3300044658 Bacteria 1215
353 Ga0466966_0098759 3300044684 Unclassified 1807
354 Ga0466963_0000677 3300044694 Bacteria 16540
355 Ga0466963_0052832 3300044694 Bacteria 2697
356 Ga0466963_0079472 3300044694 Bacteria 2219
357 Ga0466964_0053977 3300044706 Bacteria 1656
358 Ga0466970_0050850 3300044765 Bacteria 2211
359 Ga0466957_0000784 3300044842 Bacteria 16257
360 Ga0466957_0004343 3300044842 Bacteria 7876
361 Ga0466959_0349305 3300045049 Unclassified 1008
362 Ga0466958_0231570 3300045836 Bacteria 1180
363 Ga0466967_0000210 3300045976 Bacteria 24683
364 Ga0466967_0264415 3300045976 Bacteria 1646
365 Ga0495621_0010315 3300046539 Bacteria 2853
366 Ga0495669_0017748 3300046684 Bacteria 3056
367 Ga0495669_0044331 3300046684 Bacteria 1981
368 Ga0496102_0114084 3300048905 Bacteria 2521
369 Ga0496105_0047438 3300048908 Bacteria 3545
370 Ga0496106_0020518 3300048909 Bacteria 4905
371 Ga0496108_0001136 3300048911 Bacteria 20807
372 Ga0496109_0412733 3300048912 Bacteria 1276
373 Ga0496110_0459299 3300048913 Bacteria 1160
374 Ga0496112_0022605 3300048915 Bacteria 5995
375 Ga0496112_0277767 3300048915 Bacteria 1623
376 nmdc:mga08y16_365949_c1 3300050511 Unclassified 1480
377 nmdc:mga0a205_1780_c1 3300050515 Bacteria 18620

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0000677 Ga0466963_0000677_7301_8110 230
2 3300044706 Ga0466964_0053977 Ga0466964_0053977_346_1155 230
3 3300044842 Ga0466957_0000784 Ga0466957_0000784_4701_5510 230
4 3300045976 Ga0466967_0000210 Ga0466967_0000210_8042_8851 230
5 3300031852 Ga0307410_10282415 Ga0307410_102824152 234
6 3300044656 Ga0466969_0117109 Ga0466969_0117109_481_1227 235
7 3300005336 Ga0070680_100003482 Ga0070680_1000034826 239
8 3300005458 Ga0070681_10007779 Ga0070681_100077793 239
9 3300005614 Ga0068856_100053274 Ga0068856_1000532743 239
10 3300005616 Ga0068852_100044261 Ga0068852_1000442613 239
11 3300020069 Ga0197907_10854725 Ga0197907_108547252 239
12 3300025912 Ga0207707_10056606 Ga0207707_100566062 239
13 3300025913 Ga0207695_10275508 Ga0207695_102755082 239
14 3300025917 Ga0207660_10012572 Ga0207660_100125723 239
15 3300025921 Ga0207652_10447007 Ga0207652_104470072 239
16 3300025949 Ga0207667_10054377 Ga0207667_100543773 239
17 3300025981 Ga0207640_10003332 Ga0207640_100033323 239
18 3300026142 Ga0207698_10014237 Ga0207698_100142372 239
19 3300031548 Ga0307408_100038799 Ga0307408_1000387993 242
20 3300031731 Ga0307405_10006410 Ga0307405_100064103 242
21 3300031901 Ga0307406_10122698 Ga0307406_101226982 242
22 3300031995 Ga0307409_100272586 Ga0307409_1002725862 242
23 3300032002 Ga0307416_100108995 Ga0307416_1001089952 242
24 3300032004 Ga0307414_10150983 Ga0307414_101509832 242
25 3300032126 Ga0307415_100052758 Ga0307415_1000527583 242
26 3300037471 Ga0395905_0061034 Ga0395905_0061034_1499_2308 245
27 3300031731 Ga0307405_10083241 Ga0307405_100832412 248
28 3300031901 Ga0307406_10073463 Ga0307406_100734632 248
29 3300032002 Ga0307416_100181491 Ga0307416_1001814912 248
30 3300032126 Ga0307415_100055739 Ga0307415_1000557392 248
31 3300025972 Ga0207668_10248304 Ga0207668_102483042 249
32 3300025908 Ga0207643_10036646 Ga0207643_100366463 254
33 3300037312 Ga0395899_0130997 Ga0395899_0130997_344_1153 256
