F427719
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 377 | 179 | 377 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300025940|Ga0207691_10016586|Ga0207691_100165863 |
| Length | 280 |
| Sequence | VHHFDSASRALSARSSEFAPAKLNLALHVRGKLLDGRHAIETIFAFCTDGDRLSGEVVDDGRLELETSGDFARDLGDQNLITMAAIALRAAAGVYAGAALTLDKRLPVAAGLGGGSADAAAALRLLTSIWSIDPAHAEAVAPKLGSDVPACLLSLPMRGEGAGDQLTPADLADLSGTPVLLVNPRVALSTADVFARWDGVDRGPLGYWREGRNDLEAPATALVPQIEAVLAFLATRPGATFSRMSGSGATCFALFDSEGARDNAAHHVPREWWHLATYLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 141 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 143 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 144 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 145 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 152 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 157 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 158 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 159 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 160 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 161 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 162 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 163 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 164 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 165 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 169 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 178 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.73 |
| Metatranscriptomes | 0.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.12 |
| Rhizosphere | 97.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007059 | 3300001979 | Bacteria | 4603 |
| 2 | JGI24740J21852_10023111 | 3300001979 | Bacteria | 2129 |
| 3 | JGI24735J21928_10020098 | 3300002067 | Bacteria | 2048 |
| 4 | JGI24749J21850_1001908 | 3300002076 | Bacteria | 2945 |
| 5 | Ga0065715_10000370 | 3300005293 | Bacteria | 13372 |
| 6 | Ga0070658_10008759 | 3300005327 | Bacteria | 8129 |
| 7 | Ga0070658_10013320 | 3300005327 | Bacteria | 6598 |
| 8 | Ga0070676_10016546 | 3300005328 | Bacteria | 4079 |
| 9 | Ga0070676_10041081 | 3300005328 | Bacteria | 2680 |
| 10 | Ga0070676_10312801 | 3300005328 | Bacteria | 1068 |
| 11 | Ga0070683_100053787 | 3300005329 | Bacteria | 3731 |
| 12 | Ga0070690_100030050 | 3300005330 | Bacteria | 3374 |
| 13 | Ga0070670_100001912 | 3300005331 | Bacteria | 17058 |
| 14 | Ga0070670_100074489 | 3300005331 | Bacteria | 2916 |
| 15 | Ga0070677_10000430 | 3300005333 | Bacteria | 14476 |
| 16 | Ga0070677_10007722 | 3300005333 | Bacteria | 3602 |
| 17 | Ga0068869_100170597 | 3300005334 | Bacteria | 1699 |
| 18 | Ga0070666_10020531 | 3300005335 | Bacteria | 4271 |
| 19 | Ga0070680_100003482 | 3300005336 | Bacteria | 11750 |
| 20 | Ga0070680_100026291 | 3300005336 | Bacteria | 4654 |
| 21 | Ga0068868_100024470 | 3300005338 | Bacteria | 4582 |
| 22 | Ga0068868_100100873 | 3300005338 | Bacteria | 2335 |
| 23 | Ga0070660_100010351 | 3300005339 | Bacteria | 6589 |
| 24 | Ga0070660_100108670 | 3300005339 | Bacteria | 2204 |
| 25 | Ga0070660_100115074 | 3300005339 | Bacteria | 2143 |
| 26 | Ga0070691_10019274 | 3300005341 | Bacteria | 3147 |
| 27 | Ga0070687_100119259 | 3300005343 | Bacteria | 1506 |
| 28 | Ga0070687_100255353 | 3300005343 | Unclassified | 1091 |
| 29 | Ga0070661_100015051 | 3300005344 | Bacteria | 5456 |
| 30 | Ga0070661_100043091 | 3300005344 | Bacteria | 3296 |
| 31 | Ga0070661_100054212 | 3300005344 | Bacteria | 2936 |
| 32 | Ga0070661_100385699 | 3300005344 | Bacteria | 1105 |
| 33 | Ga0070668_100051558 | 3300005347 | Bacteria | 3171 |
| 34 | Ga0070668_100131984 | 3300005347 | Bacteria | 2005 |
| 35 | Ga0070669_100004727 | 3300005353 | Bacteria | 9817 |
| 36 | Ga0070675_100002570 | 3300005354 | Bacteria | 13593 |
| 37 | Ga0070671_100005670 | 3300005355 | Bacteria | 9937 |
| 38 | Ga0070671_100026544 | 3300005355 | Bacteria | 4760 |
| 39 | Ga0070671_100201070 | 3300005355 | Bacteria | 1689 |
| 40 | Ga0070674_100004207 | 3300005356 | Bacteria | 8176 |
| 41 | Ga0070673_100040621 | 3300005364 | Bacteria | 3570 |
| 42 | Ga0070673_100184496 | 3300005364 | Bacteria | 1788 |
| 43 | Ga0070688_100038914 | 3300005365 | Bacteria | 2908 |
| 44 | Ga0070659_100005748 | 3300005366 | Bacteria | 8926 |
| 45 | Ga0070659_100424270 | 3300005366 | Bacteria | 1125 |
| 46 | Ga0070667_100026584 | 3300005367 | Bacteria | 4815 |
| 47 | Ga0070667_100029828 | 3300005367 | Bacteria | 4547 |
| 48 | Ga0070667_100031826 | 3300005367 | Bacteria | 4397 |
| 49 | Ga0070714_100100298 | 3300005435 | Bacteria | 2550 |
| 50 | Ga0070701_10008008 | 3300005438 | Bacteria | 4544 |
| 51 | Ga0070705_100169686 | 3300005440 | Bacteria | 1467 |
| 52 | Ga0070663_100015918 | 3300005455 | Bacteria | 4869 |
| 53 | Ga0070663_100018631 | 3300005455 | Bacteria | 4556 |
| 54 | Ga0070663_100134770 | 3300005455 | Bacteria | 1879 |
| 55 | Ga0070663_100136259 | 3300005455 | Bacteria | 1870 |
| 56 | Ga0070678_100043761 | 3300005456 | Bacteria | 3192 |
| 57 | Ga0070678_100492678 | 3300005456 | Unclassified | 1080 |
| 58 | Ga0070662_100001494 | 3300005457 | Bacteria | 14387 |
| 59 | Ga0070662_100192347 | 3300005457 | Bacteria | 1614 |
| 60 | Ga0070662_100205991 | 3300005457 | Bacteria | 1563 |
| 61 | Ga0070662_100240439 | 3300005457 | Bacteria | 1452 |
| 62 | Ga0070662_100316825 | 3300005457 | Bacteria | 1271 |
| 63 | Ga0070681_10007779 | 3300005458 | Bacteria | 10478 |
| 64 | Ga0070681_10599421 | 3300005458 | Bacteria | 1016 |
| 65 | Ga0068867_100025668 | 3300005459 | Bacteria | 4229 |
| 66 | Ga0068867_100279971 | 3300005459 | Bacteria | 1367 |
| 67 | Ga0070679_100490117 | 3300005530 | Bacteria | 1173 |
| 68 | Ga0070684_100009366 | 3300005535 | Bacteria | 7710 |
| 69 | Ga0068853_100021692 | 3300005539 | Bacteria | 5358 |
| 70 | Ga0068853_100038037 | 3300005539 | Bacteria | 4097 |
| 71 | Ga0068853_100119528 | 3300005539 | Bacteria | 2349 |
| 72 | Ga0070672_100001865 | 3300005543 | Bacteria | 13165 |
| 73 | Ga0070672_100095546 | 3300005543 | Bacteria | 2403 |
| 74 | Ga0070665_100013752 | 3300005548 | Bacteria | 8144 |
| 75 | Ga0070665_100103745 | 3300005548 | Bacteria | 2846 |
| 76 | Ga0070665_100583489 | 3300005548 | Bacteria | 1131 |
| 77 | Ga0070704_100131850 | 3300005549 | Bacteria | 1938 |
| 78 | Ga0070664_100004639 | 3300005564 | Bacteria | 11031 |
| 79 | Ga0070664_100005105 | 3300005564 | Bacteria | 10536 |
| 80 | Ga0070664_100024952 | 3300005564 | Bacteria | 4954 |
| 81 | Ga0070664_100049560 | 3300005564 | Bacteria | 3552 |
| 82 | Ga0068857_100014587 | 3300005577 | Bacteria | 6855 |
| 83 | Ga0068854_100009383 | 3300005578 | Bacteria | 6318 |
| 84 | Ga0068854_100057755 | 3300005578 | Bacteria | 2799 |
