F427558

General Info

Members Datasets Scaffolds Average Seq Length
377 240 377 174

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10027203|JGI24737J22298_100272032
Length 173
Sequence MDNVARWFDRKFEFTFPAELFPNLCARLRGTPARLEELLQDCDRSLLIRKPAAKNAWSIQEQAGHLLDLEPLWFARVEDFLSGGDQLTAADLRNQKTDDAKHNARDIKDILAEFRAVRSRLLERVASLEPAMFSRTMLHPRLKQPMRLVDHLFFAAEHDDHHLAKIWELKSQP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 2.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.18
Rhizosphere 94.96
Stem 0
Stem Tuber 0
Unclassified 1.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2475507 2162886012 Bacteria 3340
2 JGI24737J22298_10027203 3300001990 Bacteria 1804
3 JGI24748J21848_1002004 3300002074 Bacteria 2271
4 JGI24033J26618_1012562 3300002155 Unclassified 1021
5 JGI24034J26672_10044919 3300002239 Unclassified 749
6 JGI24751J29686_10006037 3300002459 Bacteria 2466
7 Ga0065715_10096563 3300005293 Bacteria 3839
8 Ga0070676_10001801 3300005328 Bacteria 10898
9 Ga0070683_100003702 3300005329 Bacteria 12475
10 Ga0070683_100269769 3300005329 Unclassified 1619
11 Ga0070690_100008023 3300005330 Bacteria 6061
12 Ga0070677_10029779 3300005333 Bacteria 2073
13 Ga0070680_100118658 3300005336 Bacteria 2207
14 Ga0070680_100416889 3300005336 Archaea 1145
15 Ga0068868_100013659 3300005338 Bacteria 5964
16 Ga0068868_100130807 3300005338 Bacteria 2054
17 Ga0070660_100010639 3300005339 Bacteria 6504
18 Ga0070689_100002679 3300005340 Bacteria 11674
19 Ga0070687_100001713 3300005343 Bacteria 7875
20 Ga0070661_100006705 3300005344 Bacteria 7943
21 Ga0070668_100011516 3300005347 Bacteria 6586
22 Ga0070675_100028106 3300005354 Bacteria 4525
23 Ga0070671_100208015 3300005355 Bacteria 1659
24 Ga0070674_100010921 3300005356 Bacteria 5507
25 Ga0070673_100015844 3300005364 Bacteria 5309
26 Ga0070688_100001844 3300005365 Bacteria 10650
27 Ga0070659_100051346 3300005366 Bacteria 3242
28 Ga0070667_100047368 3300005367 Bacteria 3616
29 Ga0070703_10055118 3300005406 Archaea 1283
30 Ga0070709_10326719 3300005434 Archaea 1127
31 Ga0070714_100000111 3300005435 Bacteria 67800
32 Ga0070710_10542360 3300005437 Bacteria 802
33 Ga0070711_100070492 3300005439 Bacteria 2461
34 Ga0070705_100044457 3300005440 Archaea 2551
35 Ga0070700_100035465 3300005441 Bacteria 3019
36 Ga0070694_100126877 3300005444 Bacteria 1838
37 Ga0070708_100007274 3300005445 Bacteria 8853
38 Ga0070663_100008478 3300005455 Bacteria 6324
39 Ga0070678_100004251 3300005456 Bacteria 8094
40 Ga0070662_100010560 3300005457 Bacteria 6067
41 Ga0070681_10046237 3300005458 Bacteria 4352
42 Ga0070681_10110865 3300005458 Bacteria 2683
43 Ga0068867_100036447 3300005459 Bacteria 3570
44 Ga0070685_10001765 3300005466 Bacteria 11318
45 Ga0070698_100063738 3300005471 Bacteria 3716
46 Ga0070679_100044256 3300005530 Unclassified 4435
47 Ga0070679_100324919 3300005530 Bacteria 1487
48 Ga0070679_100669441 3300005530 Unclassified 981
49 Ga0070684_100001094 3300005535 Bacteria 19438
50 Ga0070697_100001676 3300005536 Bacteria 16914
51 Ga0070697_100500727 3300005536 Bacteria 1062
52 Ga0068853_100004477 3300005539 Bacteria 10837
53 Ga0068853_100249853 3300005539 Bacteria 1627
54 Ga0068853_100315720 3300005539 Unclassified 1448
55 Ga0070672_100115918 3300005543 Bacteria 2188
56 Ga0070686_100003305 3300005544 Bacteria 8830
57 Ga0070695_100001267 3300005545 Bacteria 13912
58 Ga0070696_100021013 3300005546 Unclassified 4424
59 Ga0070696_100149645 3300005546 Bacteria 1712
60 Ga0070693_100000068 3300005547 Bacteria 42338
61 Ga0070665_100094928 3300005548 Bacteria 2987
62 Ga0070665_100108501 3300005548 Unclassified 2778
63 Ga0070704_100138359 3300005549 Archaea 1898
64 Ga0068855_100026997 3300005563 Bacteria 6870
65 Ga0068855_100761376 3300005563 Bacteria 1032
66 Ga0070664_100150840 3300005564 Bacteria 2052
67 Ga0068857_100002970 3300005577 Bacteria 13970
68 Ga0068857_100005240 3300005577 Bacteria 11038
69 Ga0068857_100019383 3300005577 Bacteria 5972
70 Ga0068854_100013542 3300005578 Bacteria 5357
71 Ga0068856_100234460 3300005614 Bacteria 1851
72 Ga0070702_100019517 3300005615 Bacteria 3538
73 Ga0068852_100001934 3300005616 Bacteria 14106
74 Ga0068852_100075646 3300005616 Unclassified 2970
75 Ga0068859_100017697 3300005617 Bacteria 7163
76 Ga0068859_100138035 3300005617 Bacteria 2512
77 Ga0068866_10019860 3300005718 Bacteria 3067
78 Ga0068861_100104329 3300005719 Unclassified 2261
79 Ga0068863_101021415 3300005841 Bacteria 830
80 Ga0068858_100008165 3300005842 Bacteria 10064
81 Ga0068858_100168538 3300005842 Bacteria 2064
82 Ga0068858_101335513 3300005842 Bacteria 706
83 Ga0068860_100015201 3300005843 Bacteria 7519
84 Ga0068862_100007710 3300005844 Bacteria 8903
85 Ga0068862_100907485 3300005844 Bacteria 866
86 Ga0081455_10015198 3300005937 Bacteria 7488
87 Ga0070715_10056283 3300006163 Bacteria 1710
88 Ga0097621_100083605 3300006237 Bacteria 2660
89 Ga0097621_100399674 3300006237 Bacteria 1230
90 Ga0097621_100451099 3300006237 Unclassified 1159
91 Ga0097621_100633133 3300006237 Unclassified 980
92 Ga0068871_100009658 3300006358 Bacteria 7004
93 Ga0068871_100011508 3300006358 Bacteria 6489
94 Ga0068871_100090794 3300006358 Unclassified 2545
95 Ga0068871_100192942 3300006358 Unclassified 1755
96 Ga0068871_100419647 3300006358 Bacteria 1194
97 Ga0068865_100007893 3300006881 Bacteria 6566
98 Ga0068865_100120974 3300006881 Bacteria 1947