34 3300031548 Ga0307408_100209281 Ga0307408_1002092812 261
35 3300032004 Ga0307414_10114420 Ga0307414_101144202 261
36 3300005339 Ga0070660_100108670 Ga0070660_1001086701 264
37 3300005344 Ga0070661_100043091 Ga0070661_1000430912 264
38 3300005457 Ga0070662_100240439 Ga0070662_1002404392 264
39 3300005719 Ga0068861_100479648 Ga0068861_1004796482 264
40 3300005843 Ga0068860_100406029 Ga0068860_1004060292 264
41 3300026067 Ga0207678_10167688 Ga0207678_101676882 264
42 3300001979 JGI24740J21852_10023111 JGI24740J21852_100231112 265
43 3300002076 JGI24749J21850_1001908 JGI24749J21850_10019083 267
44 3300005293 Ga0065715_10000370 Ga0065715_1000037012 267
45 3300005327 Ga0070658_10008759 Ga0070658_100087592 267
46 3300005328 Ga0070676_10016546 Ga0070676_100165462 267
47 3300005328 Ga0070676_10041081 Ga0070676_100410812 267
48 3300005328 Ga0070676_10312801 Ga0070676_103128012 267
49 3300005330 Ga0070690_100030050 Ga0070690_1000300503 267
50 3300005331 Ga0070670_100001912 Ga0070670_10000191211 267
51 3300005331 Ga0070670_100074489 Ga0070670_1000744892 267
52 3300005333 Ga0070677_10000430 Ga0070677_100004304 267
53 3300005333 Ga0070677_10007722 Ga0070677_100077222 267
54 3300005334 Ga0068869_100170597 Ga0068869_1001705971 267
55 3300005335 Ga0070666_10020531 Ga0070666_100205313 267
56 3300005338 Ga0068868_100024470 Ga0068868_1000244704 267
57 3300005339 Ga0070660_100010351 Ga0070660_1000103515 267
58 3300005343 Ga0070687_100119259 Ga0070687_1001192591 267
59 3300005343 Ga0070687_100255353 Ga0070687_1002553532 267
60 3300005344 Ga0070661_100054212 Ga0070661_1000542122 267
61 3300005347 Ga0070668_100051558 Ga0070668_1000515582 267
62 3300005347 Ga0070668_100131984 Ga0070668_1001319842 267
63 3300005353 Ga0070669_100004727 Ga0070669_1000047273 267
64 3300005354 Ga0070675_100002570 Ga0070675_1000025703 267
65 3300005355 Ga0070671_100026544 Ga0070671_1000265442 267
66 3300005355 Ga0070671_100201070 Ga0070671_1002010702 267
67 3300005356 Ga0070674_100004207 Ga0070674_1000042073 267
68 3300005364 Ga0070673_100040621 Ga0070673_1000406213 267
69 3300005365 Ga0070688_100038914 Ga0070688_1000389142 267
70 3300005366 Ga0070659_100005748 Ga0070659_1000057483 267
71 3300005366 Ga0070659_100424270 Ga0070659_1004242702 267
72 3300005367 Ga0070667_100026584 Ga0070667_1000265843 267
73 3300005367 Ga0070667_100029828 Ga0070667_1000298283 267
74 3300005438 Ga0070701_10008008 Ga0070701_100080082 267
75 3300005440 Ga0070705_100169686 Ga0070705_1001696862 267
76 3300005455 Ga0070663_100015918 Ga0070663_1000159183 267
77 3300005455 Ga0070663_100134770 Ga0070663_1001347702 267
78 3300005456 Ga0070678_100043761 Ga0070678_1000437613 267
79 3300005456 Ga0070678_100492678 Ga0070678_1004926781 267
80 3300005457 Ga0070662_100001494 Ga0070662_10000149411 267
81 3300005457 Ga0070662_100192347 Ga0070662_1001923472 267
82 3300005458 Ga0070681_10599421 Ga0070681_105994211 267
83 3300005459 Ga0068867_100025668 Ga0068867_1000256683 267
84 3300005459 Ga0068867_100279971 Ga0068867_1002799711 267
85 3300005539 Ga0068853_100038037 Ga0068853_1000380373 267
86 3300005539 Ga0068853_100119528 Ga0068853_1001195282 267
87 3300005543 Ga0070672_100001865 Ga0070672_10000186511 267