| 85 | Ga0068854_100142226 | 3300005578 | Bacteria | 1842 |
| 86 | Ga0068854_100231797 | 3300005578 | Bacteria | 1466 |
| 87 | Ga0068856_100053274 | 3300005614 | Bacteria | 3989 |
| 88 | Ga0068856_100084778 | 3300005614 | Bacteria | 3148 |
| 89 | Ga0068852_100011308 | 3300005616 | Bacteria | 6714 |
| 90 | Ga0068852_100017152 | 3300005616 | Bacteria | 5674 |
| 91 | Ga0068852_100044261 | 3300005616 | Bacteria | 3779 |
| 92 | Ga0068852_100159078 | 3300005616 | Bacteria | 2107 |
| 93 | Ga0068852_100272397 | 3300005616 | Bacteria | 1629 |
| 94 | Ga0068859_100023440 | 3300005617 | Bacteria | 6193 |
| 95 | Ga0068859_100059253 | 3300005617 | Bacteria | 3857 |
| 96 | Ga0068864_100022334 | 3300005618 | Bacteria | 5305 |
| 97 | Ga0068864_100051759 | 3300005618 | Bacteria | 3538 |
| 98 | Ga0068864_100058612 | 3300005618 | Bacteria | 3329 |
| 99 | Ga0068864_100223266 | 3300005618 | Bacteria | 1739 |
| 100 | Ga0068861_100479648 | 3300005719 | Bacteria | 1120 |
| 101 | Ga0068851_10016793 | 3300005834 | Bacteria | 3507 |
| 102 | Ga0068863_100177214 | 3300005841 | Bacteria | 2046 |
| 103 | Ga0068863_100454547 | 3300005841 | Bacteria | 1257 |
| 104 | Ga0068858_100430987 | 3300005842 | Bacteria | 1269 |
| 105 | Ga0068860_100102948 | 3300005843 | Bacteria | 2725 |
| 106 | Ga0068860_100126561 | 3300005843 | Bacteria | 2449 |
| 107 | Ga0068860_100217294 | 3300005843 | Bacteria | 1855 |
| 108 | Ga0068860_100406029 | 3300005843 | Bacteria | 1348 |
| 109 | Ga0068862_100006881 | 3300005844 | Bacteria | 9430 |
| 110 | Ga0068862_100008099 | 3300005844 | Bacteria | 8696 |
| 111 | Ga0068862_100048076 | 3300005844 | Bacteria | 3642 |
| 112 | Ga0097621_100297181 | 3300006237 | Bacteria | 1425 |
| 113 | Ga0068871_100017020 | 3300006358 | Bacteria | 5490 |
| 114 | Ga0075428_100139177 | 3300006844 | Bacteria | 2638 |
| 115 | Ga0075433_10059602 | 3300006852 | Bacteria | 3339 |
| 116 | Ga0068865_100012328 | 3300006881 | Bacteria | 5377 |
| 117 | Ga0068865_100066306 | 3300006881 | Bacteria | 2546 |
| 118 | Ga0097620_100023440 | 3300006931 | Bacteria | 6193 |
| 119 | Ga0097620_100059254 | 3300006931 | Bacteria | 3857 |
| 120 | Ga0105240_10041798 | 3300009093 | Bacteria | 5846 |
| 121 | Ga0111539_10041388 | 3300009094 | Bacteria | 5540 |
| 122 | Ga0105245_10003796 | 3300009098 | Bacteria | 13436 |
| 123 | Ga0105245_10058496 | 3300009098 | Bacteria | 3470 |
| 124 | Ga0105245_10159328 | 3300009098 | Bacteria | 2140 |
| 125 | Ga0105245_10172600 | 3300009098 | Bacteria | 2060 |
| 126 | Ga0105241_10115936 | 3300009174 | Bacteria | 2151 |
| 127 | Ga0105242_10060809 | 3300009176 | Bacteria | 3105 |
| 128 | Ga0105248_10024379 | 3300009177 | Bacteria | 6727 |
| 129 | Ga0105237_10034968 | 3300009545 | Bacteria | 5085 |
| 130 | Ga0105238_10011752 | 3300009551 | Bacteria | 8825 |
| 131 | Ga0105238_10035054 | 3300009551 | Bacteria | 5104 |
| 132 | Ga0105249_10012562 | 3300009553 | Bacteria | 7465 |
| 133 | Ga0105249_10146720 | 3300009553 | Bacteria | 2267 |
| 134 | Ga0105239_10166072 | 3300010375 | Bacteria | 2468 |
| 135 | Ga0105246_10079935 | 3300011119 | Bacteria | 2326 |
| 136 | Ga0157373_10013649 | 3300013100 | Bacteria | 5957 |
| 137 | Ga0157373_10016531 | 3300013100 | Bacteria | 5380 |
| 138 | Ga0157373_10239881 | 3300013100 | Bacteria | 1281 |
| 139 | Ga0157371_10066835 | 3300013102 | Bacteria | 2545 |
| 140 | Ga0157370_10018022 | 3300013104 | Bacteria | 7107 |
| 141 | Ga0157369_10057400 | 3300013105 | Bacteria | 4200 |
| 142 | Ga0157369_10533238 | 3300013105 | Bacteria | 1214 |
| 143 | Ga0157374_10158695 | 3300013296 | Bacteria | 2202 |
| 144 | Ga0163162_10055501 | 3300013306 | Bacteria | 3988 |
| 145 | Ga0163162_10409322 | 3300013306 | Bacteria | 1489 |
| 146 | Ga0157372_10029222 | 3300013307 | Bacteria | 6017 |
| 147 | Ga0157375_10169609 | 3300013308 | Bacteria | 2329 |
| 148 | Ga0157375_10392549 | 3300013308 | Bacteria | 1554 |
| 149 | Ga0163163_10065730 | 3300014325 | Bacteria | 3601 |
| 150 | Ga0157380_10001232 | 3300014326 | Bacteria | 16609 |
| 151 | Ga0157380_10411220 | 3300014326 | Bacteria | 1287 |
| 152 | Ga0157380_10664813 | 3300014326 | Bacteria | 1041 |
| 153 | Ga0182008_10173726 | 3300014497 | Bacteria | 1088 |
| 154 | Ga0157377_10009183 | 3300014745 | Bacteria | 4842 |
| 155 | Ga0157376_10006900 | 3300014969 | Bacteria | 8044 |
| 156 | Ga0197907_10854725 | 3300020069 | Bacteria | 2214 |
| 157 | Ga0207697_10003347 | 3300025315 | Bacteria | 7971 |
| 158 | Ga0207697_10005604 | 3300025315 | Bacteria | 5812 |
| 159 | Ga0207656_10012915 | 3300025321 | Bacteria | 3181 |
| 160 | Ga0207656_10014270 | 3300025321 | Bacteria | 3056 |
| 161 | Ga0207682_10001260 | 3300025893 | Bacteria | 11713 |
| 162 | Ga0207682_10005004 | 3300025893 | Bacteria | 5436 |
| 163 | Ga0207642_10039499 | 3300025899 | Bacteria | 2051 |
| 164 | Ga0207688_10022485 | 3300025901 | Bacteria | 3450 |
| 165 | Ga0207680_10279527 | 3300025903 | Bacteria | 1159 |
| 166 | Ga0207647_10007040 | 3300025904 | Bacteria | 8156 |
| 167 | Ga0207647_10184677 | 3300025904 | Bacteria | 1210 |
| 168 | Ga0207645_10014115 | 3300025907 | Bacteria | 5353 |
| 169 | Ga0207643_10036646 | 3300025908 | Bacteria | 2751 |
| 170 | Ga0207705_10013751 | 3300025909 | Bacteria | 5838 |
| 171 | Ga0207705_10034707 | 3300025909 | Bacteria | 3608 |
| 172 | Ga0207705_10052239 | 3300025909 | Bacteria | 2942 |
| 173 | Ga0207705_10216204 | 3300025909 | Bacteria | 1454 |
| 174 | Ga0207707_10056606 | 3300025912 | Bacteria | 3412 |
| 175 | Ga0207707_10399756 | 3300025912 | Bacteria | 1180 |
| 176 | Ga0207695_10024793 | 3300025913 | Bacteria | 6734 |
| 177 | Ga0207695_10275508 | 3300025913 | Bacteria | 1577 |
| 178 | Ga0207671_10058845 | 3300025914 | Bacteria | 2849 |
| 179 | Ga0207660_10012572 | 3300025917 | Bacteria | 5544 |
| 180 | Ga0207660_10017082 | 3300025917 | Bacteria | 4815 |
| 181 | Ga0207657_10002976 | 3300025919 | Bacteria | 18168 |
| 182 | Ga0207657_10011586 | 3300025919 | Bacteria | 8747 |
| 183 | Ga0207657_10016273 | 3300025919 | Bacteria | 7177 |
| 184 | Ga0207657_10020766 | 3300025919 | Bacteria | 6198 |
| 185 | Ga0207649_10002986 | 3300025920 | Bacteria | 9319 |
| 186 | Ga0207649_10097384 | 3300025920 | Bacteria | 1940 |
| 187 | Ga0207652_10188989 | 3300025921 | Bacteria | 1852 |
| 188 | Ga0207652_10357899 | 3300025921 | Bacteria | 1317 |
| 189 | Ga0207652_10447007 | 3300025921 | Bacteria | 1165 |
| 190 | Ga0207681_10000980 | 3300025923 | Bacteria | 18650 |
| 191 | Ga0207681_10341162 | 3300025923 | Bacteria | 1197 |
| 192 | Ga0207694_10019750 | 3300025924 | Bacteria | 5096 |
| 193 | Ga0207694_10327980 | 3300025924 | Bacteria | 1264 |
| 194 | Ga0207650_10000537 | 3300025925 | Bacteria | 30997 |