99 Ga0097620_100017698 3300006931 Bacteria 7163
100 Ga0097620_100138034 3300006931 Bacteria 2512
101 Ga0105240_10180964 3300009093 Bacteria 2488
102 Ga0105240_10262143 3300009093 Bacteria 1993
103 Ga0105240_10277704 3300009093 Bacteria 1926
104 Ga0105240_10305903 3300009093 Bacteria 1817
105 Ga0105240_10728302 3300009093 Unclassified 1080
106 Ga0105245_10010651 3300009098 Bacteria 7998
107 Ga0105245_10058119 3300009098 Bacteria 3481
108 Ga0105245_10061033 3300009098 Unclassified 3397
109 Ga0105245_10270481 3300009098 Bacteria 1657
110 Ga0105245_10405220 3300009098 Bacteria 1364
111 Ga0105245_11000470 3300009098 Unclassified 880
112 Ga0105247_10001315 3300009101 Bacteria 18153
113 Ga0105247_10022694 3300009101 Bacteria 3779
114 Ga0105243_10085303 3300009148 Bacteria 2588
115 Ga0105243_10499742 3300009148 Unclassified 1152
116 Ga0105241_10008841 3300009174 Bacteria 7405
117 Ga0105241_10058103 3300009174 Bacteria 2970
118 Ga0105241_10061454 3300009174 Bacteria 2893
119 Ga0105241_10137975 3300009174 Unclassified 1982
120 Ga0105241_10335787 3300009174 Unclassified 1308
121 Ga0105242_10005691 3300009176 Bacteria 9617
122 Ga0105242_10091908 3300009176 Bacteria 2555
123 Ga0105242_10120674 3300009176 Bacteria 2249
124 Ga0105242_10251006 3300009176 Bacteria 1594
125 Ga0105242_11007044 3300009176 Bacteria 841
126 Ga0105248_10073527 3300009177 Bacteria 3841
127 Ga0105248_10214540 3300009177 Bacteria 2168
128 Ga0105248_10232747 3300009177 Bacteria 2074
129 Ga0105248_10307140 3300009177 Bacteria 1786
130 Ga0105248_12747919 3300009177 Bacteria 561
131 Ga0105237_10017880 3300009545 Bacteria 7348
132 Ga0105237_10042148 3300009545 Bacteria 4604
133 Ga0105237_10121942 3300009545 Bacteria 2601
134 Ga0105237_11457553 3300009545 Bacteria 691
135 Ga0105238_10004534 3300009551 Bacteria 13758
136 Ga0105238_10180501 3300009551 Bacteria 2088
137 Ga0105238_11271795 3300009551 Bacteria 761
138 Ga0105249_10029976 3300009553 Bacteria 4915
139 Ga0105249_10121108 3300009553 Bacteria 2486
140 Ga0105239_10011627 3300010375 Bacteria 9821
141 Ga0105239_10163683 3300010375 Bacteria 2487
142 Ga0105239_10246586 3300010375 Bacteria 2006
143 Ga0105239_10272546 3300010375 Bacteria 1904
144 Ga0105246_10454880 3300011119 Unclassified 1077
145 Ga0157373_10002222 3300013100 Bacteria 14686
146 Ga0157373_10365021 3300013100 Unclassified 1031
147 Ga0157371_10002758 3300013102 Bacteria 16499
148 Ga0157370_10462081 3300013104 Unclassified 1167
149 Ga0157369_10021695 3300013105 Bacteria 7182
150 Ga0157369_10132358 3300013105 Bacteria 2642
151 Ga0157374_10043517 3300013296 Bacteria 4149
152 Ga0157378_10023563 3300013297 Bacteria 5415
153 Ga0157378_10033785 3300013297 Bacteria 4523
154 Ga0157378_10700762 3300013297 Bacteria 1032
155 Ga0163162_10018646 3300013306 Bacteria 6799
156 Ga0163162_10303622 3300013306 Bacteria 1728
157 Ga0163162_10435198 3300013306 Bacteria 1444
158 Ga0163162_10661624 3300013306 Bacteria 1168
159 Ga0157372_10043920 3300013307 Bacteria 4950
160 Ga0157372_10265846 3300013307 Bacteria 1992
161 Ga0157372_10297291 3300013307 Bacteria 1878
162 Ga0157372_10363761 3300013307 Bacteria 1686
163 Ga0157372_10754825 3300013307 Bacteria 1131
164 Ga0157372_10797067 3300013307 Unclassified 1098
165 Ga0157375_10189379 3300013308 Bacteria 2212
166 Ga0157375_11391977 3300013308 Bacteria 826
167 Ga0163163_10001220 3300014325 Bacteria 21743
168 Ga0163163_10271983 3300014325 Unclassified 1745
169 Ga0163163_10304866 3300014325 Unclassified 1645
170 Ga0157380_10125993 3300014326 Bacteria 2177
171 Ga0157377_10000456 3300014745 Bacteria 17623
172 Ga0157379_10007834 3300014968 Bacteria 9251
173 Ga0157379_10009806 3300014968 Bacteria 8346
174 Ga0157376_10290918 3300014969 Unclassified 1542
175 Ga0163161_10001906 3300017792 Bacteria 15234
176 Ga0213872_10061094 3300021361 Bacteria 1704
177 Ga0213872_10089372 3300021361 Bacteria 1379
178 Ga0207697_10004295 3300025315 Bacteria 6833
179 Ga0207656_10005947 3300025321 Bacteria 4354
180 Ga0207653_10020876 3300025885 Bacteria 2076
181 Ga0207682_10032184 3300025893 Bacteria 2107
182 Ga0207642_10650896 3300025899 Unclassified 660
183 Ga0207688_10012076 3300025901 Unclassified 4699
184 Ga0207680_10112478 3300025903 Bacteria 1768
185 Ga0207647_10004255 3300025904 Bacteria 10614
186 Ga0207685_10077873 3300025905 Bacteria 1363
187 Ga0207699_10164988 3300025906 Archaea 1477
188 Ga0207645_10000223 3300025907 Bacteria 47126
189 Ga0207643_10000338 3300025908 Bacteria 31915
190 Ga0207654_10010198 3300025911 Bacteria 4782
191 Ga0207654_10037442 3300025911 Bacteria 2716
192 Ga0207654_10084732 3300025911 Unclassified 1916
193 Ga0207654_10086097 3300025911 Bacteria 1904
194 Ga0207707_10067127 3300025912 Bacteria 3124
195 Ga0207695_10059276 3300025913 Bacteria 3970
196 Ga0207695_10083358 3300025913 Bacteria 3230
197 Ga0207695_10100113 3300025913 Bacteria 2895
198 Ga0207695_10193662 3300025913 Bacteria 1950
199 Ga0207695_10931653 3300025913 Bacteria 748
200 Ga0207671_10435924 3300025914 Unclassified 1043
201 Ga0207660_10115188 3300025917 Bacteria 2029
202 Ga0207660_10392388 3300025917 Archaea 1117
203 Ga0207662_10024120 3300025918 Bacteria 3500
204 Ga0207657_10001186 3300025919 Bacteria 27702
205 Ga0207649_10000136 3300025920 Bacteria 62562
206 Ga0207652_10060306 3300025921 Unclassified 3273
207 Ga0207652_10125100 3300025921 Unclassified 2290
208 Ga0207652_10169145 3300025921 Bacteria 1961