88 3300005548 Ga0070665_100013752 Ga0070665_1000137522 267
89 3300005548 Ga0070665_100103745 Ga0070665_1001037452 267
90 3300005549 Ga0070704_100131850 Ga0070704_1001318502 267
91 3300005564 Ga0070664_100005105 Ga0070664_1000051056 267
92 3300005564 Ga0070664_100024952 Ga0070664_1000249522 267
93 3300005564 Ga0070664_100049560 Ga0070664_1000495602 267
94 3300005578 Ga0068854_100057755 Ga0068854_1000577553 267
95 3300005578 Ga0068854_100231797 Ga0068854_1002317972 267
96 3300005614 Ga0068856_100084778 Ga0068856_1000847783 267
97 3300005616 Ga0068852_100011308 Ga0068852_1000113084 267
98 3300005616 Ga0068852_100017152 Ga0068852_1000171523 267
99 3300005616 Ga0068852_100272397 Ga0068852_1002723972 267
100 3300005617 Ga0068859_100023440 Ga0068859_1000234403 267
101 3300005617 Ga0068859_100059253 Ga0068859_1000592534 267
102 3300005618 Ga0068864_100022334 Ga0068864_1000223346 267
103 3300005618 Ga0068864_100051759 Ga0068864_1000517592 267
104 3300005618 Ga0068864_100058612 Ga0068864_1000586122 267
105 3300005618 Ga0068864_100223266 Ga0068864_1002232662 267
106 3300005841 Ga0068863_100454547 Ga0068863_1004545472 267
107 3300005842 Ga0068858_100430987 Ga0068858_1004309872 267
108 3300005843 Ga0068860_100126561 Ga0068860_1001265612 267
109 3300005844 Ga0068862_100006881 Ga0068862_1000068816 267
110 3300006237 Ga0097621_100297181 Ga0097621_1002971812 267
111 3300006844 Ga0075428_100139177 Ga0075428_1001391772 267
112 3300006881 Ga0068865_100012328 Ga0068865_1000123283 267
113 3300006881 Ga0068865_100066306 Ga0068865_1000663062 267
114 3300006931 Ga0097620_100023440 Ga0097620_1000234403 267
115 3300006931 Ga0097620_100059254 Ga0097620_1000592541 267
116 3300009094 Ga0111539_10041388 Ga0111539_100413883 267
117 3300009098 Ga0105245_10003796 Ga0105245_100037962 267
118 3300009098 Ga0105245_10159328 Ga0105245_101593282 267
119 3300009098 Ga0105245_10172600 Ga0105245_101726002 267
120 3300009176 Ga0105242_10060809 Ga0105242_100608093 267
121 3300009551 Ga0105238_10035054 Ga0105238_100350542 267
122 3300009553 Ga0105249_10012562 Ga0105249_100125625 267
123 3300009553 Ga0105249_10146720 Ga0105249_101467202 267
124 3300010375 Ga0105239_10166072 Ga0105239_101660722 267
125 3300011119 Ga0105246_10079935 Ga0105246_100799352 267
126 3300013100 Ga0157373_10016531 Ga0157373_100165312 267
127 3300013100 Ga0157373_10239881 Ga0157373_102398812 267
128 3300013105 Ga0157369_10057400 Ga0157369_100574003 267
129 3300013105 Ga0157369_10533238 Ga0157369_105332382 267
130 3300013296 Ga0157374_10158695 Ga0157374_101586952 267
131 3300013306 Ga0163162_10055501 Ga0163162_100555012 267
132 3300013306 Ga0163162_10409322 Ga0163162_104093222 267
133 3300013308 Ga0157375_10169609 Ga0157375_101696092 267
134 3300014325 Ga0163163_10065730 Ga0163163_100657302 267
135 3300014326 Ga0157380_10001232 Ga0157380_100012323 267
136 3300014326 Ga0157380_10411220 Ga0157380_104112201 267
137 3300014326 Ga0157380_10664813 Ga0157380_106648132 267
138 3300014497 Ga0182008_10173726 Ga0182008_101737262 267
139 3300014745 Ga0157377_10009183 Ga0157377_100091832 267
140 3300014969 Ga0157376_10006900 Ga0157376_100069003 267
141 3300025315 Ga0207697_10003347 Ga0207697_100033473 267