| 195 | Ga0207650_10032747 | 3300025925 | Bacteria | 3760 |
| 196 | Ga0207650_10102570 | 3300025925 | Bacteria | 2205 |
| 197 | Ga0207650_10129722 | 3300025925 | Bacteria | 1972 |
| 198 | Ga0207659_10002931 | 3300025926 | Bacteria | 10163 |
| 199 | Ga0207659_10130595 | 3300025926 | Bacteria | 1938 |
| 200 | Ga0207687_10348334 | 3300025927 | Unclassified | 1206 |
| 201 | Ga0207687_10388134 | 3300025927 | Bacteria | 1146 |
| 202 | Ga0207644_10067505 | 3300025931 | Bacteria | 2606 |
| 203 | Ga0207690_10005072 | 3300025932 | Bacteria | 7778 |
| 204 | Ga0207690_10011855 | 3300025932 | Bacteria | 5212 |
| 205 | Ga0207690_10194661 | 3300025932 | Bacteria | 1535 |
| 206 | Ga0207690_10573327 | 3300025932 | Bacteria | 919 |
| 207 | Ga0207706_10000415 | 3300025933 | Bacteria | 45662 |
| 208 | Ga0207706_10004027 | 3300025933 | Bacteria | 13904 |
| 209 | Ga0207706_10088338 | 3300025933 | Bacteria | 2725 |
| 210 | Ga0207706_10265119 | 3300025933 | Bacteria | 1499 |
| 211 | Ga0207686_10059227 | 3300025934 | Bacteria | 2418 |
| 212 | Ga0207669_10004417 | 3300025937 | Bacteria | 6189 |
| 213 | Ga0207669_10039435 | 3300025937 | Bacteria | 2729 |
| 214 | Ga0207669_10054331 | 3300025937 | Bacteria | 2419 |
| 215 | Ga0207704_10154056 | 3300025938 | Bacteria | 1626 |
| 216 | Ga0207704_10301839 | 3300025938 | Bacteria | 1227 |
| 217 | Ga0207691_10006421 | 3300025940 | Bacteria | 11361 |
| 218 | Ga0207691_10016586 | 3300025940 | Bacteria | 6992 |
| 219 | Ga0207711_10023918 | 3300025941 | Bacteria | 5113 |
| 220 | Ga0207711_10585925 | 3300025941 | Bacteria | 1040 |
| 221 | Ga0207661_10054698 | 3300025944 | Bacteria | 3198 |
| 222 | Ga0207679_10011209 | 3300025945 | Bacteria | 5793 |
| 223 | Ga0207679_10022262 | 3300025945 | Bacteria | 4313 |
| 224 | Ga0207667_10014151 | 3300025949 | Bacteria | 9107 |
| 225 | Ga0207667_10054377 | 3300025949 | Bacteria | 4211 |
| 226 | Ga0207667_10352217 | 3300025949 | Bacteria | 1501 |
| 227 | Ga0207651_10017730 | 3300025960 | Bacteria | 4214 |
| 228 | Ga0207651_10178213 | 3300025960 | Bacteria | 1683 |
| 229 | Ga0207651_10457886 | 3300025960 | Bacteria | 1095 |
| 230 | Ga0207712_10049689 | 3300025961 | Bacteria | 2924 |
| 231 | Ga0207712_10085588 | 3300025961 | Bacteria | 2308 |
| 232 | Ga0207668_10001025 | 3300025972 | Bacteria | 16716 |
| 233 | Ga0207668_10087397 | 3300025972 | Bacteria | 2280 |
| 234 | Ga0207668_10109279 | 3300025972 | Bacteria | 2071 |
| 235 | Ga0207668_10111464 | 3300025972 | Bacteria | 2054 |
| 236 | Ga0207668_10248304 | 3300025972 | Bacteria | 1444 |
| 237 | Ga0207640_10003332 | 3300025981 | Bacteria | 8655 |
| 238 | Ga0207640_10009141 | 3300025981 | Bacteria | 5535 |
| 239 | Ga0207640_10145199 | 3300025981 | Bacteria | 1735 |
| 240 | Ga0207640_10243261 | 3300025981 | Bacteria | 1392 |
| 241 | Ga0207640_10402570 | 3300025981 | Bacteria | 1115 |
| 242 | Ga0207658_10001752 | 3300025986 | Bacteria | 16336 |
| 243 | Ga0207658_10021251 | 3300025986 | Bacteria | 4502 |
| 244 | Ga0207658_10520227 | 3300025986 | Bacteria | 1062 |
| 245 | Ga0207677_10004923 | 3300026023 | Bacteria | 7211 |
| 246 | Ga0207677_10261363 | 3300026023 | Unclassified | 1411 |
| 247 | Ga0207703_10002285 | 3300026035 | Bacteria | 16709 |
| 248 | Ga0207639_10002465 | 3300026041 | Bacteria | 12409 |
| 249 | Ga0207639_10396623 | 3300026041 | Bacteria | 1242 |
| 250 | Ga0207678_10016862 | 3300026067 | Bacteria | 6413 |
| 251 | Ga0207678_10167688 | 3300026067 | Bacteria | 1875 |
| 252 | Ga0207678_10475773 | 3300026067 | Bacteria | 1087 |
| 253 | Ga0207702_10021273 | 3300026078 | Bacteria | 5368 |
| 254 | Ga0207641_10414749 | 3300026088 | Bacteria | 1295 |
| 255 | Ga0207648_10003316 | 3300026089 | Bacteria | 16906 |
| 256 | Ga0207648_10003663 | 3300026089 | Bacteria | 16080 |
| 257 | Ga0207648_10045770 | 3300026089 | Bacteria | 3837 |
| 258 | Ga0207676_10145910 | 3300026095 | Bacteria | 2032 |
| 259 | Ga0207676_10166986 | 3300026095 | Bacteria | 1913 |
| 260 | Ga0207676_10305558 | 3300026095 | Bacteria | 1454 |
| 261 | Ga0207674_10001374 | 3300026116 | Bacteria | 31441 |
| 262 | Ga0207675_100005627 | 3300026118 | Bacteria | 11998 |
| 263 | Ga0207683_10002725 | 3300026121 | Bacteria | 15428 |
| 264 | Ga0207683_10006055 | 3300026121 | Bacteria | 10355 |
| 265 | Ga0207683_10054989 | 3300026121 | Bacteria | 3491 |
| 266 | Ga0207683_10091544 | 3300026121 | Bacteria | 2709 |
| 267 | Ga0207683_10259742 | 3300026121 | Bacteria | 1586 |
| 268 | Ga0207698_10008759 | 3300026142 | Bacteria | 6417 |
| 269 | Ga0207698_10014237 | 3300026142 | Bacteria | 5281 |
| 270 | Ga0207698_10089741 | 3300026142 | Bacteria | 2511 |
| 271 | Ga0207698_10448408 | 3300026142 | Bacteria | 1245 |
| 272 | Ga0207698_10530222 | 3300026142 | Bacteria | 1151 |
| 273 | Ga0207428_10172169 | 3300027907 | Bacteria | 1639 |
| 274 | Ga0268266_10020608 | 3300028379 | Bacteria | 5617 |
| 275 | Ga0268265_10002664 | 3300028380 | Bacteria | 13238 |
| 276 | Ga0268265_10012275 | 3300028380 | Bacteria | 5806 |
| 277 | Ga0268265_10118260 | 3300028380 | Bacteria | 2178 |
| 278 | Ga0268264_10017043 | 3300028381 | Bacteria | 5949 |
| 279 | Ga0268264_10069400 | 3300028381 | Bacteria | 2980 |
| 280 | Ga0268264_10073602 | 3300028381 | Bacteria | 2900 |
| 281 | Ga0268264_10226028 | 3300028381 | Bacteria | 1725 |
| 282 | Ga0268264_10250653 | 3300028381 | Bacteria | 1645 |
| 283 | Ga0307408_100038799 | 3300031548 | Bacteria | 3362 |
| 284 | Ga0307408_100209281 | 3300031548 | Bacteria | 1584 |
| 285 | Ga0307408_100240622 | 3300031548 | Bacteria | 1487 |
| 286 | Ga0307405_10006410 | 3300031731 | Bacteria | 5786 |
| 287 | Ga0307405_10083241 | 3300031731 | Bacteria | 2097 |
| 288 | Ga0307405_10096635 | 3300031731 | Bacteria | 1970 |
| 289 | Ga0307405_10231923 | 3300031731 | Bacteria | 1361 |
| 290 | Ga0307413_10058691 | 3300031824 | Bacteria | 2360 |
| 291 | Ga0307413_10067269 | 3300031824 | Bacteria | 2239 |
| 292 | Ga0307413_10079261 | 3300031824 | Bacteria | 2099 |
| 293 | Ga0307413_10116274 | 3300031824 | Bacteria | 1801 |
| 294 | Ga0307410_10018037 | 3300031852 | Bacteria | 4255 |
| 295 | Ga0307410_10282415 | 3300031852 | Bacteria | 1303 |
| 296 | Ga0307410_10357608 | 3300031852 | Bacteria | 1168 |
| 297 | Ga0307410_10387993 | 3300031852 | Bacteria | 1125 |
| 298 | Ga0307406_10007147 | 3300031901 | Bacteria | 6184 |
| 299 | Ga0307406_10073463 | 3300031901 | Bacteria | 2249 |
| 300 | Ga0307406_10122698 | 3300031901 | Bacteria | 1809 |
| 301 | Ga0307406_10124308 | 3300031901 | Bacteria | 1799 |
| 302 | Ga0307406_10204124 | 3300031901 | Bacteria | 1457 |
| 303 | Ga0307407_10003932 | 3300031903 | Bacteria | 6203 |
| 304 | Ga0307407_10022929 | 3300031903 | Bacteria | 3248 |