209 Ga0207652_10260821 3300025921 Unclassified 1563
210 Ga0207646_10236611 3300025922 Bacteria 1650
211 Ga0207694_10018833 3300025924 Bacteria 5218
212 Ga0207694_10084207 3300025924 Bacteria 2501
213 Ga0207650_10000040 3300025925 Bacteria 204095
214 Ga0207687_10467719 3300025927 Unclassified 1048
215 Ga0207687_11040759 3300025927 Unclassified 702
216 Ga0207664_10000127 3300025929 Bacteria 66344
217 Ga0207644_10071789 3300025931 Bacteria 2533
218 Ga0207706_10000141 3300025933 Bacteria 78380
219 Ga0207686_10012503 3300025934 Bacteria 4667
220 Ga0207686_10020690 3300025934 Bacteria 3763
221 Ga0207686_10059189 3300025934 Bacteria 2419
222 Ga0207709_10188479 3300025935 Bacteria 1463
223 Ga0207669_10151871 3300025937 Bacteria 1623
224 Ga0207704_10008616 3300025938 Bacteria 4886
225 Ga0207704_10020812 3300025938 Bacteria 3479
226 Ga0207691_10000456 3300025940 Bacteria 40414
227 Ga0207711_10012595 3300025941 Bacteria 7024
228 Ga0207711_10266087 3300025941 Bacteria 1577
229 Ga0207711_11231849 3300025941 Bacteria 690
230 Ga0207711_11634351 3300025941 Bacteria 588
231 Ga0207689_10001204 3300025942 Bacteria 24869
232 Ga0207661_10040000 3300025944 Bacteria 3683
233 Ga0207661_10089535 3300025944 Bacteria 2561
234 Ga0207661_10955752 3300025944 Unclassified 789
235 Ga0207679_10000049 3300025945 Bacteria 119045
236 Ga0207679_10208453 3300025945 Bacteria 1637
237 Ga0207679_10276871 3300025945 Bacteria 1437
238 Ga0207667_10078769 3300025949 Bacteria 3415
239 Ga0207667_10091251 3300025949 Bacteria 3147
240 Ga0207651_10001216 3300025960 Bacteria 11542
241 Ga0207712_10394354 3300025961 Bacteria 1162
242 Ga0207640_10179064 3300025981 Bacteria 1588
243 Ga0207658_10009905 3300025986 Bacteria 6475
244 Ga0207703_10033272 3300026035 Bacteria 4085
245 Ga0207703_10035987 3300026035 Bacteria 3937
246 Ga0207703_10087511 3300026035 Bacteria 2612
247 Ga0207703_11115922 3300026035 Bacteria 758
248 Ga0207639_10022132 3300026041 Bacteria 4576
249 Ga0207639_10125577 3300026041 Bacteria 2115
250 Ga0207678_10000411 3300026067 Bacteria 38751
251 Ga0207702_10046824 3300026078 Bacteria 3642
252 Ga0207702_10081968 3300026078 Bacteria 2803
253 Ga0207641_10000009 3300026088 Bacteria 407901
254 Ga0207641_10005575 3300026088 Bacteria 10727
255 Ga0207641_10427146 3300026088 Bacteria 1277
256 Ga0207641_11001279 3300026088 Bacteria 832
257 Ga0207648_10000514 3300026089 Bacteria 43209
258 Ga0207648_10454459 3300026089 Unclassified 1167
259 Ga0207676_10000149 3300026095 Bacteria 60541
260 Ga0207674_10000010 3300026116 Bacteria 196710
261 Ga0207674_10004517 3300026116 Bacteria 16711
262 Ga0207674_10095183 3300026116 Bacteria 2964
263 Ga0207675_100008103 3300026118 Bacteria 9898
264 Ga0207683_10000191 3300026121 Bacteria 52438
265 Ga0207698_10084149 3300026142 Unclassified 2578
266 Ga0207698_10246746 3300026142 Bacteria 1631
267 Ga0265354_1000055 3300028016 Bacteria 18594
268 Ga0265354_1003773 3300028016 Unclassified 1652
269 Ga0268266_10006384 3300028379 Bacteria 10799
270 Ga0268266_10010605 3300028379 Bacteria 8032
271 Ga0268265_10020959 3300028380 Bacteria 4569
272 Ga0268264_10015600 3300028381 Bacteria 6226
273 Ga0268264_10234178 3300028381 Bacteria 1697
274 Ga0265338_10061150 3300028800 Bacteria 3302
275 Ga0265762_1001200 3300030760 Bacteria 4700
276 Ga0265762_1150703 3300030760 Unclassified 553
277 Ga0265770_1000565 3300030878 Bacteria 5138
278 Ga0265770_1003762 3300030878 Unclassified 2062
279 Ga0265770_1025868 3300030878 Unclassified 957
280 Ga0265770_1093798 3300030878 Unclassified 602
281 Ga0265765_1001788 3300030879 Bacteria 2018
282 Ga0265765_1006262 3300030879 Bacteria 1262
283 Ga0265765_1007685 3300030879 Bacteria 1165
284 Ga0265760_10019189 3300031090 Unclassified 1970
285 Ga0265339_10122551 3300031249 Bacteria 1335
286 Ga0307405_10060480 3300031731 Bacteria 2391
287 Ga0316212_1007211 3300033547 Unclassified 1606
288 Ga0316212_1007630 3300033547 Unclassified 1561
289 Ga0316212_1061776 3300033547 Bacteria 540
290 Ga0373926_0006466 3300035083 Bacteria 3890
291 Ga0373934_0020077 3300035086 Bacteria 2568
292 Ga0373923_0021689 3300035111 Bacteria 2510
293 Ga0373945_0009284 3300035116 Bacteria 3220
294 Ga0373953_0016743 3300035117 Bacteria 2682
295 Ga0373954_0026535 3300035118 Bacteria 2655
296 Ga0373954_0424679 3300035118 Unclassified 658
297 Ga0373956_0012317 3300035119 Bacteria 3543
298 Ga0373957_0035811 3300035120 Bacteria 1846
299 Ga0373943_0000889 3300035170 Bacteria 13140
300 Ga0373946_0000776 3300035171 Bacteria 10879
301 Ga0373955_0069013 3300035172 Bacteria 1971
302 Ga0373924_0099236 3300035410 Bacteria 1251
303 Ga0373935_0000266 3300035692 Bacteria 25825
304 Ga0373927_0002186 3300035695 Bacteria 14374
305 Ga0373947_0000053 3300035725 Bacteria 57813
306 Ga0373925_0016099 3300037068 Bacteria 5414
307 Ga0373925_0766100 3300037068 Unclassified 796
308 Ga0373925_1078295 3300037068 Unclassified 661
309 Ga0436364_1143158 3300037853 Archaea 2311
310 Ga0436365_1023621 3300039437 Archaea 4489
311 Ga0436360_0209914 3300039438 Bacteria 3555
312 Ga0436360_0580177 3300039438 Bacteria 907
313 Ga0436361_0274510 3300039447 Bacteria 4265
314 Ga0436361_0433966 3300039447 Bacteria 6033
315 Ga0436361_0784741 3300039447 Bacteria 9074
316 Ga0436363_1294387 3300039450 Unclassified 1886
317 Ga0436363_1564468 3300039450 Bacteria 1821
318 Ga0436362_1006124 3300039453 Unclassified 783