142 3300025315 Ga0207697_10005604 Ga0207697_100056043 267
143 3300025321 Ga0207656_10014270 Ga0207656_100142703 267
144 3300025893 Ga0207682_10001260 Ga0207682_100012603 267
145 3300025893 Ga0207682_10005004 Ga0207682_100050043 267
146 3300025899 Ga0207642_10039499 Ga0207642_100394992 267
147 3300025901 Ga0207688_10022485 Ga0207688_100224853 267
148 3300025903 Ga0207680_10279527 Ga0207680_102795272 267
149 3300025904 Ga0207647_10184677 Ga0207647_101846772 267
150 3300025907 Ga0207645_10014115 Ga0207645_100141156 267
151 3300025909 Ga0207705_10034707 Ga0207705_100347072 267
152 3300025909 Ga0207705_10216204 Ga0207705_102162042 267
153 3300025912 Ga0207707_10399756 Ga0207707_103997562 267
154 3300025919 Ga0207657_10011586 Ga0207657_100115866 267
155 3300025919 Ga0207657_10016273 Ga0207657_100162733 267
156 3300025919 Ga0207657_10020766 Ga0207657_100207665 267
157 3300025920 Ga0207649_10097384 Ga0207649_100973842 267
158 3300025923 Ga0207681_10000980 Ga0207681_1000098015 267
159 3300025924 Ga0207694_10327980 Ga0207694_103279802 267
160 3300025925 Ga0207650_10000537 Ga0207650_1000053724 267
161 3300025925 Ga0207650_10032747 Ga0207650_100327472 267
162 3300025925 Ga0207650_10102570 Ga0207650_101025703 267
163 3300025925 Ga0207650_10129722 Ga0207650_101297222 267
164 3300025926 Ga0207659_10002931 Ga0207659_100029317 267
165 3300025926 Ga0207659_10130595 Ga0207659_101305952 267
166 3300025927 Ga0207687_10348334 Ga0207687_103483341 267
167 3300025927 Ga0207687_10388134 Ga0207687_103881342 267
168 3300025931 Ga0207644_10067505 Ga0207644_100675052 267
169 3300025932 Ga0207690_10011855 Ga0207690_100118552 267
170 3300025932 Ga0207690_10194661 Ga0207690_101946611 267
171 3300025932 Ga0207690_10573327 Ga0207690_105733271 267
172 3300025933 Ga0207706_10000415 Ga0207706_1000041547 267
173 3300025933 Ga0207706_10004027 Ga0207706_100040273 267
174 3300025933 Ga0207706_10088338 Ga0207706_100883382 267
175 3300025934 Ga0207686_10059227 Ga0207686_100592272 267
176 3300025937 Ga0207669_10004417 Ga0207669_100044174 267
177 3300025937 Ga0207669_10039435 Ga0207669_100394353 267
178 3300025937 Ga0207669_10054331 Ga0207669_100543312 267
179 3300025938 Ga0207704_10154056 Ga0207704_101540562 267
180 3300025938 Ga0207704_10301839 Ga0207704_103018392 267
181 3300025940 Ga0207691_10006421 Ga0207691_100064213 267
182 3300025940 Ga0207691_10016586 Ga0207691_100165863 267
183 3300025941 Ga0207711_10023918 Ga0207711_100239183 267
184 3300025945 Ga0207679_10011209 Ga0207679_100112095 267
185 3300025945 Ga0207679_10022262 Ga0207679_100222622 267
186 3300025949 Ga0207667_10352217 Ga0207667_103522172 267
187 3300025960 Ga0207651_10017730 Ga0207651_100177303 267
188 3300025960 Ga0207651_10457886 Ga0207651_104578861 267
189 3300025961 Ga0207712_10049689 Ga0207712_100496892 267
190 3300025961 Ga0207712_10085588 Ga0207712_100855882 267
191 3300025972 Ga0207668_10001025 Ga0207668_1000102513 267
192 3300025972 Ga0207668_10087397 Ga0207668_100873972 267
193 3300025981 Ga0207640_10243261 Ga0207640_102432612 267
194 3300025981 Ga0207640_10402570 Ga0207640_104025702 267
195 3300025986 Ga0207658_10520227 Ga0207658_105202271 267
196 3300026023 Ga0207677_10261363 Ga0207677_102613632 267