| 305 | Ga0307407_10031419 | 3300031903 | Bacteria | 2875 |
| 306 | Ga0307407_10341561 | 3300031903 | Bacteria | 1057 |
| 307 | Ga0307412_10043475 | 3300031911 | Bacteria | 2925 |
| 308 | Ga0307412_10117246 | 3300031911 | Bacteria | 1911 |
| 309 | Ga0307409_100017544 | 3300031995 | Bacteria | 4776 |
| 310 | Ga0307409_100071372 | 3300031995 | Bacteria | 2761 |
| 311 | Ga0307409_100096516 | 3300031995 | Bacteria | 2439 |
| 312 | Ga0307409_100272586 | 3300031995 | Bacteria | 1559 |
| 313 | Ga0307409_100588291 | 3300031995 | Bacteria | 1098 |
| 314 | Ga0307409_100592003 | 3300031995 | Unclassified | 1095 |
| 315 | Ga0307416_100018282 | 3300032002 | Bacteria | 4933 |
| 316 | Ga0307416_100053576 | 3300032002 | Bacteria | 3237 |
| 317 | Ga0307416_100108995 | 3300032002 | Bacteria | 2434 |
| 318 | Ga0307416_100181491 | 3300032002 | Bacteria | 1973 |
| 319 | Ga0307416_100201263 | 3300032002 | Bacteria | 1890 |
| 320 | Ga0307416_100297325 | 3300032002 | Bacteria | 1602 |
| 321 | Ga0307414_10049847 | 3300032004 | Bacteria | 2897 |
| 322 | Ga0307414_10114420 | 3300032004 | Bacteria | 2061 |
| 323 | Ga0307414_10132973 | 3300032004 | Bacteria | 1934 |
| 324 | Ga0307414_10150983 | 3300032004 | Bacteria | 1833 |
| 325 | Ga0307414_10251046 | 3300032004 | Bacteria | 1470 |
| 326 | Ga0307411_10015293 | 3300032005 | Bacteria | 4304 |
| 327 | Ga0307411_10015390 | 3300032005 | Bacteria | 4295 |
| 328 | Ga0307411_10018070 | 3300032005 | Bacteria | 4036 |
| 329 | Ga0307415_100028381 | 3300032126 | Bacteria | 3559 |
| 330 | Ga0307415_100034428 | 3300032126 | Bacteria | 3298 |
| 331 | Ga0307415_100052758 | 3300032126 | Bacteria | 2767 |
| 332 | Ga0307415_100055739 | 3300032126 | Bacteria | 2706 |
| 333 | Ga0307415_100059713 | 3300032126 | Bacteria | 2631 |
| 334 | Ga0373931_0034411 | 3300035691 | Bacteria | 2630 |
| 335 | Ga0395899_0040723 | 3300037312 | Bacteria | 3474 |
| 336 | Ga0395899_0096667 | 3300037312 | Bacteria | 2135 |
| 337 | Ga0395899_0130997 | 3300037312 | Bacteria | 1790 |
| 338 | Ga0395900_0018045 | 3300037418 | Bacteria | 7203 |
| 339 | Ga0395900_0306173 | 3300037418 | Unclassified | 1573 |
| 340 | Ga0395898_0019810 | 3300037466 | Bacteria | 6841 |
| 341 | Ga0395905_0005612 | 3300037471 | Bacteria | 12773 |
| 342 | Ga0395905_0061034 | 3300037471 | Bacteria | 3525 |
| 343 | Ga0395905_0159350 | 3300037471 | Bacteria | 2121 |
| 344 | Ga0395905_0178515 | 3300037471 | Bacteria | 1993 |
| 345 | Ga0395905_0431229 | 3300037471 | Bacteria | 1215 |
| 346 | Ga0395901_0047669 | 3300038443 | Bacteria | 4448 |
| 347 | Ga0395901_0072620 | 3300038443 | Bacteria | 3587 |
| 348 | Ga0395901_0353161 | 3300038443 | Bacteria | 1517 |
| 349 | Ga0395901_0436685 | 3300038443 | Bacteria | 1340 |
| 350 | Ga0439445_0000177 | 3300042004 | Bacteria | 11327 |
| 351 | Ga0466969_0117109 | 3300044656 | Bacteria | 1243 |
| 352 | Ga0466972_0124463 | 3300044658 | Bacteria | 1215 |
| 353 | Ga0466966_0098759 | 3300044684 | Unclassified | 1807 |
| 354 | Ga0466963_0000677 | 3300044694 | Bacteria | 16540 |
| 355 | Ga0466963_0052832 | 3300044694 | Bacteria | 2697 |
| 356 | Ga0466963_0079472 | 3300044694 | Bacteria | 2219 |
| 357 | Ga0466964_0053977 | 3300044706 | Bacteria | 1656 |
| 358 | Ga0466970_0050850 | 3300044765 | Bacteria | 2211 |
| 359 | Ga0466957_0000784 | 3300044842 | Bacteria | 16257 |
| 360 | Ga0466957_0004343 | 3300044842 | Bacteria | 7876 |
| 361 | Ga0466959_0349305 | 3300045049 | Unclassified | 1008 |
| 362 | Ga0466958_0231570 | 3300045836 | Bacteria | 1180 |
| 363 | Ga0466967_0000210 | 3300045976 | Bacteria | 24683 |
| 364 | Ga0466967_0264415 | 3300045976 | Bacteria | 1646 |
| 365 | Ga0495621_0010315 | 3300046539 | Bacteria | 2853 |
| 366 | Ga0495669_0017748 | 3300046684 | Bacteria | 3056 |
| 367 | Ga0495669_0044331 | 3300046684 | Bacteria | 1981 |
| 368 | Ga0496102_0114084 | 3300048905 | Bacteria | 2521 |
| 369 | Ga0496105_0047438 | 3300048908 | Bacteria | 3545 |
| 370 | Ga0496106_0020518 | 3300048909 | Bacteria | 4905 |
| 371 | Ga0496108_0001136 | 3300048911 | Bacteria | 20807 |
| 372 | Ga0496109_0412733 | 3300048912 | Bacteria | 1276 |
| 373 | Ga0496110_0459299 | 3300048913 | Bacteria | 1160 |
| 374 | Ga0496112_0022605 | 3300048915 | Bacteria | 5995 |
| 375 | Ga0496112_0277767 | 3300048915 | Bacteria | 1623 |
| 376 | nmdc:mga08y16_365949_c1 | 3300050511 | Unclassified | 1480 |
| 377 | nmdc:mga0a205_1780_c1 | 3300050515 | Bacteria | 18620 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044694 | Ga0466963_0000677 | Ga0466963_0000677_7301_8110 | 230 |
| 2 | 3300044706 | Ga0466964_0053977 | Ga0466964_0053977_346_1155 | 230 |
| 3 | 3300044842 | Ga0466957_0000784 | Ga0466957_0000784_4701_5510 | 230 |
| 4 | 3300045976 | Ga0466967_0000210 | Ga0466967_0000210_8042_8851 | 230 |
| 5 | 3300031852 | Ga0307410_10282415 | Ga0307410_102824152 | 234 |
| 6 | 3300044656 | Ga0466969_0117109 | Ga0466969_0117109_481_1227 | 235 |
| 7 | 3300005336 | Ga0070680_100003482 | Ga0070680_1000034826 | 239 |
| 8 | 3300005458 | Ga0070681_10007779 | Ga0070681_100077793 | 239 |
| 9 | 3300005614 | Ga0068856_100053274 | Ga0068856_1000532743 | 239 |
| 10 | 3300005616 | Ga0068852_100044261 | Ga0068852_1000442613 | 239 |
| 11 | 3300020069 | Ga0197907_10854725 | Ga0197907_108547252 | 239 |
| 12 | 3300025912 | Ga0207707_10056606 | Ga0207707_100566062 | 239 |
| 13 | 3300025913 | Ga0207695_10275508 | Ga0207695_102755082 | 239 |
| 14 | 3300025917 | Ga0207660_10012572 | Ga0207660_100125723 | 239 |
| 15 | 3300025921 | Ga0207652_10447007 | Ga0207652_104470072 | 239 |
| 16 | 3300025949 | Ga0207667_10054377 | Ga0207667_100543773 | 239 |
| 17 | 3300025981 | Ga0207640_10003332 | Ga0207640_100033323 | 239 |
| 18 | 3300026142 | Ga0207698_10014237 | Ga0207698_100142372 | 239 |
| 19 | 3300031548 | Ga0307408_100038799 | Ga0307408_1000387993 | 242 |
| 20 | 3300031731 | Ga0307405_10006410 | Ga0307405_100064103 | 242 |
| 21 | 3300031901 | Ga0307406_10122698 | Ga0307406_101226982 | 242 |
| 22 | 3300031995 | Ga0307409_100272586 | Ga0307409_1002725862 | 242 |
| 23 | 3300032002 | Ga0307416_100108995 | Ga0307416_1001089952 | 242 |
| 24 | 3300032004 | Ga0307414_10150983 | Ga0307414_101509832 | 242 |
| 25 | 3300032126 | Ga0307415_100052758 | Ga0307415_1000527583 | 242 |
| 26 | 3300037471 | Ga0395905_0061034 | Ga0395905_0061034_1499_2308 | 245 |
| 27 | 3300031731 | Ga0307405_10083241 | Ga0307405_100832412 | 248 |
| 28 | 3300031901 | Ga0307406_10073463 | Ga0307406_100734632 | 248 |
| 29 | 3300032002 | Ga0307416_100181491 | Ga0307416_1001814912 | 248 |
| 30 | 3300032126 | Ga0307415_100055739 | Ga0307415_1000557392 | 248 |
| 31 | 3300025972 | Ga0207668_10248304 | Ga0207668_102483042 | 249 |
