F427698

General Info

Members Datasets Scaffolds Average Seq Length
377 170 754 341

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10022999|Ga0157376_100229996
Length 367
Sequence MAFYVSIGPIFTVQLIILNTQFDSMKKWIVLTVLLIFLVAAFLVWKLFGPTVKQPEEKFLYIRTGSTYNAVVKDLQNRKIIKSAEGFNLISRALKYTIVKPGKYEIKKGMNLFNLVRMLKNGRQTPIDLVIIKFRTKEEFAGRIGREFETDSLQMLNFLSNHDSLEHYHLDTNTWACAIIPDTYRYFWNSTPTRIFSKLYAVSEGFWTSERKQELKDNNLTPVQAYTLASIIEEETNLKTDKGKIASVYINRIDKGISLQADPTIKFALKDFGLKRIYEKYLAVQSPYNTYTNKGLPPGPICTPSVETLKEVINAPKTDYIYFVADSDLNGSSVFTSNYKDHMKYAKLYQQALNKQDSIKQARENMQ

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
143 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
165 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
166 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
167 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
168 2738541278 Niastella sp. CF465 Isolate Unclassified
169 2818991444 Filimonas endophytica 3197 Isolate Unclassified
170 2914759650 Rhizosphaericola mali Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.33
Nodule 0
Rhizoplane 0.27
Rhizosphere 96.29
Stem 0
Stem Tuber 0
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10022999 3300014969 Bacteria 4870
2 rootH1_10021375 3300003323 Bacteria 11386
3 Ga0065714_10076655 3300005288 Bacteria 2769
4 Ga0065704_10114337 3300005289 Bacteria 1893
5 Ga0065712_10005108 3300005290 Bacteria 3959
6 Ga0070658_10008410 3300005327 Bacteria 8297
7 Ga0070658_10036387 3300005327 Bacteria 3968
8 Ga0070658_10043984 3300005327 Bacteria 3608
9 Ga0070658_10079891 3300005327 Bacteria 2686
10 Ga0070658_10344770 3300005327 Unclassified 1274
11 Ga0070683_100000211 3300005329 Bacteria 39486
12 Ga0070683_100003981 3300005329 Bacteria 12096
13 Ga0070683_100125343 3300005329 Bacteria 2428
14 Ga0070690_100019967 3300005330 Bacteria 4077
15 Ga0070690_100143780 3300005330 Bacteria 1621
16 Ga0070690_100146515 3300005330 Unclassified 1607
17 Ga0070670_100043976 3300005331 Bacteria 3840
18 Ga0070670_100094499 3300005331 Bacteria 2571
19 Ga0070670_100094938 3300005331 Bacteria 2565
20 Ga0070670_100102221 3300005331 Bacteria 2468
21 Ga0068869_100016129 3300005334 Bacteria 5031
22 Ga0068869_100043864 3300005334 Unclassified 3215
23 Ga0068869_100235880 3300005334 Bacteria 1455
24 Ga0070666_10002600 3300005335 Bacteria 10892
25 Ga0070680_100016888 3300005336 Bacteria 5745
26 Ga0070680_100025265 3300005336 Bacteria 4746
27 Ga0070680_100041019 3300005336 Bacteria 3752
28 Ga0070682_100001184 3300005337 Bacteria 14886
29 Ga0070682_100091336 3300005337 Unclassified 1993
30 Ga0068868_100008958 3300005338 Bacteria 7180
31 Ga0068868_100012580 3300005338 Bacteria 6188
32 Ga0070660_100023036 3300005339 Bacteria 4611
33 Ga0070660_100089040 3300005339 Bacteria 2432
34 Ga0070660_100152552 3300005339 Bacteria 1858
35 Ga0070689_100004082 3300005340 Bacteria 9834
36 Ga0070689_100262164 3300005340 Bacteria 1429
37 Ga0070689_100292646 3300005340 Bacteria 1353
38 Ga0070691_10032536 3300005341 Unclassified 2450
39 Ga0070661_100004977 3300005344 Bacteria 9153
40 Ga0070669_100043293 3300005353 Bacteria 3278
41 Ga0070675_100005185 3300005354 Bacteria 9936
42 Ga0070675_100078766 3300005354 Bacteria 2745
43 Ga0070675_100359161 3300005354 Bacteria 1293
44 Ga0070671_100073189 3300005355 Bacteria 2862
45 Ga0070671_100102273 3300005355 Bacteria 2404
46 Ga0070674_100151917 3300005356 Bacteria 1748
47 Ga0070673_100041322 3300005364 Bacteria 3546
48 Ga0070673_100061030 3300005364 Bacteria 2989
49 Ga0070673_100210194 3300005364 Bacteria 1680
50 Ga0070688_100003172 3300005365 Bacteria 8420
51 Ga0070688_100025164 3300005365 Bacteria 3522
52 Ga0070688_100054822 3300005365 Bacteria 2498
53 Ga0070688_100055470 3300005365 Bacteria 2485
54 Ga0070659_100017471 3300005366 Bacteria 5402