197 3300026041 Ga0207639_10396623 Ga0207639_103966232 267
198 3300026089 Ga0207648_10003316 Ga0207648_1000331613 267
199 3300026089 Ga0207648_10003663 Ga0207648_100036639 267
200 3300026089 Ga0207648_10045770 Ga0207648_100457703 267
201 3300026095 Ga0207676_10145910 Ga0207676_101459102 267
202 3300026095 Ga0207676_10166986 Ga0207676_101669862 267
203 3300026118 Ga0207675_100005627 Ga0207675_1000056272 267
204 3300026121 Ga0207683_10002725 Ga0207683_1000272513 267
205 3300026121 Ga0207683_10006055 Ga0207683_100060556 267
206 3300026121 Ga0207683_10091544 Ga0207683_100915442 267
207 3300026142 Ga0207698_10089741 Ga0207698_100897412 267
208 3300026142 Ga0207698_10448408 Ga0207698_104484082 267
209 3300026142 Ga0207698_10530222 Ga0207698_105302222 267
210 3300027907 Ga0207428_10172169 Ga0207428_101721692 267
211 3300028379 Ga0268266_10020608 Ga0268266_100206085 267
212 3300028381 Ga0268264_10017043 Ga0268264_100170434 267
213 3300028381 Ga0268264_10073602 Ga0268264_100736022 267
214 3300031548 Ga0307408_100240622 Ga0307408_1002406222 267
215 3300031731 Ga0307405_10231923 Ga0307405_102319232 267
216 3300031824 Ga0307413_10067269 Ga0307413_100672692 267
217 3300031824 Ga0307413_10079261 Ga0307413_100792612 267
218 3300031852 Ga0307410_10018037 Ga0307410_100180373 267
219 3300031901 Ga0307406_10007147 Ga0307406_100071475 267
220 3300031903 Ga0307407_10022929 Ga0307407_100229292 267
221 3300031911 Ga0307412_10117246 Ga0307412_101172462 267
222 3300031995 Ga0307409_100017544 Ga0307409_1000175442 267
223 3300031995 Ga0307409_100071372 Ga0307409_1000713722 267
224 3300032002 Ga0307416_100018282 Ga0307416_1000182825 267
225 3300032005 Ga0307411_10015390 Ga0307411_100153902 267
226 3300032126 Ga0307415_100059713 Ga0307415_1000597132 267
227 3300035691 Ga0373931_0034411 Ga0373931_0034411_1431_2249 267
228 3300037471 Ga0395905_0178515 Ga0395905_0178515_696_1508 267
229 3300038443 Ga0395901_0353161 Ga0395901_0353161_477_1289 267
230 3300044684 Ga0466966_0098759 Ga0466966_0098759_252_1064 267
231 3300044694 Ga0466963_0052832 Ga0466963_0052832_836_1648 267
232 3300044842 Ga0466957_0004343 Ga0466957_0004343_5862_6674 267
233 3300045049 Ga0466959_0349305 Ga0466959_0349305_80_892 267
234 3300045836 Ga0466958_0231570 Ga0466958_0231570_161_973 267
235 3300045976 Ga0466967_0264415 Ga0466967_0264415_535_1347 267
236 3300046539 Ga0495621_0010315 Ga0495621_0010315_283_1086 267
237 3300046684 Ga0495669_0044331 Ga0495669_0044331_339_1142 267
238 3300048905 Ga0496102_0114084 Ga0496102_0114084_871_1683 267
239 3300048908 Ga0496105_0047438 Ga0496105_0047438_564_1376 267
240 3300048909 Ga0496106_0020518 Ga0496106_0020518_2324_3136 267
241 3300048912 Ga0496109_0412733 Ga0496109_0412733_19_831 267
242 3300048913 Ga0496110_0459299 Ga0496110_0459299_232_1044 267
243 3300048915 Ga0496112_0022605 Ga0496112_0022605_3824_4642 267
244 3300048915 Ga0496112_0277767 Ga0496112_0277767_532_1344 267
245 3300050511 nmdc:mga08y16_365949_c1 nmdc:mga08y16_365949_c1_575_1378 267
246 3300005338 Ga0068868_100100873 Ga0068868_1001008732 268
247 3300005344 Ga0070661_100385699 Ga0070661_1003856992 268
248 3300005364 Ga0070673_100184496 Ga0070673_1001844962 268