| 32 | 3300025908 | Ga0207643_10036646 | Ga0207643_100366463 | 254 |
| 33 | 3300037312 | Ga0395899_0130997 | Ga0395899_0130997_344_1153 | 256 |
| 34 | 3300031548 | Ga0307408_100209281 | Ga0307408_1002092812 | 261 |
| 35 | 3300032004 | Ga0307414_10114420 | Ga0307414_101144202 | 261 |
| 36 | 3300005339 | Ga0070660_100108670 | Ga0070660_1001086701 | 264 |
| 37 | 3300005344 | Ga0070661_100043091 | Ga0070661_1000430912 | 264 |
| 38 | 3300005457 | Ga0070662_100240439 | Ga0070662_1002404392 | 264 |
| 39 | 3300005719 | Ga0068861_100479648 | Ga0068861_1004796482 | 264 |
| 40 | 3300005843 | Ga0068860_100406029 | Ga0068860_1004060292 | 264 |
| 41 | 3300026067 | Ga0207678_10167688 | Ga0207678_101676882 | 264 |
| 42 | 3300001979 | JGI24740J21852_10023111 | JGI24740J21852_100231112 | 265 |
| 43 | 3300002076 | JGI24749J21850_1001908 | JGI24749J21850_10019083 | 267 |
| 44 | 3300005293 | Ga0065715_10000370 | Ga0065715_1000037012 | 267 |
| 45 | 3300005327 | Ga0070658_10008759 | Ga0070658_100087592 | 267 |
| 46 | 3300005328 | Ga0070676_10016546 | Ga0070676_100165462 | 267 |
| 47 | 3300005328 | Ga0070676_10041081 | Ga0070676_100410812 | 267 |
| 48 | 3300005328 | Ga0070676_10312801 | Ga0070676_103128012 | 267 |
| 49 | 3300005330 | Ga0070690_100030050 | Ga0070690_1000300503 | 267 |
| 50 | 3300005331 | Ga0070670_100001912 | Ga0070670_10000191211 | 267 |
| 51 | 3300005331 | Ga0070670_100074489 | Ga0070670_1000744892 | 267 |
| 52 | 3300005333 | Ga0070677_10000430 | Ga0070677_100004304 | 267 |
| 53 | 3300005333 | Ga0070677_10007722 | Ga0070677_100077222 | 267 |
| 54 | 3300005334 | Ga0068869_100170597 | Ga0068869_1001705971 | 267 |
| 55 | 3300005335 | Ga0070666_10020531 | Ga0070666_100205313 | 267 |
| 56 | 3300005338 | Ga0068868_100024470 | Ga0068868_1000244704 | 267 |
| 57 | 3300005339 | Ga0070660_100010351 | Ga0070660_1000103515 | 267 |
| 58 | 3300005343 | Ga0070687_100119259 | Ga0070687_1001192591 | 267 |
| 59 | 3300005343 | Ga0070687_100255353 | Ga0070687_1002553532 | 267 |
| 60 | 3300005344 | Ga0070661_100054212 | Ga0070661_1000542122 | 267 |
| 61 | 3300005347 | Ga0070668_100051558 | Ga0070668_1000515582 | 267 |
| 62 | 3300005347 | Ga0070668_100131984 | Ga0070668_1001319842 | 267 |
| 63 | 3300005353 | Ga0070669_100004727 | Ga0070669_1000047273 | 267 |
| 64 | 3300005354 | Ga0070675_100002570 | Ga0070675_1000025703 | 267 |
| 65 | 3300005355 | Ga0070671_100026544 | Ga0070671_1000265442 | 267 |
| 66 | 3300005355 | Ga0070671_100201070 | Ga0070671_1002010702 | 267 |
| 67 | 3300005356 | Ga0070674_100004207 | Ga0070674_1000042073 | 267 |
| 68 | 3300005364 | Ga0070673_100040621 | Ga0070673_1000406213 | 267 |
| 69 | 3300005365 | Ga0070688_100038914 | Ga0070688_1000389142 | 267 |
| 70 | 3300005366 | Ga0070659_100005748 | Ga0070659_1000057483 | 267 |
| 71 | 3300005366 | Ga0070659_100424270 | Ga0070659_1004242702 | 267 |
| 72 | 3300005367 | Ga0070667_100026584 | Ga0070667_1000265843 | 267 |
| 73 | 3300005367 | Ga0070667_100029828 | Ga0070667_1000298283 | 267 |
| 74 | 3300005438 | Ga0070701_10008008 | Ga0070701_100080082 | 267 |
| 75 | 3300005440 | Ga0070705_100169686 | Ga0070705_1001696862 | 267 |
| 76 | 3300005455 | Ga0070663_100015918 | Ga0070663_1000159183 | 267 |
| 77 | 3300005455 | Ga0070663_100134770 | Ga0070663_1001347702 | 267 |
| 78 | 3300005456 | Ga0070678_100043761 | Ga0070678_1000437613 | 267 |
| 79 | 3300005456 | Ga0070678_100492678 | Ga0070678_1004926781 | 267 |
| 80 | 3300005457 | Ga0070662_100001494 | Ga0070662_10000149411 | 267 |
| 81 | 3300005457 | Ga0070662_100192347 | Ga0070662_1001923472 | 267 |
| 82 | 3300005458 | Ga0070681_10599421 | Ga0070681_105994211 | 267 |
| 83 | 3300005459 | Ga0068867_100025668 | Ga0068867_1000256683 | 267 |
| 84 | 3300005459 | Ga0068867_100279971 | Ga0068867_1002799711 | 267 |
| 85 | 3300005539 | Ga0068853_100038037 | Ga0068853_1000380373 | 267 |
| 86 | 3300005539 | Ga0068853_100119528 | Ga0068853_1001195282 | 267 |
| 87 | 3300005543 | Ga0070672_100001865 | Ga0070672_10000186511 | 267 |
| 88 | 3300005548 | Ga0070665_100013752 | Ga0070665_1000137522 | 267 |
| 89 | 3300005548 | Ga0070665_100103745 | Ga0070665_1001037452 | 267 |
| 90 | 3300005549 | Ga0070704_100131850 | Ga0070704_1001318502 | 267 |
| 91 | 3300005564 | Ga0070664_100005105 | Ga0070664_1000051056 | 267 |
| 92 | 3300005564 | Ga0070664_100024952 | Ga0070664_1000249522 | 267 |
| 93 | 3300005564 | Ga0070664_100049560 | Ga0070664_1000495602 | 267 |
| 94 | 3300005578 | Ga0068854_100057755 | Ga0068854_1000577553 | 267 |
| 95 | 3300005578 | Ga0068854_100231797 | Ga0068854_1002317972 | 267 |
| 96 | 3300005614 | Ga0068856_100084778 | Ga0068856_1000847783 | 267 |
| 97 | 3300005616 | Ga0068852_100011308 | Ga0068852_1000113084 | 267 |
| 98 | 3300005616 | Ga0068852_100017152 | Ga0068852_1000171523 | 267 |
| 99 | 3300005616 | Ga0068852_100272397 | Ga0068852_1002723972 | 267 |
| 100 | 3300005617 | Ga0068859_100023440 | Ga0068859_1000234403 | 267 |
| 101 | 3300005617 | Ga0068859_100059253 | Ga0068859_1000592534 | 267 |
| 102 | 3300005618 | Ga0068864_100022334 | Ga0068864_1000223346 | 267 |
| 103 | 3300005618 | Ga0068864_100051759 | Ga0068864_1000517592 | 267 |
| 104 | 3300005618 | Ga0068864_100058612 | Ga0068864_1000586122 | 267 |
| 105 | 3300005618 | Ga0068864_100223266 | Ga0068864_1002232662 | 267 |
| 106 | 3300005841 | Ga0068863_100454547 | Ga0068863_1004545472 | 267 |
| 107 | 3300005842 | Ga0068858_100430987 | Ga0068858_1004309872 | 267 |
| 108 | 3300005843 | Ga0068860_100126561 | Ga0068860_1001265612 | 267 |
| 109 | 3300005844 | Ga0068862_100006881 | Ga0068862_1000068816 | 267 |
| 110 | 3300006237 | Ga0097621_100297181 | Ga0097621_1002971812 | 267 |
| 111 | 3300006844 | Ga0075428_100139177 | Ga0075428_1001391772 | 267 |
| 112 | 3300006881 | Ga0068865_100012328 | Ga0068865_1000123283 | 267 |
| 113 | 3300006881 | Ga0068865_100066306 | Ga0068865_1000663062 | 267 |
| 114 | 3300006931 | Ga0097620_100023440 | Ga0097620_1000234403 | 267 |
| 115 | 3300006931 | Ga0097620_100059254 | Ga0097620_1000592541 | 267 |
| 116 | 3300009094 | Ga0111539_10041388 | Ga0111539_100413883 | 267 |
| 117 | 3300009098 | Ga0105245_10003796 | Ga0105245_100037962 | 267 |
| 118 | 3300009098 | Ga0105245_10159328 | Ga0105245_101593282 | 267 |
| 119 | 3300009098 | Ga0105245_10172600 | Ga0105245_101726002 | 267 |
| 120 | 3300009176 | Ga0105242_10060809 | Ga0105242_100608093 | 267 |
| 121 | 3300009551 | Ga0105238_10035054 | Ga0105238_100350542 | 267 |
| 122 | 3300009553 | Ga0105249_10012562 | Ga0105249_100125625 | 267 |
| 123 | 3300009553 | Ga0105249_10146720 | Ga0105249_101467202 | 267 |
| 124 | 3300010375 | Ga0105239_10166072 | Ga0105239_101660722 | 267 |
| 125 | 3300011119 | Ga0105246_10079935 | Ga0105246_100799352 | 267 |