319 Ga0436362_1196663 3300039453 Bacteria 904
320 Ga0495651_0108510 3300046462 Bacteria 2056
321 Ga0495653_0136459 3300046463 Bacteria 1730
322 Ga0495580_0196947 3300046472 Bacteria 1389
323 Ga0495580_0202170 3300046472 Bacteria 1368
324 Ga0495630_0547717 3300046517 Unclassified 887
325 Ga0495652_0109667 3300046529 Bacteria 2222
326 Ga0495657_0455483 3300046675 Unclassified 749
327 Ga0495646_0285415 3300046680 Unclassified 876
328 Ga0495669_0102214 3300046684 Bacteria 1332
329 Ga0495624_0027359 3300046690 Bacteria 3734
330 Ga0495604_0088592 3300047317 Bacteria 2302
331 Ga0495604_0302316 3300047317 Bacteria 1074
332 Ga0495674_0054658 3300047319 Bacteria 3505
333 Ga0495674_0084288 3300047319 Bacteria 2724
334 Ga0495676_0719724 3300047321 Unclassified 645
335 Ga0495602_0074061 3300048088 Bacteria 2896
336 Ga0496101_0025496 3300048904 Bacteria 4104
337 Ga0496102_0191291 3300048905 Bacteria 1928
338 Ga0496102_0910369 3300048905 Unclassified 801
339 Ga0496104_0548993 3300048907 Bacteria 1066
340 Ga0496106_0500329 3300048909 Bacteria 976
341 Ga0496107_0293947 3300048910 Bacteria 1209
342 Ga0496108_0025849 3300048911 Bacteria 4841
343 Ga0496109_0000084 3300048912 Bacteria 95803
344 Ga0496110_0002607 3300048913 Bacteria 13564
345 Ga0496112_0000119 3300048915 Bacteria 49202
346 Ga0496112_0620499 3300048915 Unclassified 1012
347 Ga0496113_0001388 3300048916 Bacteria 13455
348 Ga0501031_0001748 3300049568 Bacteria 13625
349 Ga0501032_0002764 3300049569 Bacteria 13672
350 Ga0501033_0008910 3300049570 Bacteria 7752
351 Ga0501034_0058062 3300049571 Bacteria 3889
352 Ga0501036_0000160 3300049572 Bacteria 43815
353 Ga0501037_0002168 3300049573 Bacteria 14200
354 Ga0501038_0002357 3300049574 Bacteria 17603
355 Ga0501039_0036845 3300049575 Bacteria 3774
356 Ga0501042_0160888 3300049578 Bacteria 1620
357 Ga0501043_0003033 3300049579 Bacteria 13954
358 Ga0501046_0001221 3300049580 Bacteria 24913
359 Ga0501047_0011380 3300049581 Bacteria 8420
360 Ga0501048_0018166 3300049582 Bacteria 5173
361 Ga0501067_0000681 3300049583 Bacteria 18290
362 Ga0501068_0015063 3300049584 Bacteria 4433
363 Ga0501069_0000424 3300049585 Bacteria 19189
364 Ga0501070_0015599 3300049586 Bacteria 6388
365 Ga0501072_0004156 3300049588 Bacteria 10960
366 Ga0501073_0000160 3300049589 Bacteria 43635
367 Ga0501074_0021942 3300049590 Bacteria 4636
368 Ga0501075_0174966 3300049591 Bacteria 1638
369 Ga0501076_0053794 3300049592 Bacteria 3191
370 Ga0501079_0004133 3300049741 Bacteria 10745
371 Ga0501080_0000021 3300049742 Bacteria 91749
372 Ga0501083_0007209 3300049744 Bacteria 7894
373 Ga0501035_0014601 3300049822 Bacteria 7249
374 Ga0501044_0005686 3300049823 Bacteria 13821
375 Ga0501084_0007916 3300054114 Bacteria 8746
376 Ga0501082_0032958 3300060353 Bacteria 4467
377 Ga0530510_0204607 3300061734 Bacteria 1467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009176 Ga0105242_11007044 Ga0105242_110070442 164
2 3300026088 Ga0207641_10427146 Ga0207641_104271462 164
3 3300005563 Ga0068855_100761376 Ga0068855_1007613761 165
4 3300005841 Ga0068863_101021415 Ga0068863_1010214152 165
5 3300006358 Ga0068871_100090794 Ga0068871_1000907942 165
6 3300009174 Ga0105241_10058103 Ga0105241_100581033 165
7 3300009176 Ga0105242_10120674 Ga0105242_101206743 165
8 3300010375 Ga0105239_10011627 Ga0105239_1001162711 165
9 3300013100 Ga0157373_10365021 Ga0157373_103650212 165
10 3300013306 Ga0163162_10018646 Ga0163162_100186463 165
11 3300013307 Ga0157372_10363761 Ga0157372_103637612 165
12 3300025945 Ga0207679_10276871 Ga0207679_102768712 165
13 3300025949 Ga0207667_10078769 Ga0207667_100787693 165
14 3300026088 Ga0207641_11001279 Ga0207641_110012792 165
15 3300005336 Ga0070680_100118658 Ga0070680_1001186582 167
16 3300005458 Ga0070681_10110865 Ga0070681_101108653 167
17 3300005530 Ga0070679_100324919 Ga0070679_1003249192 167
18 3300005539 Ga0068853_100249853 Ga0068853_1002498532 167
19 3300005564 Ga0070664_100150840 Ga0070664_1001508402 167
20 3300005577 Ga0068857_100005240 Ga0068857_1000052403 167
21 3300006237 Ga0097621_100451099 Ga0097621_1004510992 167
22 3300006358 Ga0068871_100011508 Ga0068871_1000115086 167
23 3300006881 Ga0068865_100120974 Ga0068865_1001209742 167
24 3300009093 Ga0105240_10262143 Ga0105240_102621433 167
25 3300009098 Ga0105245_10010651 Ga0105245_100106512 167
26 3300009174 Ga0105241_10061454 Ga0105241_100614543 167
27 3300009176 Ga0105242_10091908 Ga0105242_100919083 167
28 3300009176 Ga0105242_10251006 Ga0105242_102510062 167
29 3300009177 Ga0105248_10232747 Ga0105248_102327473 167
30 3300009545 Ga0105237_10017880 Ga0105237_100178802 167
31 3300009551 Ga0105238_10004534 Ga0105238_100045348 167
32 3300009551 Ga0105238_11271795 Ga0105238_112717952 167
33 3300010375 Ga0105239_10272546 Ga0105239_102725462 167
34 3300011119 Ga0105246_10454880 Ga0105246_104548802 167
35 3300013296 Ga0157374_10043517 Ga0157374_100435172 167
36 3300013297 Ga0157378_10033785 Ga0157378_100337853 167
37 3300013306 Ga0163162_10435198 Ga0163162_104351982 167
38 3300013306 Ga0163162_10661624 Ga0163162_106616242 167
39 3300013307 Ga0157372_10265846 Ga0157372_102658462 167
40 3300013307 Ga0157372_10754825 Ga0157372_107548252 167
41 3300013308 Ga0157375_11391977 Ga0157375_113919772 167
42 3300014325 Ga0163163_10271983 Ga0163163_102719832 167
43 3300025911 Ga0207654_10010198 Ga0207654_100101982 167
44 3300025912 Ga0207707_10067127 Ga0207707_100671273 167
45 3300025917 Ga0207660_10115188 Ga0207660_101151882 167
46 3300025921 Ga0207652_10169145 Ga0207652_101691452 167
47 3300025924 Ga0207694_10018833 Ga0207694_100188333 167
48 3300025934 Ga0207686_10012503 Ga0207686_100125032 167
49 3300025934 Ga0207686_10020690 Ga0207686_100206902 167
50 3300025938 Ga0207704_10008616 Ga0207704_100086163 167
51 3300025941 Ga0207711_10266087 Ga0207711_102660872 167
52 3300025944 Ga0207661_10089535 Ga0207661_100895352 167
53 3300025945 Ga0207679_10208453 Ga0207679_102084532 167
54 3300026041 Ga0207639_10022132 Ga0207639_100221325 167
55 3300026116 Ga0207674_10095183 Ga0207674_100951832 167
56 3300037068 Ga0373925_0766100 Ga0373925_0766100_85_588 167
57 3300005577 Ga0068857_100002970 Ga0068857_1000029703 168
58 3300005614 Ga0068856_100234460 Ga0068856_1002344603 168
59 3300006237 Ga0097621_100399674 Ga0097621_1003996742 168
60 3300009174 Ga0105241_10137975 Ga0105241_101379753 168
61 3300025911 Ga0207654_10084732 Ga0207654_100847323 168
62 3300025911 Ga0207654_10086097 Ga0207654_100860972 168
63 3300025924 Ga0207694_10084207 Ga0207694_100842073 168
64 3300026078 Ga0207702_10081968 Ga0207702_100819683 168
65 3300026116 Ga0207674_10004517 Ga0207674_100045173 168
66 3300030760 Ga0265762_1150703 Ga0265762_11507031 168
67 3300033547 Ga0316212_1061776 Ga0316212_10617761 168
68 3300037068 Ga0373925_1078295 Ga0373925_1078295_81_590 168
69 3300048905 Ga0496102_0910369 Ga0496102_0910369_29_547 168
70 3300048907 Ga0496104_0548993 Ga0496104_0548993_256_774 168
71 3300048915 Ga0496112_0620499 Ga0496112_0620499_481_999 168
72 3300005937 Ga0081455_10015198 Ga0081455_100151984 169
73 3300021361 Ga0213872_10061094 Ga0213872_100610941 169
74 3300021361 Ga0213872_10089372 Ga0213872_100893721 169
75 3300031731 Ga0307405_10060480 Ga0307405_100604802 169
76 3300039438 Ga0436360_0209914 Ga0436360_0209914_2546_3055 169
77 3300039447 Ga0436361_0274510 Ga0436361_0274510_851_1360 169
78 3300039447 Ga0436361_0433966 Ga0436361_0433966_4960_5469 169
79 3300039450 Ga0436363_1294387 Ga0436363_1294387_1269_1796 169
80 3300005338 Ga0068868_100130807 Ga0068868_1001308072 170
81 3300005539 Ga0068853_100315720 Ga0068853_1003157202 170
82 3300005548 Ga0070665_100108501 Ga0070665_1001085012 170
83 3300005617 Ga0068859_100138035 Ga0068859_1001380352 170
84 3300006237 Ga0097621_100633133 Ga0097621_1006331331 170
85 3300006358 Ga0068871_100192942 Ga0068871_1001929422 170
86 3300006358 Ga0068871_100419647 Ga0068871_1004196471 170
87 3300006931 Ga0097620_100138034 Ga0097620_1001380344 170
88 3300009098 Ga0105245_10061033 Ga0105245_100610334 170
89 3300009098 Ga0105245_10270481 Ga0105245_102704813 170
90 3300009101 Ga0105247_10022694 Ga0105247_100226943 170
91 3300009148 Ga0105243_10085303 Ga0105243_100853032 170
92 3300009174 Ga0105241_10335787 Ga0105241_103357872 170
93 3300009177 Ga0105248_10214540 Ga0105248_102145401 170
94 3300009177 Ga0105248_10307140 Ga0105248_103071403 170
95 3300010375 Ga0105239_10246586 Ga0105239_102465863 170
96 3300014325 Ga0163163_10304866 Ga0163163_103048661 170
97 3300014969 Ga0157376_10290918 Ga0157376_102909182 170
98 3300025913 Ga0207695_10100113 Ga0207695_101001135 170
99 3300025914 Ga0207671_10435924 Ga0207671_104359242 170
100 3300025927 Ga0207687_11040759 Ga0207687_110407591 170
101 3300025935 Ga0207709_10188479 Ga0207709_101884792 170
102 3300025941 Ga0207711_11231849 Ga0207711_112318492 170
103 3300026035 Ga0207703_10033272 Ga0207703_100332723 170
104 3300028379 Ga0268266_10010605 Ga0268266_100106053 170
105 3300028381 Ga0268264_10234178 Ga0268264_102341782 170
106 3300039450 Ga0436363_1564468 Ga0436363_1564468_185_700 170
107 3300005329 Ga0070683_100269769 Ga0070683_1002697692 171
108 3300005336 Ga0070680_100416889 Ga0070680_1004168891 171
109 3300005406 Ga0070703_10055118 Ga0070703_100551181 171
110 3300005434 Ga0070709_10326719 Ga0070709_103267191 171
111 3300005435 Ga0070714_100000111 Ga0070714_10000011156 171
112 3300005437 Ga0070710_10542360 Ga0070710_105423601 171
113 3300005439 Ga0070711_100070492 Ga0070711_1000704923 171
114 3300005440 Ga0070705_100044457 Ga0070705_1000444572 171
115 3300005444 Ga0070694_100126877 Ga0070694_1001268771 171
116 3300005445 Ga0070708_100007274 Ga0070708_1000072742 171
117 3300005458 Ga0070681_10046237 Ga0070681_100462373 171
118 3300005471 Ga0070698_100063738 Ga0070698_1000637385 171
119 3300005530 Ga0070679_100044256 Ga0070679_1000442566 171
120 3300005530 Ga0070679_100669441 Ga0070679_1006694412 171
121 3300005536 Ga0070697_100001676 Ga0070697_1000016765 171
122 3300005536 Ga0070697_100500727 Ga0070697_1005007272 171
123 3300005545 Ga0070695_100001267 Ga0070695_1000012671 171
124 3300005546 Ga0070696_100021013 Ga0070696_1000210135 171
125 3300005547 Ga0070693_100000068 Ga0070693_10000006820 171
126 3300005548 Ga0070665_100094928 Ga0070665_1000949283 171
127 3300005549 Ga0070704_100138359 Ga0070704_1001383591 171
128 3300005616 Ga0068852_100075646 Ga0068852_1000756463 171
129 3300005842 Ga0068858_100168538 Ga0068858_1001685382 171
130 3300005842 Ga0068858_101335513 Ga0068858_1013355131 171
131 3300005844 Ga0068862_100907485 Ga0068862_1009074852 171
132 3300006163 Ga0070715_10056283 Ga0070715_100562831 171
133 3300009093 Ga0105240_10180964 Ga0105240_101809642 171
134 3300009093 Ga0105240_10277704 Ga0105240_102777042 171
135 3300009093 Ga0105240_10305903 Ga0105240_103059033 171
136 3300009093 Ga0105240_10728302 Ga0105240_107283022 171
137 3300009098 Ga0105245_10405220 Ga0105245_104052202 171
138 3300009098 Ga0105245_11000470 Ga0105245_110004701 171
139 3300009177 Ga0105248_12747919 Ga0105248_127479191 171
140 3300009545 Ga0105237_10121942 Ga0105237_101219422 171
141 3300009545 Ga0105237_11457553 Ga0105237_114575531 171
142 3300009551 Ga0105238_10180501 Ga0105238_101805012 171
143 3300009553 Ga0105249_10121108 Ga0105249_101211082 171
144 3300010375 Ga0105239_10163683 Ga0105239_101636833 171
145 3300013104 Ga0157370_10462081 Ga0157370_104620812 171
146 3300013105 Ga0157369_10132358 Ga0157369_101323583 171
147 3300013297 Ga0157378_10700762 Ga0157378_107007621 171
148 3300013307 Ga0157372_10297291 Ga0157372_102972912 171
149 3300013307 Ga0157372_10797067 Ga0157372_107970672 171
150 3300014968 Ga0157379_10009806 Ga0157379_100098067 171
151 3300025885 Ga0207653_10020876 Ga0207653_100208763 171
152 3300025905 Ga0207685_10077873 Ga0207685_100778731 171
153 3300025906 Ga0207699_10164988 Ga0207699_101649881 171
154 3300025913 Ga0207695_10059276 Ga0207695_100592762 171
155 3300025913 Ga0207695_10083358 Ga0207695_100833582 171
156 3300025913 Ga0207695_10193662 Ga0207695_101936622 171
157 3300025913 Ga0207695_10931653 Ga0207695_109316531 171
158 3300025917 Ga0207660_10392388 Ga0207660_103923881 171
159 3300025921 Ga0207652_10060306 Ga0207652_100603065 171
160 3300025921 Ga0207652_10125100 Ga0207652_101251002 171
161 3300025921 Ga0207652_10260821 Ga0207652_102608211 171
162 3300025922 Ga0207646_10236611 Ga0207646_102366111 171
163 3300025929 Ga0207664_10000127 Ga0207664_1000012750 171
164 3300025941 Ga0207711_11634351 Ga0207711_116343511 171
165 3300025944 Ga0207661_10955752 Ga0207661_109557522 171
166 3300025949 Ga0207667_10091251 Ga0207667_100912512 171
167 3300026035 Ga0207703_10035987 Ga0207703_100359872 171
168 3300026035 Ga0207703_11115922 Ga0207703_111159221 171
169 3300026088 Ga0207641_10005575 Ga0207641_100055755 171
170 3300026089 Ga0207648_10454459 Ga0207648_104544591 171
171 3300026142 Ga0207698_10084149 Ga0207698_100841492 171
172 3300028016 Ga0265354_1000055 Ga0265354_10000559 171
173 3300028016 Ga0265354_1003773 Ga0265354_10037731 171
174 3300028800 Ga0265338_10061150 Ga0265338_100611502 171
175 3300030760 Ga0265762_1001200 Ga0265762_10012003 171
176 3300030878 Ga0265770_1000565 Ga0265770_10005655 171
177 3300030878 Ga0265770_1003762 Ga0265770_10037621 171
178 3300030878 Ga0265770_1025868 Ga0265770_10258682 171
179 3300030878 Ga0265770_1093798 Ga0265770_10937981 171
180 3300030879 Ga0265765_1001788 Ga0265765_10017881 171
181 3300030879 Ga0265765_1006262 Ga0265765_10062622 171
182 3300030879 Ga0265765_1007685 Ga0265765_10076852 171
183 3300031090 Ga0265760_10019189 Ga0265760_100191893 171
184 3300031249 Ga0265339_10122551 Ga0265339_101225512 171
185 3300033547 Ga0316212_1007211 Ga0316212_10072111 171
186 3300033547 Ga0316212_1007630 Ga0316212_10076303 171
187 3300035083 Ga0373926_0006466 Ga0373926_0006466_2380_2901 171
188 3300035086 Ga0373934_0020077 Ga0373934_0020077_489_1010 171
189 3300035111 Ga0373923_0021689 Ga0373923_0021689_828_1349 171
190 3300035116 Ga0373945_0009284 Ga0373945_0009284_1659_2180 171
191 3300035117 Ga0373953_0016743 Ga0373953_0016743_645_1166 171
192 3300035118 Ga0373954_0026535 Ga0373954_0026535_484_1005 171
193 3300035118 Ga0373954_0424679 Ga0373954_0424679_107_625 171
194 3300035119 Ga0373956_0012317 Ga0373956_0012317_1715_2236 171
195 3300035120 Ga0373957_0035811 Ga0373957_0035811_300_821 171
196 3300035170 Ga0373943_0000889 Ga0373943_0000889_7240_7761 171
197 3300035171 Ga0373946_0000776 Ga0373946_0000776_9801_10322 171
198 3300035172 Ga0373955_0069013 Ga0373955_0069013_800_1321 171
199 3300035410 Ga0373924_0099236 Ga0373924_0099236_205_726 171
200 3300035692 Ga0373935_0000266 Ga0373935_0000266_14714_15235 171
201 3300035695 Ga0373927_0002186 Ga0373927_0002186_3431_3952 171
202 3300035725 Ga0373947_0000053 Ga0373947_0000053_27568_28089 171
203 3300037068 Ga0373925_0016099 Ga0373925_0016099_4380_4901 171
204 3300037853 Ga0436364_1143158 Ga0436364_1143158_1137_1667 171
205 3300039437 Ga0436365_1023621 Ga0436365_1023621_987_1505 171
206 3300039438 Ga0436360_0580177 Ga0436360_0580177_110_625 171
207 3300039447 Ga0436361_0784741 Ga0436361_0784741_2423_2938 171
208 3300039453 Ga0436362_1006124 Ga0436362_1006124_222_740 171
209 3300039453 Ga0436362_1196663 Ga0436362_1196663_334_861 171
210 3300046462 Ga0495651_0108510 Ga0495651_0108510_985_1506 171
211 3300046463 Ga0495653_0136459 Ga0495653_0136459_509_1030 171
212 3300046472 Ga0495580_0196947 Ga0495580_0196947_33_551 171
213 3300046472 Ga0495580_0202170 Ga0495580_0202170_817_1332 171
214 3300046517 Ga0495630_0547717 Ga0495630_0547717_115_633 171
215 3300046529 Ga0495652_0109667 Ga0495652_0109667_1025_1546 171
216 3300046675 Ga0495657_0455483 Ga0495657_0455483_100_618 171
217 3300046680 Ga0495646_0285415 Ga0495646_0285415_200_721 171
218 3300046690 Ga0495624_0027359 Ga0495624_0027359_387_908 171
219 3300047317 Ga0495604_0088592 Ga0495604_0088592_409_927 171
220 3300047317 Ga0495604_0302316 Ga0495604_0302316_526_1047 171
221 3300047319 Ga0495674_0054658 Ga0495674_0054658_1422_1940 171
222 3300047319 Ga0495674_0084288 Ga0495674_0084288_1812_2330 171
223 3300047321 Ga0495676_0719724 Ga0495676_0719724_95_616 171
224 3300048088 Ga0495602_0074061 Ga0495602_0074061_455_973 171
225 3300049568 Ga0501031_0001748 Ga0501031_0001748_10364_10894 171
226 3300049569 Ga0501032_0002764 Ga0501032_0002764_9523_10053 171
227 3300049570 Ga0501033_0008910 Ga0501033_0008910_4887_5417 171
228 3300049571 Ga0501034_0058062 Ga0501034_0058062_2336_2866 171
229 3300049572 Ga0501036_0000160 Ga0501036_0000160_23550_24080 171
230 3300049573 Ga0501037_0002168 Ga0501037_0002168_5894_6424 171
231 3300049574 Ga0501038_0002357 Ga0501038_0002357_1860_2390 171
232 3300049575 Ga0501039_0036845 Ga0501039_0036845_909_1439 171
233 3300049578 Ga0501042_0160888 Ga0501042_0160888_992_1522 171
234 3300049579 Ga0501043_0003033 Ga0501043_0003033_7598_8128 171
235 3300049580 Ga0501046_0001221 Ga0501046_0001221_18474_19004 171
236 3300049581 Ga0501047_0011380 Ga0501047_0011380_1024_1554 171
237 3300049582 Ga0501048_0018166 Ga0501048_0018166_3731_4261 171
238 3300049583 Ga0501067_0000681 Ga0501067_0000681_15214_15744 171
239 3300049584 Ga0501068_0015063 Ga0501068_0015063_1893_2423 171
240 3300049585 Ga0501069_0000424 Ga0501069_0000424_17612_18142 171
241 3300049586 Ga0501070_0015599 Ga0501070_0015599_3739_4269 171
242 3300049588 Ga0501072_0004156 Ga0501072_0004156_8478_9008 171
243 3300049589 Ga0501073_0000160 Ga0501073_0000160_23498_24028 171
244 3300049590 Ga0501074_0021942 Ga0501074_0021942_1771_2301 171
245 3300049591 Ga0501075_0174966 Ga0501075_0174966_134_664 171
246 3300049592 Ga0501076_0053794 Ga0501076_0053794_1636_2166 171
247 3300049741 Ga0501079_0004133 Ga0501079_0004133_8263_8793 171
248 3300049742 Ga0501080_0000021 Ga0501080_0000021_4622_5152 171
249 3300049744 Ga0501083_0007209 Ga0501083_0007209_2336_2866 171
250 3300049822 Ga0501035_0014601 Ga0501035_0014601_2916_3446 171
251 3300049823 Ga0501044_0005686 Ga0501044_0005686_8263_8793 171
252 3300054114 Ga0501084_0007916 Ga0501084_0007916_5484_6014 171
253 3300060353 Ga0501082_0032958 Ga0501082_0032958_1953_2483 171
254 3300061734 Ga0530510_0204607 Ga0530510_0204607_352_882 171
255 2162886012 MBSR1b_contig_2475507 MBSR1b_0717.00007540 173
256 3300001990 JGI24737J22298_10027203 JGI24737J22298_100272032 173
257 3300002074 JGI24748J21848_1002004 JGI24748J21848_10020042 173
258 3300002155 JGI24033J26618_1012562 JGI24033J26618_10125622 173
259 3300002239 JGI24034J26672_10044919 JGI24034J26672_100449192 173
260 3300002459 JGI24751J29686_10006037 JGI24751J29686_100060373 173
261 3300005293 Ga0065715_10096563 Ga0065715_100965633 173
262 3300005328 Ga0070676_10001801 Ga0070676_100018017 173
263 3300005329 Ga0070683_100003702 Ga0070683_1000037028 173
264 3300005330 Ga0070690_100008023 Ga0070690_1000080234 173
265 3300005333 Ga0070677_10029779 Ga0070677_100297792 173
266 3300005338 Ga0068868_100013659 Ga0068868_1000136592 173
267 3300005339 Ga0070660_100010639 Ga0070660_1000106397 173
268 3300005340 Ga0070689_100002679 Ga0070689_1000026797 173
269 3300005343 Ga0070687_100001713 Ga0070687_1000017137 173
270 3300005344 Ga0070661_100006705 Ga0070661_1000067057 173
271 3300005347 Ga0070668_100011516 Ga0070668_1000115167 173
272 3300005354 Ga0070675_100028106 Ga0070675_1000281064 173
273 3300005355 Ga0070671_100208015 Ga0070671_1002080152 173
274 3300005356 Ga0070674_100010921 Ga0070674_1000109214 173
275 3300005364 Ga0070673_100015844 Ga0070673_1000158446 173
276 3300005365 Ga0070688_100001844 Ga0070688_1000018446 173
277 3300005366 Ga0070659_100051346 Ga0070659_1000513462 173
278 3300005367 Ga0070667_100047368 Ga0070667_1000473684 173
279 3300005441 Ga0070700_100035465 Ga0070700_1000354652 173
280 3300005455 Ga0070663_100008478 Ga0070663_1000084786 173
281 3300005456 Ga0070678_100004251 Ga0070678_1000042513 173
282 3300005457 Ga0070662_100010560 Ga0070662_1000105607 173
283 3300005459 Ga0068867_100036447 Ga0068867_1000364473 173
284 3300005466 Ga0070685_10001765 Ga0070685_100017658 173
285 3300005535 Ga0070684_100001094 Ga0070684_1000010947 173
286 3300005539 Ga0068853_100004477 Ga0068853_1000044776 173
287 3300005543 Ga0070672_100115918 Ga0070672_1001159182 173
288 3300005544 Ga0070686_100003305 Ga0070686_1000033054 173
289 3300005546 Ga0070696_100149645 Ga0070696_1001496452 173
290 3300005563 Ga0068855_100026997 Ga0068855_1000269973 173
291 3300005577 Ga0068857_100019383 Ga0068857_1000193837 173
292 3300005578 Ga0068854_100013542 Ga0068854_1000135422 173
293 3300005615 Ga0070702_100019517 Ga0070702_1000195173 173
294 3300005616 Ga0068852_100001934 Ga0068852_10000193411 173
295 3300005617 Ga0068859_100017697 Ga0068859_1000176976 173
296 3300005718 Ga0068866_10019860 Ga0068866_100198601 173
297 3300005719 Ga0068861_100104329 Ga0068861_1001043294 173
298 3300005842 Ga0068858_100008165 Ga0068858_1000081657 173
299 3300005843 Ga0068860_100015201 Ga0068860_1000152014 173
300 3300005844 Ga0068862_100007710 Ga0068862_1000077104 173
301 3300006237 Ga0097621_100083605 Ga0097621_1000836053 173
302 3300006358 Ga0068871_100009658 Ga0068871_1000096582 173
303 3300006881 Ga0068865_100007893 Ga0068865_1000078937 173
304 3300006931 Ga0097620_100017698 Ga0097620_1000176986 173
305 3300009098 Ga0105245_10058119 Ga0105245_100581193 173
306 3300009101 Ga0105247_10001315 Ga0105247_1000131512 173
307 3300009148 Ga0105243_10499742 Ga0105243_104997422 173
308 3300009174 Ga0105241_10008841 Ga0105241_100088414 173
309 3300009176 Ga0105242_10005691 Ga0105242_100056919 173
310 3300009177 Ga0105248_10073527 Ga0105248_100735271 173
311 3300009545 Ga0105237_10042148 Ga0105237_100421483 173
312 3300009553 Ga0105249_10029976 Ga0105249_100299764 173
313 3300013100 Ga0157373_10002222 Ga0157373_1000222213 173
314 3300013102 Ga0157371_10002758 Ga0157371_100027589 173
315 3300013105 Ga0157369_10021695 Ga0157369_100216957 173
316 3300013297 Ga0157378_10023563 Ga0157378_100235634 173
317 3300013306 Ga0163162_10303622 Ga0163162_103036222 173
318 3300013307 Ga0157372_10043920 Ga0157372_100439202 173
319 3300013308 Ga0157375_10189379 Ga0157375_101893792 173
320 3300014325 Ga0163163_10001220 Ga0163163_1000122013 173
321 3300014326 Ga0157380_10125993 Ga0157380_101259933 173
322 3300014745 Ga0157377_10000456 Ga0157377_1000045613 173
323 3300014968 Ga0157379_10007834 Ga0157379_100078342 173
324 3300017792 Ga0163161_10001906 Ga0163161_100019066 173
325 3300025315 Ga0207697_10004295 Ga0207697_100042956 173
326 3300025321 Ga0207656_10005947 Ga0207656_100059473 173
327 3300025893 Ga0207682_10032184 Ga0207682_100321842 173
328 3300025899 Ga0207642_10650896 Ga0207642_106508961 173
329 3300025901 Ga0207688_10012076 Ga0207688_100120764 173
330 3300025903 Ga0207680_10112478 Ga0207680_101124782 173
331 3300025904 Ga0207647_10004255 Ga0207647_100042558 173
332 3300025907 Ga0207645_10000223 Ga0207645_1000022326 173
333 3300025908 Ga0207643_10000338 Ga0207643_1000033815 173
334 3300025911 Ga0207654_10037442 Ga0207654_100374423 173
335 3300025918 Ga0207662_10024120 Ga0207662_100241203 173
336 3300025919 Ga0207657_10001186 Ga0207657_1000118613 173
337 3300025920 Ga0207649_10000136 Ga0207649_100001368 173
338 3300025925 Ga0207650_10000040 Ga0207650_10000040142 173
339 3300025927 Ga0207687_10467719 Ga0207687_104677192 173
340 3300025931 Ga0207644_10071789 Ga0207644_100717892 173
341 3300025933 Ga0207706_10000141 Ga0207706_1000014115 173
342 3300025934 Ga0207686_10059189 Ga0207686_100591892 173
343 3300025937 Ga0207669_10151871 Ga0207669_101518712 173
344 3300025938 Ga0207704_10020812 Ga0207704_100208125 173
345 3300025940 Ga0207691_10000456 Ga0207691_1000045618 173
346 3300025941 Ga0207711_10012595 Ga0207711_100125953 173
347 3300025942 Ga0207689_10001204 Ga0207689_100012047 173
348 3300025944 Ga0207661_10040000 Ga0207661_100400002 173
349 3300025945 Ga0207679_10000049 Ga0207679_1000004922 173
350 3300025960 Ga0207651_10001216 Ga0207651_100012168 173
351 3300025961 Ga0207712_10394354 Ga0207712_103943542 173
352 3300025981 Ga0207640_10179064 Ga0207640_101790642 173
353 3300025986 Ga0207658_10009905 Ga0207658_100099052 173
354 3300026035 Ga0207703_10087511 Ga0207703_100875113 173
355 3300026041 Ga0207639_10125577 Ga0207639_101255771 173
356 3300026067 Ga0207678_10000411 Ga0207678_100004117 173
357 3300026078 Ga0207702_10046824 Ga0207702_100468243 173
358 3300026088 Ga0207641_10000009 Ga0207641_10000009231 173
359 3300026089 Ga0207648_10000514 Ga0207648_1000051417 173
360 3300026095 Ga0207676_10000149 Ga0207676_100001496 173
361 3300026116 Ga0207674_10000010 Ga0207674_1000001056 173
362 3300026118 Ga0207675_100008103 Ga0207675_1000081035 173
363 3300026121 Ga0207683_10000191 Ga0207683_1000019119 173
364 3300026142 Ga0207698_10246746 Ga0207698_102467462 173
365 3300028379 Ga0268266_10006384 Ga0268266_100063846 173
366 3300028380 Ga0268265_10020959 Ga0268265_100209593 173
367 3300028381 Ga0268264_10015600 Ga0268264_100156005 173
368 3300046684 Ga0495669_0102214 Ga0495669_0102214_22_543 173
369 3300048904 Ga0496101_0025496 Ga0496101_0025496_152_673 173
370 3300048905 Ga0496102_0191291 Ga0496102_0191291_1288_1809 173
371 3300048909 Ga0496106_0500329 Ga0496106_0500329_116_637 173
372 3300048910 Ga0496107_0293947 Ga0496107_0293947_49_570 173
373 3300048911 Ga0496108_0025849 Ga0496108_0025849_589_1110 173
374 3300048912 Ga0496109_0000084 Ga0496109_0000084_74035_74556 173
375 3300048913 Ga0496110_0002607 Ga0496110_0002607_5377_5898 173
376 3300048915 Ga0496112_0000119 Ga0496112_0000119_42925_43446 173
377 3300048916 Ga0496113_0001388 Ga0496113_0001388_11521_12042 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

27

166

0.89

PF05163

DinB

DinB family

30

170

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.8552 10 170
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8323 21 169
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8318 10 168
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.8317 21 168
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.814 21 168
ID Description Score Start End Superfamily
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8665 22 169 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8475 10 170 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8012 10 170 1.20.120.450
5cogA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7801 21 173 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7688 11 166 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V8RX79-F1-model_v4 DinB family protein 0.9807 4 169
AF-A0A7C1AII7-F1-model_v4 DinB family protein 0.9801 28 170
AF-A0A372IPF4-F1-model_v4 DinB family protein 0.976 4 172
AF-A0A6I0E9H2-F1-model_v4 DinB family protein 0.9757 6 169
AF-A0A523MLF0-F1-model_v4 Response regulator 0.9749 1 173 GO:0000160

Feature Viewer

pLDDT pTM Quality
91.35 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map