249 3300005367 Ga0070667_100031826 Ga0070667_1000318262 268
250 3300005543 Ga0070672_100095546 Ga0070672_1000955462 268
251 3300005548 Ga0070665_100583489 Ga0070665_1005834892 268
252 3300005578 Ga0068854_100142226 Ga0068854_1001422262 268
253 3300005616 Ga0068852_100159078 Ga0068852_1001590781 268
254 3300005841 Ga0068863_100177214 Ga0068863_1001772142 268
255 3300005843 Ga0068860_100102948 Ga0068860_1001029482 268
256 3300005844 Ga0068862_100008099 Ga0068862_1000080993 268
257 3300006358 Ga0068871_100017020 Ga0068871_1000170203 268
258 3300006852 Ga0075433_10059602 Ga0075433_100596022 268
259 3300009098 Ga0105245_10058496 Ga0105245_100584962 268
260 3300009174 Ga0105241_10115936 Ga0105241_101159362 268
261 3300013308 Ga0157375_10392549 Ga0157375_103925492 268
262 3300025960 Ga0207651_10178213 Ga0207651_101782132 268
263 3300025972 Ga0207668_10109279 Ga0207668_101092792 268
264 3300025981 Ga0207640_10145199 Ga0207640_101451992 268
265 3300025986 Ga0207658_10021251 Ga0207658_100212512 268
266 3300026023 Ga0207677_10004923 Ga0207677_100049236 268
267 3300026035 Ga0207703_10002285 Ga0207703_1000228513 268
268 3300026067 Ga0207678_10475773 Ga0207678_104757732 268
269 3300026088 Ga0207641_10414749 Ga0207641_104147492 268
270 3300026121 Ga0207683_10054989 Ga0207683_100549892 268
271 3300028380 Ga0268265_10002664 Ga0268265_100026648 268
272 3300028380 Ga0268265_10012275 Ga0268265_100122755 268
273 3300028381 Ga0268264_10069400 Ga0268264_100694002 268
274 3300028381 Ga0268264_10250653 Ga0268264_102506532 268
275 3300031824 Ga0307413_10058691 Ga0307413_100586912 268
276 3300031852 Ga0307410_10357608 Ga0307410_103576082 268
277 3300031903 Ga0307407_10003932 Ga0307407_100039326 268
278 3300031903 Ga0307407_10031419 Ga0307407_100314192 268
279 3300031911 Ga0307412_10043475 Ga0307412_100434753 268
280 3300031995 Ga0307409_100096516 Ga0307409_1000965162 268
281 3300031995 Ga0307409_100592003 Ga0307409_1005920032 268
282 3300032002 Ga0307416_100053576 Ga0307416_1000535763 268
283 3300032004 Ga0307414_10049847 Ga0307414_100498473 268
284 3300032005 Ga0307411_10015293 Ga0307411_100152932 268
285 3300032005 Ga0307411_10018070 Ga0307411_100180702 268
286 3300032126 Ga0307415_100028381 Ga0307415_1000283812 268
287 3300042004 Ga0439445_0000177 Ga0439445_0000177_4108_4914 268
288 3300050515 nmdc:mga0a205_1780_c1 nmdc:mga0a205_1780_c1_15057_15863 268
289 3300001979 JGI24740J21852_10007059 JGI24740J21852_100070594 269
290 3300002067 JGI24735J21928_10020098 JGI24735J21928_100200982 269
291 3300005327 Ga0070658_10013320 Ga0070658_100133203 269
292 3300005329 Ga0070683_100053787 Ga0070683_1000537872 269
293 3300005336 Ga0070680_100026291 Ga0070680_1000262913 269
294 3300005339 Ga0070660_100115074 Ga0070660_1001150742 269
295 3300005341 Ga0070691_10019274 Ga0070691_100192743 269
296 3300005344 Ga0070661_100015051 Ga0070661_1000150512 269
297 3300005355 Ga0070671_100005670 Ga0070671_1000056708 269
298 3300005435 Ga0070714_100100298 Ga0070714_1001002982 269
299 3300005455 Ga0070663_100018631 Ga0070663_1000186312 269
300 3300005455 Ga0070663_100136259 Ga0070663_1001362592 269
301 3300005457 Ga0070662_100205991 Ga0070662_1002059912 269
302 3300005457 Ga0070662_100316825 Ga0070662_1003168252 269
303 3300005530 Ga0070679_100490117 Ga0070679_1004901171 269
304 3300005535 Ga0070684_100009366 Ga0070684_1000093665 269
305 3300005539 Ga0068853_100021692 Ga0068853_1000216922 269
306 3300005564 Ga0070664_100004639 Ga0070664_1000046395 269
307 3300005577 Ga0068857_100014587 Ga0068857_1000145874 269
308 3300005578 Ga0068854_100009383 Ga0068854_1000093832 269
309 3300005834 Ga0068851_10016793 Ga0068851_100167932 269
310 3300005843 Ga0068860_100217294 Ga0068860_1002172942 269
311 3300005844 Ga0068862_100048076 Ga0068862_1000480762 269
312 3300009093 Ga0105240_10041798 Ga0105240_100417982 269
313 3300009177 Ga0105248_10024379 Ga0105248_100243792 269
314 3300009545 Ga0105237_10034968 Ga0105237_100349684 269
315 3300009551 Ga0105238_10011752 Ga0105238_100117526 269
316 3300013100 Ga0157373_10013649 Ga0157373_100136492 269
317 3300013102 Ga0157371_10066835 Ga0157371_100668352 269
318 3300013104 Ga0157370_10018022 Ga0157370_100180223 269
319 3300013307 Ga0157372_10029222 Ga0157372_100292223 269
320 3300025321 Ga0207656_10012915 Ga0207656_100129152 269
321 3300025904 Ga0207647_10007040 Ga0207647_100070407 269
322 3300025909 Ga0207705_10013751 Ga0207705_100137514 269
323 3300025909 Ga0207705_10052239 Ga0207705_100522392 269
324 3300025913 Ga0207695_10024793 Ga0207695_100247933 269
325 3300025914 Ga0207671_10058845 Ga0207671_100588452 269
326 3300025917 Ga0207660_10017082 Ga0207660_100170824 269
327 3300025919 Ga0207657_10002976 Ga0207657_1000297618 269
328 3300025920 Ga0207649_10002986 Ga0207649_100029865 269
329 3300025921 Ga0207652_10188989 Ga0207652_101889892 269
330 3300025921 Ga0207652_10357899 Ga0207652_103578992 269
331 3300025923 Ga0207681_10341162 Ga0207681_103411622 269
332 3300025924 Ga0207694_10019750 Ga0207694_100197502 269
333 3300025932 Ga0207690_10005072 Ga0207690_100050722 269
334 3300025933 Ga0207706_10265119 Ga0207706_102651192 269
335 3300025941 Ga0207711_10585925 Ga0207711_105859252 269
336 3300025944 Ga0207661_10054698 Ga0207661_100546982 269
337 3300025949 Ga0207667_10014151 Ga0207667_100141512 269
338 3300025972 Ga0207668_10111464 Ga0207668_101114642 269
339 3300025981 Ga0207640_10009141 Ga0207640_100091415 269
340 3300025986 Ga0207658_10001752 Ga0207658_1000175213 269
341 3300026041 Ga0207639_10002465 Ga0207639_100024654 269
342 3300026067 Ga0207678_10016862 Ga0207678_100168626 269
343 3300026078 Ga0207702_10021273 Ga0207702_100212735 269
344 3300026095 Ga0207676_10305558 Ga0207676_103055582 269
345 3300026116 Ga0207674_10001374 Ga0207674_1000137421 269
346 3300026121 Ga0207683_10259742 Ga0207683_102597422 269
347 3300026142 Ga0207698_10008759 Ga0207698_100087595 269
348 3300028380 Ga0268265_10118260 Ga0268265_101182602 269
349 3300028381 Ga0268264_10226028 Ga0268264_102260282 269
350 3300031731 Ga0307405_10096635 Ga0307405_100966352 269
351 3300031824 Ga0307413_10116274 Ga0307413_101162742 269
352 3300031852 Ga0307410_10387993 Ga0307410_103879931 269
353 3300031901 Ga0307406_10124308 Ga0307406_101243082 269
354 3300031901 Ga0307406_10204124 Ga0307406_102041242 269
355 3300031903 Ga0307407_10341561 Ga0307407_103415612 269
356 3300031995 Ga0307409_100588291 Ga0307409_1005882911 269
357 3300032002 Ga0307416_100201263 Ga0307416_1002012632 269
358 3300032002 Ga0307416_100297325 Ga0307416_1002973252 269
359 3300032004 Ga0307414_10132973 Ga0307414_101329732 269
360 3300032004 Ga0307414_10251046 Ga0307414_102510462 269
361 3300032126 Ga0307415_100034428 Ga0307415_1000344282 269
362 3300037312 Ga0395899_0040723 Ga0395899_0040723_2224_3033 269
363 3300037312 Ga0395899_0096667 Ga0395899_0096667_733_1542 269
364 3300037418 Ga0395900_0018045 Ga0395900_0018045_2756_3565 269
365 3300037418 Ga0395900_0306173 Ga0395900_0306173_180_989 269
366 3300037466 Ga0395898_0019810 Ga0395898_0019810_1061_1870 269
367 3300037471 Ga0395905_0005612 Ga0395905_0005612_8149_8958 269
368 3300037471 Ga0395905_0159350 Ga0395905_0159350_380_1189 269
369 3300037471 Ga0395905_0431229 Ga0395905_0431229_371_1180 269
370 3300038443 Ga0395901_0047669 Ga0395901_0047669_315_1124 269
371 3300038443 Ga0395901_0072620 Ga0395901_0072620_1525_2334 269
372 3300038443 Ga0395901_0436685 Ga0395901_0436685_368_1177 269
373 3300044658 Ga0466972_0124463 Ga0466972_0124463_63_872 269
374 3300044694 Ga0466963_0079472 Ga0466963_0079472_83_892 269
375 3300044765 Ga0466970_0050850 Ga0466970_0050850_1375_2184 269
376 3300046684 Ga0495669_0017748 Ga0495669_0017748_153_962 269
377 3300048911 Ga0496108_0001136 Ga0496108_0001136_16180_16992 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

79

154

0.94

PF08544

GHMP_kinases_C

GHMP kinases C terminal

203

274

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ww4-assembly1.cif.gz_B a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase 0.8674 2 266
1uek-assembly1.cif.gz_A crystal structure of 4-(cytidine 5'-diphospho)-2c-methyl-d-erythritol kinase 0.8567 4 268
4ed4-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp 0.8559 3 269
2ww4-assembly1.cif.gz_B a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase 0.8528 2 266
4ed4-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp 0.847 3 269
ID Description Score Start End Superfamily
af_Q8S2G0_72_245_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9144 1 159 3.30.230.10
4dxlA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.904 2 159 3.30.230.10
2v2qB01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8841 1 159 3.30.230.10
2v2qB01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8789 1 159 3.30.230.10
af_Q2G0S8_1_157_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8656 1 158 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A239H5K7-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9775 46 269 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A7C1UHK2-F1-model_v4 4-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase 0.9763 2 102 GO:0050515
AF-A0A520Y9U1-F1-model_v4 4-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase 0.975 98 269 GO:0005524
GO:0050515
AF-A0A838VA13-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9712 4 269 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A520Y9U1-F1-model_v4 4-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase 0.964 98 269 GO:0005524
GO:0050515

Feature Viewer

pLDDT pTM Quality
94.54 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map