| 126 | 3300013100 | Ga0157373_10016531 | Ga0157373_100165312 | 267 |
| 127 | 3300013100 | Ga0157373_10239881 | Ga0157373_102398812 | 267 |
| 128 | 3300013105 | Ga0157369_10057400 | Ga0157369_100574003 | 267 |
| 129 | 3300013105 | Ga0157369_10533238 | Ga0157369_105332382 | 267 |
| 130 | 3300013296 | Ga0157374_10158695 | Ga0157374_101586952 | 267 |
| 131 | 3300013306 | Ga0163162_10055501 | Ga0163162_100555012 | 267 |
| 132 | 3300013306 | Ga0163162_10409322 | Ga0163162_104093222 | 267 |
| 133 | 3300013308 | Ga0157375_10169609 | Ga0157375_101696092 | 267 |
| 134 | 3300014325 | Ga0163163_10065730 | Ga0163163_100657302 | 267 |
| 135 | 3300014326 | Ga0157380_10001232 | Ga0157380_100012323 | 267 |
| 136 | 3300014326 | Ga0157380_10411220 | Ga0157380_104112201 | 267 |
| 137 | 3300014326 | Ga0157380_10664813 | Ga0157380_106648132 | 267 |
| 138 | 3300014497 | Ga0182008_10173726 | Ga0182008_101737262 | 267 |
| 139 | 3300014745 | Ga0157377_10009183 | Ga0157377_100091832 | 267 |
| 140 | 3300014969 | Ga0157376_10006900 | Ga0157376_100069003 | 267 |
| 141 | 3300025315 | Ga0207697_10003347 | Ga0207697_100033473 | 267 |
| 142 | 3300025315 | Ga0207697_10005604 | Ga0207697_100056043 | 267 |
| 143 | 3300025321 | Ga0207656_10014270 | Ga0207656_100142703 | 267 |
| 144 | 3300025893 | Ga0207682_10001260 | Ga0207682_100012603 | 267 |
| 145 | 3300025893 | Ga0207682_10005004 | Ga0207682_100050043 | 267 |
| 146 | 3300025899 | Ga0207642_10039499 | Ga0207642_100394992 | 267 |
| 147 | 3300025901 | Ga0207688_10022485 | Ga0207688_100224853 | 267 |
| 148 | 3300025903 | Ga0207680_10279527 | Ga0207680_102795272 | 267 |
| 149 | 3300025904 | Ga0207647_10184677 | Ga0207647_101846772 | 267 |
| 150 | 3300025907 | Ga0207645_10014115 | Ga0207645_100141156 | 267 |
| 151 | 3300025909 | Ga0207705_10034707 | Ga0207705_100347072 | 267 |
| 152 | 3300025909 | Ga0207705_10216204 | Ga0207705_102162042 | 267 |
| 153 | 3300025912 | Ga0207707_10399756 | Ga0207707_103997562 | 267 |
| 154 | 3300025919 | Ga0207657_10011586 | Ga0207657_100115866 | 267 |
| 155 | 3300025919 | Ga0207657_10016273 | Ga0207657_100162733 | 267 |
| 156 | 3300025919 | Ga0207657_10020766 | Ga0207657_100207665 | 267 |
| 157 | 3300025920 | Ga0207649_10097384 | Ga0207649_100973842 | 267 |
| 158 | 3300025923 | Ga0207681_10000980 | Ga0207681_1000098015 | 267 |
| 159 | 3300025924 | Ga0207694_10327980 | Ga0207694_103279802 | 267 |
| 160 | 3300025925 | Ga0207650_10000537 | Ga0207650_1000053724 | 267 |
| 161 | 3300025925 | Ga0207650_10032747 | Ga0207650_100327472 | 267 |
| 162 | 3300025925 | Ga0207650_10102570 | Ga0207650_101025703 | 267 |
| 163 | 3300025925 | Ga0207650_10129722 | Ga0207650_101297222 | 267 |
| 164 | 3300025926 | Ga0207659_10002931 | Ga0207659_100029317 | 267 |
| 165 | 3300025926 | Ga0207659_10130595 | Ga0207659_101305952 | 267 |
| 166 | 3300025927 | Ga0207687_10348334 | Ga0207687_103483341 | 267 |
| 167 | 3300025927 | Ga0207687_10388134 | Ga0207687_103881342 | 267 |
| 168 | 3300025931 | Ga0207644_10067505 | Ga0207644_100675052 | 267 |
| 169 | 3300025932 | Ga0207690_10011855 | Ga0207690_100118552 | 267 |
| 170 | 3300025932 | Ga0207690_10194661 | Ga0207690_101946611 | 267 |
| 171 | 3300025932 | Ga0207690_10573327 | Ga0207690_105733271 | 267 |
| 172 | 3300025933 | Ga0207706_10000415 | Ga0207706_1000041547 | 267 |
| 173 | 3300025933 | Ga0207706_10004027 | Ga0207706_100040273 | 267 |
| 174 | 3300025933 | Ga0207706_10088338 | Ga0207706_100883382 | 267 |
| 175 | 3300025934 | Ga0207686_10059227 | Ga0207686_100592272 | 267 |
| 176 | 3300025937 | Ga0207669_10004417 | Ga0207669_100044174 | 267 |
| 177 | 3300025937 | Ga0207669_10039435 | Ga0207669_100394353 | 267 |
| 178 | 3300025937 | Ga0207669_10054331 | Ga0207669_100543312 | 267 |
| 179 | 3300025938 | Ga0207704_10154056 | Ga0207704_101540562 | 267 |
| 180 | 3300025938 | Ga0207704_10301839 | Ga0207704_103018392 | 267 |
| 181 | 3300025940 | Ga0207691_10006421 | Ga0207691_100064213 | 267 |
| 182 | 3300025940 | Ga0207691_10016586 | Ga0207691_100165863 | 267 |
| 183 | 3300025941 | Ga0207711_10023918 | Ga0207711_100239183 | 267 |
| 184 | 3300025945 | Ga0207679_10011209 | Ga0207679_100112095 | 267 |
| 185 | 3300025945 | Ga0207679_10022262 | Ga0207679_100222622 | 267 |
| 186 | 3300025949 | Ga0207667_10352217 | Ga0207667_103522172 | 267 |
| 187 | 3300025960 | Ga0207651_10017730 | Ga0207651_100177303 | 267 |
| 188 | 3300025960 | Ga0207651_10457886 | Ga0207651_104578861 | 267 |
| 189 | 3300025961 | Ga0207712_10049689 | Ga0207712_100496892 | 267 |
| 190 | 3300025961 | Ga0207712_10085588 | Ga0207712_100855882 | 267 |
| 191 | 3300025972 | Ga0207668_10001025 | Ga0207668_1000102513 | 267 |
| 192 | 3300025972 | Ga0207668_10087397 | Ga0207668_100873972 | 267 |
| 193 | 3300025981 | Ga0207640_10243261 | Ga0207640_102432612 | 267 |
| 194 | 3300025981 | Ga0207640_10402570 | Ga0207640_104025702 | 267 |
| 195 | 3300025986 | Ga0207658_10520227 | Ga0207658_105202271 | 267 |
| 196 | 3300026023 | Ga0207677_10261363 | Ga0207677_102613632 | 267 |
| 197 | 3300026041 | Ga0207639_10396623 | Ga0207639_103966232 | 267 |
| 198 | 3300026089 | Ga0207648_10003316 | Ga0207648_1000331613 | 267 |
| 199 | 3300026089 | Ga0207648_10003663 | Ga0207648_100036639 | 267 |
| 200 | 3300026089 | Ga0207648_10045770 | Ga0207648_100457703 | 267 |
| 201 | 3300026095 | Ga0207676_10145910 | Ga0207676_101459102 | 267 |
| 202 | 3300026095 | Ga0207676_10166986 | Ga0207676_101669862 | 267 |
| 203 | 3300026118 | Ga0207675_100005627 | Ga0207675_1000056272 | 267 |
| 204 | 3300026121 | Ga0207683_10002725 | Ga0207683_1000272513 | 267 |
| 205 | 3300026121 | Ga0207683_10006055 | Ga0207683_100060556 | 267 |
| 206 | 3300026121 | Ga0207683_10091544 | Ga0207683_100915442 | 267 |
| 207 | 3300026142 | Ga0207698_10089741 | Ga0207698_100897412 | 267 |
| 208 | 3300026142 | Ga0207698_10448408 | Ga0207698_104484082 | 267 |
| 209 | 3300026142 | Ga0207698_10530222 | Ga0207698_105302222 | 267 |
| 210 | 3300027907 | Ga0207428_10172169 | Ga0207428_101721692 | 267 |
| 211 | 3300028379 | Ga0268266_10020608 | Ga0268266_100206085 | 267 |
| 212 | 3300028381 | Ga0268264_10017043 | Ga0268264_100170434 | 267 |
| 213 | 3300028381 | Ga0268264_10073602 | Ga0268264_100736022 | 267 |
| 214 | 3300031548 | Ga0307408_100240622 | Ga0307408_1002406222 | 267 |
| 215 | 3300031731 | Ga0307405_10231923 | Ga0307405_102319232 | 267 |
| 216 | 3300031824 | Ga0307413_10067269 | Ga0307413_100672692 | 267 |
| 217 | 3300031824 | Ga0307413_10079261 | Ga0307413_100792612 | 267 |
| 218 | 3300031852 | Ga0307410_10018037 | Ga0307410_100180373 | 267 |
| 219 | 3300031901 | Ga0307406_10007147 | Ga0307406_100071475 | 267 |
| 220 | 3300031903 | Ga0307407_10022929 | Ga0307407_100229292 | 267 |