55 Ga0070659_100029805 3300005366 Bacteria 4218
56 Ga0070659_100083202 3300005366 Bacteria 2558
57 Ga0070659_100160579 3300005366 Bacteria 1837
58 Ga0070667_100267922 3300005367 Bacteria 1531
59 Ga0070663_100014614 3300005455 Bacteria 5044
60 Ga0070678_100159763 3300005456 Unclassified 1824
61 Ga0070662_100002740 3300005457 Bacteria 10892
62 Ga0070662_100032018 3300005457 Bacteria 3695
63 Ga0070681_10038610 3300005458 Bacteria 4787
64 Ga0068867_100012240 3300005459 Bacteria 6064
65 Ga0068867_100057445 3300005459 Bacteria 2882
66 Ga0070685_10038976 3300005466 Bacteria 2697
67 Ga0070685_10155728 3300005466 Bacteria 1452
68 Ga0070707_100466875 3300005468 Bacteria 1223
69 Ga0070679_100008525 3300005530 Bacteria 9657
70 Ga0070679_100035544 3300005530 Bacteria 4943
71 Ga0070679_100043059 3300005530 Bacteria 4497
72 Ga0070679_100059125 3300005530 Bacteria 3820
73 Ga0070679_100094989 3300005530 Bacteria 2969
74 Ga0070684_100000568 3300005535 Bacteria 25497
75 Ga0070684_100304437 3300005535 Unclassified 1463
76 Ga0068853_100007326 3300005539 Bacteria 8830
77 Ga0068853_100031245 3300005539 Unclassified 4504
78 Ga0068853_100077770 3300005539 Bacteria 2899
79 Ga0068853_100291035 3300005539 Bacteria 1508
80 Ga0068853_100452645 3300005539 Bacteria 1207
81 Ga0070693_100003857 3300005547 Bacteria 7026
82 Ga0070665_100073574 3300005548 Bacteria 3423
83 Ga0068855_100020250 3300005563 Bacteria 7985
84 Ga0068855_100021324 3300005563 Bacteria 7770
85 Ga0068855_100071679 3300005563 Bacteria 4028
86 Ga0068855_100448395 3300005563 Bacteria 1408
87 Ga0070664_100001475 3300005564 Bacteria 18739
88 Ga0070664_100029557 3300005564 Bacteria 4569
89 Ga0070664_100044587 3300005564 Bacteria 3745
90 Ga0068857_100001702 3300005577 Bacteria 17680
91 Ga0068857_100186025 3300005577 Unclassified 1891
92 Ga0068857_100201748 3300005577 Bacteria 1813
93 Ga0068857_100202271 3300005577 Unclassified 1811
94 Ga0068854_100074676 3300005578 Bacteria 2487
95 Ga0068856_100031637 3300005614 Bacteria 5178
96 Ga0068856_100341322 3300005614 Bacteria 1516
97 Ga0068852_100002617 3300005616 Bacteria 12436
98 Ga0068852_100027499 3300005616 Bacteria 4636
99 Ga0068859_100000186 3300005617 Bacteria 60206
100 Ga0068859_100012688 3300005617 Bacteria 8472
101 Ga0068859_100015578 3300005617 Bacteria 7640
102 Ga0068859_100062636 3300005617 Bacteria 3750
103 Ga0068859_100070605 3300005617 Bacteria 3528
104 Ga0068859_100101819 3300005617 Bacteria 2929
105 Ga0068864_100021211 3300005618 Bacteria 5441
106 Ga0068866_10164939 3300005718 Unclassified 1295
107 Ga0068861_100003143 3300005719 Bacteria 10914
108 Ga0068861_100050719 3300005719 Bacteria 3148
109 Ga0068863_100002992 3300005841 Bacteria 16703
110 Ga0068863_100133973 3300005841 Bacteria 2366
111 Ga0068863_100234916 3300005841 Bacteria 1769
112 Ga0068863_100381478 3300005841 Bacteria 1376
113 Ga0068858_100006813 3300005842 Bacteria 11115
114 Ga0068858_100009912 3300005842 Bacteria 9050
115 Ga0068858_100033527 3300005842 Bacteria 4764
116 Ga0068860_100007278 3300005843 Bacteria 11071
117 Ga0068860_100109905 3300005843 Bacteria 2634
118 Ga0068860_100236193 3300005843 Bacteria 1777
119 Ga0068862_100235784 3300005844 Unclassified 1661
120 Ga0097621_100026043 3300006237 Bacteria 4584
121 Ga0097621_100027647 3300006237 Bacteria 4463
122 Ga0097621_100032016 3300006237 Bacteria 4177
123 Ga0097621_100264799 3300006237 Bacteria 1509
124 Ga0068871_100011135 3300006358 Bacteria 6594
125 Ga0068871_100036404 3300006358 Bacteria 3919
126 Ga0068865_100053974 3300006881 Unclassified 2790
127 Ga0068865_100154890 3300006881 Bacteria 1742
128 Ga0097620_100000186 3300006931 Bacteria 60206
129 Ga0097620_100012688 3300006931 Bacteria 8472
130 Ga0097620_100015579 3300006931 Bacteria 7640
131 Ga0097620_100062636 3300006931 Bacteria 3750
132 Ga0097620_100070605 3300006931 Bacteria 3528
133 Ga0097620_100101815 3300006931 Bacteria 2929
134 Ga0105240_10002244 3300009093 Bacteria 31388
135 Ga0105240_10077907 3300009093 Bacteria 4083
136 Ga0111539_10003454 3300009094 Bacteria 20812
137 Ga0105247_10008274 3300009101 Bacteria 6347
138 Ga0105247_10008423 3300009101 Bacteria 6283
139 Ga0105241_10006152 3300009174 Bacteria 8848
140 Ga0105241_10121601 3300009174 Unclassified 2103
141 Ga0105242_10046111 3300009176 Unclassified 3535
142 Ga0105242_10077363 3300009176 Bacteria 2775
143 Ga0105237_10017999 3300009545 Bacteria 7320
144 Ga0105249_10029458 3300009553 Bacteria 4958
145 Ga0105249_10035187 3300009553 Bacteria 4541
146 Ga0105249_10215614 3300009553 Bacteria 1886
147 Ga0105239_10046154 3300010375 Bacteria 4773
148 Ga0105239_10055013 3300010375 Bacteria 4364
149 Ga0105239_10204231 3300010375 Bacteria 2214
150 Ga0105246_10010026 3300011119 Bacteria 5845
151 Ga0157373_10017978 3300013100 Bacteria 5148
152 Ga0157373_10127293 3300013100 Bacteria 1791
153 Ga0157371_10000318 3300013102 Bacteria 62463
154 Ga0157371_10000656 3300013102 Bacteria 40997
155 Ga0157371_10002847 3300013102 Bacteria 16159
156 Ga0157371_10014831 3300013102 Bacteria 5867
157 Ga0157371_10016729 3300013102 Bacteria 5464
158 Ga0157371_10018394 3300013102 Bacteria 5166
159 Ga0157371_10033147 3300013102 Bacteria 3713
160 Ga0157371_10041477 3300013102 Bacteria 3283
161 Ga0157371_10075890 3300013102 Bacteria 2380
162 Ga0157371_10081834 3300013102 Unclassified 2286
163 Ga0157371_10255264 3300013102 Bacteria 1263
164 Ga0157370_10000795 3300013104 Bacteria 39727
165 Ga0157370_10000916 3300013104 Bacteria 37388
166 Ga0157370_10001221 3300013104 Bacteria 32173
167 Ga0157370_10001314 3300013104 Bacteria 30974
168 Ga0157369_10018092 3300013105 Bacteria 7904
169 Ga0157369_10107989 3300013105 Unclassified 2960
170 Ga0157374_10012169 3300013296 Bacteria 7476
171 Ga0157374_10083999 3300013296 Bacteria 3026
172 Ga0157374_10113242 3300013296 Bacteria 2611
173 Ga0157374_10147054 3300013296 Bacteria 2289
174 Ga0157378_10033743 3300013297 Bacteria 4526
175 Ga0157378_10098293 3300013297 Bacteria 2669
176 Ga0157378_10255949 3300013297 Bacteria 1678
177 Ga0157378_10530638 3300013297 Bacteria 1180
178 Ga0163162_10004586 3300013306 Bacteria 13309
179 Ga0163162_10006332 3300013306 Bacteria 11462
180 Ga0163162_10032092 3300013306 Bacteria 5214
181 Ga0163162_10065552 3300013306 Bacteria 3679
182 Ga0163162_10153822 3300013306 Bacteria 2419
183 Ga0163162_10213237 3300013306 Bacteria 2061
184 Ga0163162_10416009 3300013306 Bacteria 1476
185 Ga0157372_10009417 3300013307 Bacteria 10391
186 Ga0157372_10027286 3300013307 Bacteria 6217
187 Ga0157372_10028710 3300013307 Bacteria 6073
188 Ga0157372_10052136 3300013307 Bacteria 4554
189 Ga0157372_10056081 3300013307 Bacteria 4402
190 Ga0157372_10076899 3300013307 Bacteria 3769
191 Ga0157372_10085072 3300013307 Bacteria 3586
192 Ga0157372_10092796 3300013307 Bacteria 3435
193 Ga0157372_10239553 3300013307 Bacteria 2105
194 Ga0157375_10005137 3300013308 Bacteria 11365
195 Ga0157375_10008784 3300013308 Bacteria 8854
196 Ga0157375_10012199 3300013308 Bacteria 7617
197 Ga0157375_10038974 3300013308 Bacteria 4568
198 Ga0157375_10153458 3300013308 Bacteria 2440
199 Ga0163163_10000462 3300014325 Bacteria 37124
200 Ga0163163_10281234 3300014325 Bacteria 1715
201 Ga0157380_10001175 3300014326 Bacteria 16963
202 Ga0157377_10012210 3300014745 Bacteria 4314
203 Ga0157377_10014418 3300014745 Bacteria 4022
204 Ga0157377_10133567 3300014745 Bacteria 1518
205 Ga0157379_10083882 3300014968 Unclassified 2856
206 Ga0157376_10019448 3300014969 Bacteria 5235
207 Ga0157376_10084675 3300014969 Bacteria 2730
208 Ga0157376_10108796 3300014969 Bacteria 2436
209 Ga0157376_10166843 3300014969 Unclassified 2001
210 Ga0157376_10308551 3300014969 Bacteria 1500
211 Ga0163161_10055618 3300017792 Bacteria 2873
212 Ga0163161_10061115 3300017792 Unclassified 2742
213 Ga0163161_10062533 3300017792 Unclassified 2712
214 Ga0163161_10317990 3300017792 Bacteria 1230
215 Ga0207710_10003698 3300025900 Bacteria 6780
216 Ga0207710_10012990 3300025900 Bacteria 3507
217 Ga0207680_10104297 3300025903 Bacteria 1827
218 Ga0207647_10013381 3300025904 Bacteria 5690
219 Ga0207647_10058434 3300025904 Bacteria 2362
220 Ga0207705_10018554 3300025909 Bacteria 4973
221 Ga0207705_10039922 3300025909 Bacteria 3364
222 Ga0207705_10059637 3300025909 Bacteria 2754
223 Ga0207705_10142231 3300025909 Bacteria 1792
224 Ga0207705_10143214 3300025909 Bacteria 1786
225 Ga0207707_10012595 3300025912 Bacteria 7349
226 Ga0207707_10090822 3300025912 Bacteria 2669
227 Ga0207695_10011412 3300025913 Bacteria 10769
228 Ga0207695_10078177 3300025913 Bacteria 3357
229 Ga0207695_10195741 3300025913 Unclassified 1937
230 Ga0207671_10184078 3300025914 Unclassified 1626
231 Ga0207660_10008625 3300025917 Bacteria 6593
232 Ga0207660_10030171 3300025917 Bacteria 3726
233 Ga0207660_10033634 3300025917 Bacteria 3548
234 Ga0207660_10035020 3300025917 Bacteria 3483
235 Ga0207660_10120136 3300025917 Bacteria 1989
236 Ga0207657_10005296 3300025919 Bacteria 13515
237 Ga0207657_10053889 3300025919 Bacteria 3482
238 Ga0207657_10097533 3300025919 Bacteria 2444
239 Ga0207657_10208763 3300025919 Bacteria 1568
240 Ga0207657_10220101 3300025919 Unclassified 1521
241 Ga0207649_10001781 3300025920 Bacteria 12322
242 Ga0207652_10000016 3300025921 Bacteria 188815
243 Ga0207652_10000171 3300025921 Bacteria 69902
244 Ga0207652_10000739 3300025921 Bacteria 31538
245 Ga0207652_10014701 3300025921 Bacteria 6344
246 Ga0207652_10021964 3300025921 Bacteria 5272
247 Ga0207652_10029365 3300025921 Bacteria 4596
248 Ga0207681_10031304 3300025923 Bacteria 3474
249 Ga0207650_10040821 3300025925 Unclassified 3397
250 Ga0207659_10058014 3300025926 Bacteria 2778
251 Ga0207659_10098247 3300025926 Bacteria 2201
252 Ga0207687_10200472 3300025927 Bacteria 1559
253 Ga0207690_10016583 3300025932 Bacteria 4486
254 Ga0207690_10065477 3300025932 Bacteria 2485
255 Ga0207690_10122942 3300025932 Bacteria 1888
256 Ga0207706_10003848 3300025933 Bacteria 14295
257 Ga0207670_10011502 3300025936 Bacteria 5143
258 Ga0207670_10021624 3300025936 Bacteria 3973
259 Ga0207670_10102251 3300025936 Unclassified 2048
260 Ga0207704_10029667 3300025938 Bacteria 3055
261 Ga0207691_10050518 3300025940 Bacteria 3806
262 Ga0207689_10003166 3300025942 Bacteria 15084
263 Ga0207689_10003496 3300025942 Bacteria 14357
264 Ga0207689_10005595 3300025942 Bacteria 11200
265 Ga0207689_10056265 3300025942 Bacteria 3236
266 Ga0207689_10058714 3300025942 Unclassified 3164
267 Ga0207661_10000688 3300025944 Bacteria 21928
268 Ga0207661_10094009 3300025944 Bacteria 2503
269 Ga0207661_10164698 3300025944 Bacteria 1926
270 Ga0207679_10000391 3300025945 Bacteria 31474
271 Ga0207667_10000539 3300025949 Bacteria 49978
272 Ga0207667_10020979 3300025949 Bacteria 7246
273 Ga0207667_10023424 3300025949 Bacteria 6799
274 Ga0207667_10026698 3300025949 Bacteria 6303
275 Ga0207712_10008681 3300025961 Bacteria 6427
276 Ga0207712_10018495 3300025961 Bacteria 4540
277 Ga0207712_10158219 3300025961 Bacteria 1757
278 Ga0207668_10214169 3300025972 Bacteria 1542
279 Ga0207640_10040775 3300025981 Unclassified 2948
280 Ga0207658_10103401 3300025986 Bacteria 2236
281 Ga0207658_10187250 3300025986 Bacteria 1718
282 Ga0207658_10203834 3300025986 Bacteria 1653
283 Ga0207677_10008332 3300026023 Bacteria 5783
284 Ga0207677_10159513 3300026023 Bacteria 1751
285 Ga0207639_10003619 3300026041 Bacteria 10380
286 Ga0207639_10023014 3300026041 Unclassified 4494
287 Ga0207639_10345180 3300026041 Bacteria 1328
288 Ga0207678_10055656 3300026067 Bacteria 3407
289 Ga0207678_10112120 3300026067 Bacteria 2326
290 Ga0207702_10033398 3300026078 Bacteria 4297
291 Ga0207641_10000194 3300026088 Bacteria 82153
292 Ga0207641_10190241 3300026088 Bacteria 1886
293 Ga0207648_10028275 3300026089 Bacteria 4972
294 Ga0207648_10044593 3300026089 Unclassified 3890
295 Ga0207648_10110406 3300026089 Bacteria 2414
296 Ga0207648_10151774 3300026089 Bacteria 2044
297 Ga0207676_10002355 3300026095 Bacteria 13499
298 Ga0207676_10035863 3300026095 Bacteria 3769
299 Ga0207676_10038323 3300026095 Unclassified 3657
300 Ga0207674_10001890 3300026116 Bacteria 26652
301 Ga0207674_10011135 3300026116 Bacteria 10115
302 Ga0207674_10024390 3300026116 Bacteria 6465
303 Ga0207674_10038548 3300026116 Bacteria 4957
304 Ga0207674_10331552 3300026116 Unclassified 1471
305 Ga0207675_100000359 3300026118 Bacteria 43729
306 Ga0207675_100066529 3300026118 Bacteria 3369
307 Ga0207683_10019477 3300026121 Bacteria 5794
308 Ga0207698_10001651 3300026142 Bacteria 13013
309 Ga0207428_10008958 3300027907 Bacteria 9014
310 Ga0268266_10026586 3300028379 Unclassified 4925
311 Ga0268266_10099447 3300028379 Bacteria 2561
312 Ga0268265_10009168 3300028380 Bacteria 6688
313 Ga0268264_10005141 3300028381 Bacteria 11086
314 Ga0268264_10006854 3300028381 Bacteria 9564
315 Ga0268264_10034681 3300028381 Bacteria 4152
316 Ga0307515_10000001 3300028794 Bacteria 4259510
317 Ga0307512_10044885 3300030522 Bacteria 3627
318 Ga0265327_10000440 3300031251 Bacteria 75453
319 Ga0307509_10044028 3300031507 Bacteria 4824
320 Ga0307414_10127422 3300032004 Bacteria 1970
321 Ga0373943_0061252 3300035170 Bacteria 1881
322 Ga0373955_0043158 3300035172 Bacteria 2425
323 Ga0373947_0121752 3300035725 Bacteria 1658
324 Ga0373937_0405762 3300036401 Unclassified 1293
325 Ga0373925_0079620 3300037068 Unclassified 2490
326 Ga0395899_0011529 3300037312 Bacteria 6767
327 Ga0395899_0013887 3300037312 Bacteria 6152
328 Ga0395899_0247487 3300037312 Bacteria 1224
329 Ga0395900_0018416 3300037418 Bacteria 7122
330 Ga0395900_0032385 3300037418 Bacteria 5376
331 Ga0395900_0038608 3300037418 Bacteria 4922
332 Ga0395900_0148974 3300037418 Unclassified 2391
333 Ga0395900_0194673 3300037418 Bacteria 2054
334 Ga0395900_0586786 3300037418 Bacteria 1056
335 Ga0395898_0007047 3300037466 Bacteria 11946
336 Ga0395898_0029934 3300037466 Bacteria 5450
337 Ga0395898_0118591 3300037466 Bacteria 2535
338 Ga0395898_0224326 3300037466 Bacteria 1792
339 Ga0395905_0005098 3300037471 Bacteria 13502
340 Ga0395901_0012025 3300038443 Bacteria 8780
341 Ga0395901_0016817 3300038443 Bacteria 7454
342 Ga0395901_0112626 3300038443 Bacteria 2857
343 Ga0439436_0014476 3300041404 Bacteria 2378
344 Ga0439466_0028479 3300041411 Bacteria 1929
345 Ga0451843_1472935 3300041509 Bacteria 1129
346 Ga0451853_1888965 3300041512 Bacteria 2104
347 Ga0439442_009487 3300042002 Bacteria 1969
348 Ga0439457_000268 3300042014 Bacteria 14301
349 Ga0439434_0030213 3300042435 Bacteria 1644
350 Ga0466969_0000091 3300044656 Bacteria 46523
351 Ga0466964_0005934 3300044706 Bacteria 4549
352 Ga0466968_0049820 3300044735 Unclassified 1785
353 Ga0466957_0000460 3300044842 Bacteria 20175
354 Ga0495653_0070640 3300046463 Bacteria 2613
355 Ga0495628_0006489 3300046516 Bacteria 10215
356 Ga0495630_0038442 3300046517 Bacteria 3579
357 Ga0495587_0085501 3300046536 Unclassified 1826
358 Ga0495668_0001051 3300046616 Bacteria 29297
359 Ga0495635_0137088 3300046663 Bacteria 1668
360 Ga0495604_0097861 3300047317 Bacteria 2163
361 Ga0495676_0120553 3300047321 Bacteria 1909
362 Ga0495676_0165621 3300047321 Bacteria 1560
363 Ga0496110_0274859 3300048913 Bacteria 1534
364 Ga0501034_0000017 3300049571 Bacteria 285938
365 Ga0501034_0162787 3300049571 Bacteria 2201
366 Ga0501070_0143939 3300049586 Bacteria 1968
367 Ga0501225_0001093 3300049705 Bacteria 8507
368 Ga0501044_0060128 3300049823 Bacteria 3892
369 nmdc:mga08y16_3350_c1 3300050511 Bacteria 16593
370 Ga0500578_0000019 3300053086 Bacteria 169042
371 Ga0500644_0002938 3300053088 Bacteria 4231
372 Ga0500646_0037618 3300053090 Bacteria 1352
373 Ga0500650_0096128 3300053098 Bacteria 1387
374 Ga0500611_000092 3300053727 Bacteria 25966
375 2738727818 2738541278 Bacteria 9755573
376 2819587164 2818991444 Bacteria 6968812
377 2914763693 2914759650 Bacteria 4701441
378 Ga0157376_10022999
379 rootH1_10021375
380 Ga0065714_10076655
381 Ga0065704_10114337
382 Ga0065712_10005108
383 Ga0070658_10008410
384 Ga0070658_10036387
385 Ga0070658_10043984
386 Ga0070658_10079891
387 Ga0070658_10344770
388 Ga0070683_100000211
389 Ga0070683_100003981
390 Ga0070683_100125343
391 Ga0070690_100019967
392 Ga0070690_100143780
393 Ga0070690_100146515
394 Ga0070670_100043976
395 Ga0070670_100094499
396 Ga0070670_100094938
397 Ga0070670_100102221
398 Ga0068869_100016129
399 Ga0068869_100043864
400 Ga0068869_100235880
401 Ga0070666_10002600
402 Ga0070680_100016888
403 Ga0070680_100025265
404 Ga0070680_100041019
405 Ga0070682_100001184
406 Ga0070682_100091336
407 Ga0068868_100008958
408 Ga0068868_100012580
409 Ga0070660_100023036
410 Ga0070660_100089040
411 Ga0070660_100152552
412 Ga0070689_100004082
413 Ga0070689_100262164
414 Ga0070689_100292646
415 Ga0070691_10032536
416 Ga0070661_100004977
417 Ga0070669_100043293
418 Ga0070675_100005185
419 Ga0070675_100078766
420 Ga0070675_100359161
421 Ga0070671_100073189
422 Ga0070671_100102273
423 Ga0070674_100151917
424 Ga0070673_100041322
425 Ga0070673_100061030
426 Ga0070673_100210194
427 Ga0070688_100003172
428 Ga0070688_100025164
429 Ga0070688_100054822
430 Ga0070688_100055470
431 Ga0070659_100017471
432 Ga0070659_100029805
433 Ga0070659_100083202
434 Ga0070659_100160579
435 Ga0070667_100267922
436 Ga0070663_100014614
437 Ga0070678_100159763
438 Ga0070662_100002740
439 Ga0070662_100032018
440 Ga0070681_10038610
441 Ga0068867_100012240
442 Ga0068867_100057445
443 Ga0070685_10038976
444 Ga0070685_10155728
445 Ga0070707_100466875
446 Ga0070679_100008525
447 Ga0070679_100035544
448 Ga0070679_100043059
449 Ga0070679_100059125
450 Ga0070679_100094989
451 Ga0070684_100000568
452 Ga0070684_100304437
453 Ga0068853_100007326
454 Ga0068853_100031245
455 Ga0068853_100077770
456 Ga0068853_100291035
457 Ga0068853_100452645
458 Ga0070693_100003857
459 Ga0070665_100073574
460 Ga0068855_100020250
461 Ga0068855_100021324
462 Ga0068855_100071679
463 Ga0068855_100448395
464 Ga0070664_100001475
465 Ga0070664_100029557
466 Ga0070664_100044587
467 Ga0068857_100001702
468 Ga0068857_100186025
469 Ga0068857_100201748
470 Ga0068857_100202271
471 Ga0068854_100074676
472 Ga0068856_100031637
473 Ga0068856_100341322
474 Ga0068852_100002617
475 Ga0068852_100027499
476 Ga0068859_100000186
477 Ga0068859_100012688
478 Ga0068859_100015578
479 Ga0068859_100062636
480 Ga0068859_100070605
481 Ga0068859_100101819
482 Ga0068864_100021211
483 Ga0068866_10164939
484 Ga0068861_100003143
485 Ga0068861_100050719
486 Ga0068863_100002992
487 Ga0068863_100133973
488 Ga0068863_100234916
489 Ga0068863_100381478
490 Ga0068858_100006813
491 Ga0068858_100009912
492 Ga0068858_100033527
493 Ga0068860_100007278
494 Ga0068860_100109905
495 Ga0068860_100236193
496 Ga0068862_100235784
497 Ga0097621_100026043
498 Ga0097621_100027647
499 Ga0097621_100032016
500 Ga0097621_100264799
501 Ga0068871_100011135
502 Ga0068871_100036404
503 Ga0068865_100053974
504 Ga0068865_100154890
505 Ga0097620_100000186
506 Ga0097620_100012688
507 Ga0097620_100015579
508 Ga0097620_100062636
509 Ga0097620_100070605
510 Ga0097620_100101815
511 Ga0105240_10002244
512 Ga0105240_10077907
513 Ga0111539_10003454
514 Ga0105247_10008274
515 Ga0105247_10008423
516 Ga0105241_10006152
517 Ga0105241_10121601
518 Ga0105242_10046111
519 Ga0105242_10077363
520 Ga0105237_10017999
521 Ga0105249_10029458
522 Ga0105249_10035187
523 Ga0105249_10215614
524 Ga0105239_10046154
525 Ga0105239_10055013
526 Ga0105239_10204231
527 Ga0105246_10010026
528 Ga0157373_10017978
529 Ga0157373_10127293
530 Ga0157371_10000318
531 Ga0157371_10000656
532 Ga0157371_10002847
533 Ga0157371_10014831
534 Ga0157371_10016729
535 Ga0157371_10018394
536 Ga0157371_10033147
537 Ga0157371_10041477
538 Ga0157371_10075890
539 Ga0157371_10081834
540 Ga0157371_10255264
541 Ga0157370_10000795
542 Ga0157370_10000916
543 Ga0157370_10001221
544 Ga0157370_10001314
545 Ga0157369_10018092
546 Ga0157369_10107989
547 Ga0157374_10012169
548 Ga0157374_10083999
549 Ga0157374_10113242
550 Ga0157374_10147054
551 Ga0157378_10033743
552 Ga0157378_10098293
553 Ga0157378_10255949
554 Ga0157378_10530638
555 Ga0163162_10004586
556 Ga0163162_10006332
557 Ga0163162_10032092
558 Ga0163162_10065552
559 Ga0163162_10153822
560 Ga0163162_10213237
561 Ga0163162_10416009
562 Ga0157372_10009417
563 Ga0157372_10027286
564 Ga0157372_10028710
565 Ga0157372_10052136
566 Ga0157372_10056081
567 Ga0157372_10076899
568 Ga0157372_10085072
569 Ga0157372_10092796
570 Ga0157372_10239553
571 Ga0157375_10005137
572 Ga0157375_10008784
573 Ga0157375_10012199
574 Ga0157375_10038974
575 Ga0157375_10153458
576 Ga0163163_10000462
577 Ga0163163_10281234
578 Ga0157380_10001175
579 Ga0157377_10012210
580 Ga0157377_10014418
581 Ga0157377_10133567
582 Ga0157379_10083882
583 Ga0157376_10019448
584 Ga0157376_10084675
585 Ga0157376_10108796
586 Ga0157376_10166843
587 Ga0157376_10308551
588 Ga0163161_10055618
589 Ga0163161_10061115
590 Ga0163161_10062533
591 Ga0163161_10317990
592 Ga0207710_10003698
593 Ga0207710_10012990
594 Ga0207680_10104297
595 Ga0207647_10013381
596 Ga0207647_10058434
597 Ga0207705_10018554
598 Ga0207705_10039922
599 Ga0207705_10059637
600 Ga0207705_10142231
601 Ga0207705_10143214
602 Ga0207707_10012595
603 Ga0207707_10090822
604 Ga0207695_10011412
605 Ga0207695_10078177
606 Ga0207695_10195741
607 Ga0207671_10184078
608 Ga0207660_10008625
609 Ga0207660_10030171
610 Ga0207660_10033634
611 Ga0207660_10035020
612 Ga0207660_10120136
613 Ga0207657_10005296
614 Ga0207657_10053889
615 Ga0207657_10097533
616 Ga0207657_10208763
617 Ga0207657_10220101
618 Ga0207649_10001781
619 Ga0207652_10000016
620 Ga0207652_10000171
621 Ga0207652_10000739
622 Ga0207652_10014701
623 Ga0207652_10021964
624 Ga0207652_10029365
625 Ga0207681_10031304
626 Ga0207650_10040821
627 Ga0207659_10058014
628 Ga0207659_10098247
629 Ga0207687_10200472
630 Ga0207690_10016583
631 Ga0207690_10065477
632 Ga0207690_10122942
633 Ga0207706_10003848
634 Ga0207670_10011502
635 Ga0207670_10021624
636 Ga0207670_10102251
637 Ga0207704_10029667
638 Ga0207691_10050518
639 Ga0207689_10003166
640 Ga0207689_10003496
641 Ga0207689_10005595
642 Ga0207689_10056265
643 Ga0207689_10058714
644 Ga0207661_10000688
645 Ga0207661_10094009
646 Ga0207661_10164698
647 Ga0207679_10000391
648 Ga0207667_10000539
649 Ga0207667_10020979
650 Ga0207667_10023424
651 Ga0207667_10026698
652 Ga0207712_10008681
653 Ga0207712_10018495
654 Ga0207712_10158219
655 Ga0207668_10214169
656 Ga0207640_10040775
657 Ga0207658_10103401
658 Ga0207658_10187250
659 Ga0207658_10203834
660 Ga0207677_10008332
661 Ga0207677_10159513
662 Ga0207639_10003619
663 Ga0207639_10023014
664 Ga0207639_10345180
665 Ga0207678_10055656
666 Ga0207678_10112120
667 Ga0207702_10033398
668 Ga0207641_10000194
669 Ga0207641_10190241
670 Ga0207648_10028275
671 Ga0207648_10044593
672 Ga0207648_10110406
673 Ga0207648_10151774
674 Ga0207676_10002355
675 Ga0207676_10035863
676 Ga0207676_10038323
677 Ga0207674_10001890
678 Ga0207674_10011135
679 Ga0207674_10024390
680 Ga0207674_10038548
681 Ga0207674_10331552
682 Ga0207675_100000359
683 Ga0207675_100066529
684 Ga0207683_10019477
685 Ga0207698_10001651
686 Ga0207428_10008958
687 Ga0268266_10026586
688 Ga0268266_10099447
689 Ga0268265_10009168
690 Ga0268264_10005141
691 Ga0268264_10006854
692 Ga0268264_10034681
693 Ga0307515_10000001
694 Ga0307512_10044885
695 Ga0265327_10000440
696 Ga0307509_10044028
697 Ga0307414_10127422
698 Ga0373943_0061252
699 Ga0373955_0043158
700 Ga0373947_0121752
701 Ga0373937_0405762
702 Ga0373925_0079620
703 Ga0395899_0011529
704 Ga0395899_0013887
705 Ga0395899_0247487
706 Ga0395900_0018416
707 Ga0395900_0032385
708 Ga0395900_0038608
709 Ga0395900_0148974
710 Ga0395900_0194673
711 Ga0395900_0586786
712 Ga0395898_0007047
713 Ga0395898_0029934
714 Ga0395898_0118591
715 Ga0395898_0224326
716 Ga0395905_0005098
717 Ga0395901_0012025
718 Ga0395901_0016817
719 Ga0395901_0112626
720 Ga0439436_0014476
721 Ga0439466_0028479
722 Ga0451843_1472935
723 Ga0451853_1888965
724 Ga0439442_009487
725 Ga0439457_000268
726 Ga0439434_0030213
727 Ga0466969_0000091
728 Ga0466964_0005934
729 Ga0466968_0049820
730 Ga0466957_0000460
731 Ga0495653_0070640
732 Ga0495628_0006489
733 Ga0495630_0038442
734 Ga0495587_0085501
735 Ga0495668_0001051
736 Ga0495635_0137088
737 Ga0495604_0097861
738 Ga0495676_0120553
739 Ga0495676_0165621
740 Ga0496110_0274859
741 Ga0501034_0000017
742 Ga0501034_0162787
743 Ga0501070_0143939
744 Ga0501225_0001093
745 Ga0501044_0060128
746 nmdc:mga08y16_3350_c1
747 Ga0500578_0000019
748 Ga0500644_0002938
749 Ga0500646_0037618
750 Ga0500650_0096128
751 Ga0500611_000092
752 2738727818
753 2819587164
754 2914763693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02618

YceG

YceG-like family

60

348

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r1f-assembly1.cif.gz_A crystal structure of predicted aminodeoxychorismate lyase from escherichia coli 0.7433 79 334
2r1f-assembly1.cif.gz_A crystal structure of predicted aminodeoxychorismate lyase from escherichia coli 0.7307 79 334
4iiw-assembly1.cif.gz_A-5 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.6544 34 323
4iiw-assembly1.cif.gz_B 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.6332 32 322
4iiw-assembly1.cif.gz_A-5 2.6 angstrom crystal structure of putative yceg-like protein lmo1499 from listeria monocytogenes 0.626 34 323
ID Description Score Start End Superfamily
2r1fA03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.9336 298 334 3.30.160.60
2r1fB03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.9163 298 331 3.30.160.60
2r1fA03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.8253 298 334 3.30.160.60
2r1fB03 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.7487 298 331 3.30.160.60
2o6iB02 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.1756 51 187 1.20.1250.30
ID Description Score Start End GO Terms
AF-A0A3M1N9R3-F1-model_v4 Endolytic transglycosylase MltG 0.9953 200 338 GO:0005886
GO:0016829
GO:0071555
AF-A0A7V4BS14-F1-model_v4 Endolytic transglycosylase MltG 0.9947 216 340 GO:0005886
GO:0016829
GO:0071555
AF-A0A1V5MSD2-F1-model_v4 Putative aminodeoxychorismate lyase 0.99 159 334 GO:0005886
GO:0016829
GO:0071555
AF-A0A7C5YDZ3-F1-model_v4 Endolytic transglycosylase MltG 0.982 201 340 GO:0005886
GO:0016829
GO:0071555
AF-A0A3M1N9R3-F1-model_v4 Endolytic transglycosylase MltG 0.9812 200 338 GO:0005886
GO:0016829
GO:0071555

Map