| 221 | 3300031911 | Ga0307412_10117246 | Ga0307412_101172462 | 267 |
| 222 | 3300031995 | Ga0307409_100017544 | Ga0307409_1000175442 | 267 |
| 223 | 3300031995 | Ga0307409_100071372 | Ga0307409_1000713722 | 267 |
| 224 | 3300032002 | Ga0307416_100018282 | Ga0307416_1000182825 | 267 |
| 225 | 3300032005 | Ga0307411_10015390 | Ga0307411_100153902 | 267 |
| 226 | 3300032126 | Ga0307415_100059713 | Ga0307415_1000597132 | 267 |
| 227 | 3300035691 | Ga0373931_0034411 | Ga0373931_0034411_1431_2249 | 267 |
| 228 | 3300037471 | Ga0395905_0178515 | Ga0395905_0178515_696_1508 | 267 |
| 229 | 3300038443 | Ga0395901_0353161 | Ga0395901_0353161_477_1289 | 267 |
| 230 | 3300044684 | Ga0466966_0098759 | Ga0466966_0098759_252_1064 | 267 |
| 231 | 3300044694 | Ga0466963_0052832 | Ga0466963_0052832_836_1648 | 267 |
| 232 | 3300044842 | Ga0466957_0004343 | Ga0466957_0004343_5862_6674 | 267 |
| 233 | 3300045049 | Ga0466959_0349305 | Ga0466959_0349305_80_892 | 267 |
| 234 | 3300045836 | Ga0466958_0231570 | Ga0466958_0231570_161_973 | 267 |
| 235 | 3300045976 | Ga0466967_0264415 | Ga0466967_0264415_535_1347 | 267 |
| 236 | 3300046539 | Ga0495621_0010315 | Ga0495621_0010315_283_1086 | 267 |
| 237 | 3300046684 | Ga0495669_0044331 | Ga0495669_0044331_339_1142 | 267 |
| 238 | 3300048905 | Ga0496102_0114084 | Ga0496102_0114084_871_1683 | 267 |
| 239 | 3300048908 | Ga0496105_0047438 | Ga0496105_0047438_564_1376 | 267 |
| 240 | 3300048909 | Ga0496106_0020518 | Ga0496106_0020518_2324_3136 | 267 |
| 241 | 3300048912 | Ga0496109_0412733 | Ga0496109_0412733_19_831 | 267 |
| 242 | 3300048913 | Ga0496110_0459299 | Ga0496110_0459299_232_1044 | 267 |
| 243 | 3300048915 | Ga0496112_0022605 | Ga0496112_0022605_3824_4642 | 267 |
| 244 | 3300048915 | Ga0496112_0277767 | Ga0496112_0277767_532_1344 | 267 |
| 245 | 3300050511 | nmdc:mga08y16_365949_c1 | nmdc:mga08y16_365949_c1_575_1378 | 267 |
| 246 | 3300005338 | Ga0068868_100100873 | Ga0068868_1001008732 | 268 |
| 247 | 3300005344 | Ga0070661_100385699 | Ga0070661_1003856992 | 268 |
| 248 | 3300005364 | Ga0070673_100184496 | Ga0070673_1001844962 | 268 |
| 249 | 3300005367 | Ga0070667_100031826 | Ga0070667_1000318262 | 268 |
| 250 | 3300005543 | Ga0070672_100095546 | Ga0070672_1000955462 | 268 |
| 251 | 3300005548 | Ga0070665_100583489 | Ga0070665_1005834892 | 268 |
| 252 | 3300005578 | Ga0068854_100142226 | Ga0068854_1001422262 | 268 |
| 253 | 3300005616 | Ga0068852_100159078 | Ga0068852_1001590781 | 268 |
| 254 | 3300005841 | Ga0068863_100177214 | Ga0068863_1001772142 | 268 |
| 255 | 3300005843 | Ga0068860_100102948 | Ga0068860_1001029482 | 268 |
| 256 | 3300005844 | Ga0068862_100008099 | Ga0068862_1000080993 | 268 |
| 257 | 3300006358 | Ga0068871_100017020 | Ga0068871_1000170203 | 268 |
| 258 | 3300006852 | Ga0075433_10059602 | Ga0075433_100596022 | 268 |
| 259 | 3300009098 | Ga0105245_10058496 | Ga0105245_100584962 | 268 |
| 260 | 3300009174 | Ga0105241_10115936 | Ga0105241_101159362 | 268 |
| 261 | 3300013308 | Ga0157375_10392549 | Ga0157375_103925492 | 268 |
| 262 | 3300025960 | Ga0207651_10178213 | Ga0207651_101782132 | 268 |
| 263 | 3300025972 | Ga0207668_10109279 | Ga0207668_101092792 | 268 |
| 264 | 3300025981 | Ga0207640_10145199 | Ga0207640_101451992 | 268 |
| 265 | 3300025986 | Ga0207658_10021251 | Ga0207658_100212512 | 268 |
| 266 | 3300026023 | Ga0207677_10004923 | Ga0207677_100049236 | 268 |
| 267 | 3300026035 | Ga0207703_10002285 | Ga0207703_1000228513 | 268 |
| 268 | 3300026067 | Ga0207678_10475773 | Ga0207678_104757732 | 268 |
| 269 | 3300026088 | Ga0207641_10414749 | Ga0207641_104147492 | 268 |
| 270 | 3300026121 | Ga0207683_10054989 | Ga0207683_100549892 | 268 |
| 271 | 3300028380 | Ga0268265_10002664 | Ga0268265_100026648 | 268 |
| 272 | 3300028380 | Ga0268265_10012275 | Ga0268265_100122755 | 268 |
| 273 | 3300028381 | Ga0268264_10069400 | Ga0268264_100694002 | 268 |
| 274 | 3300028381 | Ga0268264_10250653 | Ga0268264_102506532 | 268 |
| 275 | 3300031824 | Ga0307413_10058691 | Ga0307413_100586912 | 268 |
| 276 | 3300031852 | Ga0307410_10357608 | Ga0307410_103576082 | 268 |
| 277 | 3300031903 | Ga0307407_10003932 | Ga0307407_100039326 | 268 |
| 278 | 3300031903 | Ga0307407_10031419 | Ga0307407_100314192 | 268 |
| 279 | 3300031911 | Ga0307412_10043475 | Ga0307412_100434753 | 268 |
| 280 | 3300031995 | Ga0307409_100096516 | Ga0307409_1000965162 | 268 |
| 281 | 3300031995 | Ga0307409_100592003 | Ga0307409_1005920032 | 268 |
| 282 | 3300032002 | Ga0307416_100053576 | Ga0307416_1000535763 | 268 |
| 283 | 3300032004 | Ga0307414_10049847 | Ga0307414_100498473 | 268 |
| 284 | 3300032005 | Ga0307411_10015293 | Ga0307411_100152932 | 268 |
| 285 | 3300032005 | Ga0307411_10018070 | Ga0307411_100180702 | 268 |
| 286 | 3300032126 | Ga0307415_100028381 | Ga0307415_1000283812 | 268 |
| 287 | 3300042004 | Ga0439445_0000177 | Ga0439445_0000177_4108_4914 | 268 |
| 288 | 3300050515 | nmdc:mga0a205_1780_c1 | nmdc:mga0a205_1780_c1_15057_15863 | 268 |
| 289 | 3300001979 | JGI24740J21852_10007059 | JGI24740J21852_100070594 | 269 |
| 290 | 3300002067 | JGI24735J21928_10020098 | JGI24735J21928_100200982 | 269 |
| 291 | 3300005327 | Ga0070658_10013320 | Ga0070658_100133203 | 269 |
| 292 | 3300005329 | Ga0070683_100053787 | Ga0070683_1000537872 | 269 |
| 293 | 3300005336 | Ga0070680_100026291 | Ga0070680_1000262913 | 269 |
| 294 | 3300005339 | Ga0070660_100115074 | Ga0070660_1001150742 | 269 |
| 295 | 3300005341 | Ga0070691_10019274 | Ga0070691_100192743 | 269 |
| 296 | 3300005344 | Ga0070661_100015051 | Ga0070661_1000150512 | 269 |
| 297 | 3300005355 | Ga0070671_100005670 | Ga0070671_1000056708 | 269 |
| 298 | 3300005435 | Ga0070714_100100298 | Ga0070714_1001002982 | 269 |
| 299 | 3300005455 | Ga0070663_100018631 | Ga0070663_1000186312 | 269 |
| 300 | 3300005455 | Ga0070663_100136259 | Ga0070663_1001362592 | 269 |
| 301 | 3300005457 | Ga0070662_100205991 | Ga0070662_1002059912 | 269 |
| 302 | 3300005457 | Ga0070662_100316825 | Ga0070662_1003168252 | 269 |
| 303 | 3300005530 | Ga0070679_100490117 | Ga0070679_1004901171 | 269 |
| 304 | 3300005535 | Ga0070684_100009366 | Ga0070684_1000093665 | 269 |
| 305 | 3300005539 | Ga0068853_100021692 | Ga0068853_1000216922 | 269 |
| 306 | 3300005564 | Ga0070664_100004639 | Ga0070664_1000046395 | 269 |
| 307 | 3300005577 | Ga0068857_100014587 | Ga0068857_1000145874 | 269 |
| 308 | 3300005578 | Ga0068854_100009383 | Ga0068854_1000093832 | 269 |
| 309 | 3300005834 | Ga0068851_10016793 | Ga0068851_100167932 | 269 |
| 310 | 3300005843 | Ga0068860_100217294 | Ga0068860_1002172942 | 269 |
| 311 | 3300005844 | Ga0068862_100048076 | Ga0068862_1000480762 | 269 |
| 312 | 3300009093 | Ga0105240_10041798 | Ga0105240_100417982 | 269 |
| 313 | 3300009177 | Ga0105248_10024379 | Ga0105248_100243792 | 269 |
| 314 | 3300009545 | Ga0105237_10034968 | Ga0105237_100349684 | 269 |
| 315 | 3300009551 | Ga0105238_10011752 | Ga0105238_100117526 | 269 |
| 316 | 3300013100 | Ga0157373_10013649 | Ga0157373_100136492 | 269 |
| 317 | 3300013102 | Ga0157371_10066835 | Ga0157371_100668352 | 269 |
| 318 | 3300013104 | Ga0157370_10018022 | Ga0157370_100180223 | 269 |
| 319 | 3300013307 | Ga0157372_10029222 | Ga0157372_100292223 | 269 |
| 320 | 3300025321 | Ga0207656_10012915 | Ga0207656_100129152 | 269 |
| 321 | 3300025904 | Ga0207647_10007040 | Ga0207647_100070407 | 269 |
| 322 | 3300025909 | Ga0207705_10013751 | Ga0207705_100137514 | 269 |
| 323 | 3300025909 | Ga0207705_10052239 | Ga0207705_100522392 | 269 |
| 324 | 3300025913 | Ga0207695_10024793 | Ga0207695_100247933 | 269 |
| 325 | 3300025914 | Ga0207671_10058845 | Ga0207671_100588452 | 269 |
| 326 | 3300025917 | Ga0207660_10017082 | Ga0207660_100170824 | 269 |
| 327 | 3300025919 | Ga0207657_10002976 | Ga0207657_1000297618 | 269 |
| 328 | 3300025920 | Ga0207649_10002986 | Ga0207649_100029865 | 269 |
| 329 | 3300025921 | Ga0207652_10188989 | Ga0207652_101889892 | 269 |
| 330 | 3300025921 | Ga0207652_10357899 | Ga0207652_103578992 | 269 |
| 331 | 3300025923 | Ga0207681_10341162 | Ga0207681_103411622 | 269 |
| 332 | 3300025924 | Ga0207694_10019750 | Ga0207694_100197502 | 269 |
| 333 | 3300025932 | Ga0207690_10005072 | Ga0207690_100050722 | 269 |
| 334 | 3300025933 | Ga0207706_10265119 | Ga0207706_102651192 | 269 |
| 335 | 3300025941 | Ga0207711_10585925 | Ga0207711_105859252 | 269 |
| 336 | 3300025944 | Ga0207661_10054698 | Ga0207661_100546982 | 269 |
| 337 | 3300025949 | Ga0207667_10014151 | Ga0207667_100141512 | 269 |
| 338 | 3300025972 | Ga0207668_10111464 | Ga0207668_101114642 | 269 |
| 339 | 3300025981 | Ga0207640_10009141 | Ga0207640_100091415 | 269 |
| 340 | 3300025986 | Ga0207658_10001752 | Ga0207658_1000175213 | 269 |
| 341 | 3300026041 | Ga0207639_10002465 | Ga0207639_100024654 | 269 |
| 342 | 3300026067 | Ga0207678_10016862 | Ga0207678_100168626 | 269 |
| 343 | 3300026078 | Ga0207702_10021273 | Ga0207702_100212735 | 269 |
| 344 | 3300026095 | Ga0207676_10305558 | Ga0207676_103055582 | 269 |
| 345 | 3300026116 | Ga0207674_10001374 | Ga0207674_1000137421 | 269 |
| 346 | 3300026121 | Ga0207683_10259742 | Ga0207683_102597422 | 269 |
| 347 | 3300026142 | Ga0207698_10008759 | Ga0207698_100087595 | 269 |
| 348 | 3300028380 | Ga0268265_10118260 | Ga0268265_101182602 | 269 |
| 349 | 3300028381 | Ga0268264_10226028 | Ga0268264_102260282 | 269 |
| 350 | 3300031731 | Ga0307405_10096635 | Ga0307405_100966352 | 269 |
| 351 | 3300031824 | Ga0307413_10116274 | Ga0307413_101162742 | 269 |
| 352 | 3300031852 | Ga0307410_10387993 | Ga0307410_103879931 | 269 |
| 353 | 3300031901 | Ga0307406_10124308 | Ga0307406_101243082 | 269 |
| 354 | 3300031901 | Ga0307406_10204124 | Ga0307406_102041242 | 269 |
| 355 | 3300031903 | Ga0307407_10341561 | Ga0307407_103415612 | 269 |
| 356 | 3300031995 | Ga0307409_100588291 | Ga0307409_1005882911 | 269 |
| 357 | 3300032002 | Ga0307416_100201263 | Ga0307416_1002012632 | 269 |
| 358 | 3300032002 | Ga0307416_100297325 | Ga0307416_1002973252 | 269 |
| 359 | 3300032004 | Ga0307414_10132973 | Ga0307414_101329732 | 269 |
| 360 | 3300032004 | Ga0307414_10251046 | Ga0307414_102510462 | 269 |
| 361 | 3300032126 | Ga0307415_100034428 | Ga0307415_1000344282 | 269 |
| 362 | 3300037312 | Ga0395899_0040723 | Ga0395899_0040723_2224_3033 | 269 |
| 363 | 3300037312 | Ga0395899_0096667 | Ga0395899_0096667_733_1542 | 269 |
| 364 | 3300037418 | Ga0395900_0018045 | Ga0395900_0018045_2756_3565 | 269 |
| 365 | 3300037418 | Ga0395900_0306173 | Ga0395900_0306173_180_989 | 269 |
| 366 | 3300037466 | Ga0395898_0019810 | Ga0395898_0019810_1061_1870 | 269 |
| 367 | 3300037471 | Ga0395905_0005612 | Ga0395905_0005612_8149_8958 | 269 |
| 368 | 3300037471 | Ga0395905_0159350 | Ga0395905_0159350_380_1189 | 269 |
| 369 | 3300037471 | Ga0395905_0431229 | Ga0395905_0431229_371_1180 | 269 |
| 370 | 3300038443 | Ga0395901_0047669 | Ga0395901_0047669_315_1124 | 269 |
| 371 | 3300038443 | Ga0395901_0072620 | Ga0395901_0072620_1525_2334 | 269 |
| 372 | 3300038443 | Ga0395901_0436685 | Ga0395901_0436685_368_1177 | 269 |
| 373 | 3300044658 | Ga0466972_0124463 | Ga0466972_0124463_63_872 | 269 |
| 374 | 3300044694 | Ga0466963_0079472 | Ga0466963_0079472_83_892 | 269 |
| 375 | 3300044765 | Ga0466970_0050850 | Ga0466970_0050850_1375_2184 | 269 |
| 376 | 3300046684 | Ga0495669_0017748 | Ga0495669_0017748_153_962 | 269 |
| 377 | 3300048911 | Ga0496108_0001136 | Ga0496108_0001136_16180_16992 | 269 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ww4-assembly1.cif.gz_B | a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase | 0.8674 | 2 | 266 |
| 1uek-assembly1.cif.gz_A | crystal structure of 4-(cytidine 5'-diphospho)-2c-methyl-d-erythritol kinase | 0.8567 | 4 | 268 |
| 4ed4-assembly1.cif.gz_A | crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp | 0.8559 | 3 | 269 |
| 2ww4-assembly1.cif.gz_B | a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase | 0.8528 | 2 | 266 |
| 4ed4-assembly1.cif.gz_A | crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp | 0.847 | 3 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8S2G0_72_245_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.9144 | 1 | 159 | 3.30.230.10 |
| 4dxlA01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.904 | 2 | 159 | 3.30.230.10 |
| 2v2qB01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8841 | 1 | 159 | 3.30.230.10 |
| 2v2qB01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8789 | 1 | 159 | 3.30.230.10 |
| af_Q2G0S8_1_157_3.30.230.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.8656 | 1 | 158 | 3.30.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A239H5K7-F1-model_v4 | 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) | 0.9775 | 46 | 269 |
GO:0005524
GO:0016114 GO:0019288 GO:0050515 |
| AF-A0A7C1UHK2-F1-model_v4 | 4-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | 0.9763 | 2 | 102 |
GO:0050515
|
| AF-A0A520Y9U1-F1-model_v4 | 4-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | 0.975 | 98 | 269 |
GO:0005524
GO:0050515 |
| AF-A0A838VA13-F1-model_v4 | 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) | 0.9712 | 4 | 269 |
GO:0005524
GO:0016114 GO:0019288 GO:0050515 |
| AF-A0A520Y9U1-F1-model_v4 | 4-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | 0.964 | 98 | 269 |
GO:0005524
GO:0050515 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar