F427467

General Info

Members Datasets Scaffolds Average Seq Length
376 115 752 271

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0238076|Ga0495649_0238076_53_928
Length 291
Sequence MSSRFPELRAAFAALAFACAAGGAHAAHAGAPQTTDPTPELRVCADPDNLPYSQRDESGFENRIARLVADDLGMRLRYFWQEQRRGFVRKTMGAGECDLFVGVPAGFDKVLTTRPYYRSTYVAVTRSGAPAFGGFAPAALRGHRFGVQLIGNDMAASPPGFALAKGGAVDKVTGFLVYGDGPAAKRMADALSAGAIDVALAWGPQAAYFAHHARAPMAVAKLEPPANLTVPFEYSIAMGVRKGNTALRDRLDALLARRKTDIDAILDAYFVPRVATAALAAPSAAAQGGQP

Samples

Sample ID Description Type Environment
1 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
8 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
9 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
13 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
14 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
15 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
16 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
17 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
18 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
19 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
20 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
21 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
22 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
23 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
24 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
25 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
26 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
27 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
28 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
29 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
30 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
31 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
32 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
33 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
34 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
35 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
36 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
37 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
38 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
39 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
40 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
41 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
42 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
43 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
44 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
45 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
46 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
47 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
48 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
49 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
50 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
51 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
52 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
53 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
54 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
55 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
56 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
57 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
58 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
59 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
60 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
61 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
62 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
63 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
64 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
65 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
66 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
67 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
68 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
69 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
70 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
71 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
72 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
75 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
76 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
77 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
78 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
79 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
80 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
81 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
82 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
90 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
91 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
92 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
93 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
96 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
97 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
98 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
99 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
100 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
103 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
115 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.39
Rhizosphere 96.81
Stem 0
Stem Tuber 0
Unclassified 1.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495649_0238076 3300046694 Unclassified 938
2 Ga0070658_10003122 3300005327 Bacteria 13674
3 Ga0070658_10188777 3300005327 Bacteria 1737
4 Ga0070660_100001131 3300005339 Bacteria 17999
5 Ga0070660_100139711 3300005339 Bacteria 1943
6 Ga0070661_100037936 3300005344 Bacteria 3506
7 Ga0070659_100049464 3300005366 Bacteria 3306
8 Ga0070659_100194102 3300005366 Bacteria 1670
9 Ga0068855_100012116 3300005563 Bacteria 10419
10 Ga0207688_10096445 3300025901 Bacteria 1703
11 Ga0207705_10000223 3300025909 Bacteria 56633
12 Ga0207654_10408901 3300025911 Bacteria 945
13 Ga0207657_10015072 3300025919 Bacteria 7508
14 Ga0207657_10027220 3300025919 Bacteria 5238
15 Ga0207649_10092713 3300025920 Bacteria 1981
16 Ga0207667_10006615 3300025949 Bacteria 14011
17 Ga0395898_0094042 3300037466 Bacteria 2881
18 Ga0395905_0040837 3300037471 Bacteria 4352
19 Ga0395905_0230703 3300037471 Bacteria 1731
20 Ga0395905_0261585 3300037471 Bacteria 1615
21 Ga0395901_0300352 3300038443 Bacteria 1665
22 Ga0439448_0021779 3300042005 Bacteria 1988
23 Ga0439450_043865 3300042008 Bacteria 1046
24 Ga0451577_0002799 3300042876 Bacteria 20128
25 Ga0466965_0015703 3300044683 Bacteria 3598
26 Ga0466966_0058879 3300044684 Bacteria 2427
27 Ga0466966_0067901 3300044684 Bacteria 2238
28 Ga0466961_0059851 3300044693 Bacteria 2422
29 Ga0466963_0003457 3300044694 Bacteria 9048
30 Ga0466963_0144959 3300044694 Bacteria 1647
31 Ga0466964_0087862 3300044706 Bacteria 1347
32 Ga0453684_0436535 3300044712 Bacteria 1460
33 Ga0466970_0013019 3300044765 Bacteria 4262
34 Ga0466957_0000005 3300044842 Bacteria 102026
35 Ga0466957_0143766 3300044842 Bacteria 1539
36 Ga0466959_0020494 3300045049 Bacteria 4872
37 Ga0466959_0113714 3300045049 Bacteria 1930
38 Ga0466958_0194040 3300045836 Bacteria 1291
39 Ga0495617_040203 3300046452 Bacteria 1564
40 Ga0495627_040788 3300046453 Bacteria 1428
41 Ga0495603_0085075 3300046455 Bacteria 1851
42 Ga0495590_0000216 3300046457 Bacteria 31421
43 Ga0495590_0000820 3300046457 Bacteria 14123
44 Ga0495590_0010604 3300046457 Bacteria 3456
45 Ga0495590_0048978 3300046457 Bacteria 1474
46 Ga0495591_030416 3300046458 Bacteria 1630
47 Ga0495629_0003837 3300046459 Bacteria 11337
48 Ga0495638_0005668 3300046460 Bacteria 9200
49 Ga0495638_0026029 3300046460 Bacteria 3797
50 Ga0495653_0009068 3300046463 Bacteria 8136
51 Ga0495653_0017516 3300046463 Bacteria 5826
52 Ga0495653_0072887 3300046463 Bacteria 2564
53 Ga0495580_0019214 3300046472 Bacteria 5078
54 Ga0495582_0002301 3300046473 Bacteria 10702
55 Ga0495582_0003017 3300046473 Bacteria 9435
56 Ga0495582_0062743 3300046473 Bacteria 2053
57 Ga0495605_0003811 3300046474 Bacteria 8943
58 Ga0495605_0006702 3300046474 Bacteria 6592
59 Ga0495605_0009588 3300046474 Bacteria 5437
60 Ga0495605_0018963 3300046474 Bacteria 3682
61 Ga0495605_0027361 3300046474 Bacteria 2955
62 Ga0495605_0069430 3300046474 Bacteria 1668
63 Ga0495664_0110939 3300046477 Bacteria 1656
64 Ga0495584_0000075 3300046491 Bacteria 70256
65 Ga0495584_0004065 3300046491 Bacteria 7901
66 Ga0495584_0004123 3300046491 Bacteria 7842
67 Ga0495584_0023051 3300046491 Bacteria 3157
68 Ga0495584_0029621 3300046491 Bacteria 2775
69 Ga0495584_0040740 3300046491 Bacteria 2345
70 Ga0495584_0086202 3300046491 Bacteria 1582
71 Ga0495584_0178550 3300046491 Unclassified 1079
72 Ga0495585_0000298 3300046492 Bacteria 49916
73 Ga0495585_0000414 3300046492 Bacteria 41285
74 Ga0495585_0021948 3300046492 Bacteria 3664
75 Ga0495585_0026376 3300046492 Bacteria 3318
76 Ga0495585_0038144 3300046492 Bacteria 2704
77 Ga0495585_0044847 3300046492 Bacteria 2469
78 Ga0495585_0056680 3300046492 Bacteria 2163
79 Ga0495585_0067175 3300046492 Bacteria 1961
80 Ga0495585_0068980 3300046492 Bacteria 1930
81 Ga0495585_0086570 3300046492 Bacteria 1692
82 Ga0495585_0099837 3300046492 Bacteria 1553
83 Ga0495585_0169323 3300046492 Bacteria 1129
84 Ga0495594_0004550 3300046499 Bacteria 7132
85 Ga0495594_0011530 3300046499 Bacteria 4594
86 Ga0495594_0016906 3300046499 Bacteria 3848
87 Ga0495594_0049349 3300046499 Bacteria 2313
88 Ga0495594_0122001 3300046499 Bacteria 1473
89 Ga0495594_0199164 3300046499 Bacteria 1141
90 Ga0495596_0000186 3300046500 Bacteria 43253
91 Ga0495596_0000276 3300046500 Bacteria 34053
92 Ga0495596_0000980 3300046500 Bacteria 16995
93 Ga0495596_0001371 3300046500 Bacteria 13982
94 Ga0495596_0005963 3300046500 Bacteria 5683
95 Ga0495596_0007781 3300046500 Bacteria 4808
96 Ga0495596_0009621 3300046500 Bacteria 4248
97 Ga0495596_0010070 3300046500 Bacteria 4132
98 Ga0495596_0019419 3300046500 Bacteria 2791
99 Ga0495596_0032105 3300046500 Bacteria 2095
100 Ga0495596_0043696 3300046500 Bacteria 1766
101 Ga0495596_0046523 3300046500 Bacteria 1704
102 Ga0495596_0102908 3300046500 Bacteria 1109
103 Ga0495607_0004144 3300046501 Bacteria 10799
104 Ga0495607_0009653 3300046501 Bacteria 6521
105 Ga0495607_0011029 3300046501 Bacteria 6036
106 Ga0495607_0051675 3300046501 Bacteria 2385
107 Ga0495607_0060842 3300046501 Bacteria 2148
108 Ga0495607_0085077 3300046501 Bacteria 1728
109 Ga0495607_0101862 3300046501 Bacteria 1537
110 Ga0495607_0160359 3300046501 Bacteria 1143
111 Ga0495583_0000442 3300046506 Bacteria 62158
112 Ga0495583_0001893 3300046506 Bacteria 19400
113 Ga0495583_0002056 3300046506 Bacteria 18220
114 Ga0495583_0006730 3300046506 Bacteria 7438
115 Ga0495583_0007742 3300046506 Bacteria 6686
116 Ga0495583_0055363 3300046506 Bacteria 1792
117 Ga0495583_0062976 3300046506 Bacteria 1650
118 Ga0495606_0003979 3300046507 Bacteria 15132
119 Ga0495606_0024960 3300046507 Bacteria 4292
120 Ga0495606_0042234 3300046507 Bacteria 3051
121 Ga0495606_0056909 3300046507 Bacteria 2520
122 Ga0495606_0066086 3300046507 Bacteria 2295
123 Ga0495606_0103418 3300046507 Bacteria 1730
124 Ga0495606_0298586 3300046507 Bacteria 874
125 Ga0495610_0096655 3300046512 Bacteria 1330
126 Ga0495616_0001061 3300046513 Bacteria 19641
127 Ga0495616_0003324 3300046513 Bacteria 10332
128 Ga0495616_0005701 3300046513 Bacteria 7628
129 Ga0495616_0043838 3300046513 Bacteria 2271
130 Ga0495616_0114251 3300046513 Bacteria 1252
131 Ga0495616_0187203 3300046513 Bacteria 916
132 Ga0495630_0011865 3300046517 Bacteria 6316
133 Ga0495631_0000105 3300046518 Bacteria 55305
134 Ga0495631_0002337 3300046518 Bacteria 10800
135 Ga0495631_0002520 3300046518 Bacteria 10296
136 Ga0495631_0005141 3300046518 Bacteria 6896
137 Ga0495631_0005230 3300046518 Bacteria 6826
138 Ga0495631_0005617 3300046518 Bacteria 6548
139 Ga0495631_0010629 3300046518 Bacteria 4552
140 Ga0495631_0010662 3300046518 Bacteria 4544
141 Ga0495631_0010727 3300046518 Bacteria 4529
142 Ga0495631_0026806 3300046518 Bacteria 2642
143 Ga0495631_0030803 3300046518 Bacteria 2431
144 Ga0495631_0030922 3300046518 Bacteria 2426
145 Ga0495631_0032203 3300046518 Bacteria 2365
146 Ga0495631_0039674 3300046518 Bacteria 2088
147 Ga0495631_0046535 3300046518 Bacteria 1906
148 Ga0495631_0062104 3300046518 Bacteria 1619
149 Ga0495631_0129903 3300046518 Bacteria 1082
150 Ga0495632_0000043 3300046519 Bacteria 143694
151 Ga0495632_0000470 3300046519 Bacteria 38273
152 Ga0495632_0002550 3300046519 Bacteria 13804
153 Ga0495632_0012936 3300046519 Bacteria 4785
154 Ga0495632_0032300 3300046519 Bacteria 2698
155 Ga0495637_0009147 3300046520 Bacteria 4838
156 Ga0495643_0004368 3300046522 Bacteria 9914
157 Ga0495643_0012749 3300046522 Bacteria 5059
158 Ga0495643_0110719 3300046522 Bacteria 1396
159 Ga0495643_0110723 3300046522 Bacteria 1396
160 Ga0495644_0013871 3300046523 Bacteria 3089
161 Ga0495644_0055186 3300046523 Bacteria 1492
162 Ga0495648_0011627 3300046524 Bacteria 6612
163 Ga0495648_0013928 3300046524 Bacteria 5919
164 Ga0495648_0024478 3300046524 Bacteria 4110
165 Ga0495648_0031220 3300046524 Bacteria 3511
166 Ga0495648_0082622 3300046524 Bacteria 1823
167 Ga0495666_0000441 3300046526 Bacteria 18463
168 Ga0495666_0051095 3300046526 Bacteria 1986
169 Ga0495666_0078071 3300046526 Bacteria 1568
170 Ga0495666_0084421 3300046526 Bacteria 1500
171 Ga0495666_0143384 3300046526 Bacteria 1112
172 Ga0495642_0000883 3300046528 Bacteria 14143
173 Ga0495642_0003923 3300046528 Bacteria 5823
174 Ga0495642_0006421 3300046528 Bacteria 4511
175 Ga0495642_0006678 3300046528 Bacteria 4428
176 Ga0495642_0008306 3300046528 Bacteria 3972
177 Ga0495642_0013828 3300046528 Bacteria 3125
178 Ga0495642_0017923 3300046528 Bacteria 2768
179 Ga0495642_0017970 3300046528 Bacteria 2765
180 Ga0495642_0026450 3300046528 Bacteria 2305
181 Ga0495642_0042799 3300046528 Bacteria 1846
182 Ga0495642_0066264 3300046528 Bacteria 1504
183 Ga0495642_0087682 3300046528 Bacteria 1315
184 Ga0495642_0089343 3300046528 Bacteria 1303
185 Ga0495652_0008263 3300046529 Bacteria 9512
186 Ga0495654_0003845 3300046530 Bacteria 9068
187 Ga0495654_0007290 3300046530 Bacteria 6193
188 Ga0495654_0095170 3300046530 Bacteria 1377
189 Ga0495665_0008544 3300046531 Bacteria 5556
190 Ga0495665_0078097 3300046531 Bacteria 1741
191 Ga0495640_0053669 3300046533 Bacteria 2763
192 Ga0495586_0044328 3300046535 Bacteria 2396
193 Ga0495586_0085672 3300046535 Bacteria 1736
194 Ga0495587_0031573 3300046536 Bacteria 3206
195 Ga0495609_0001610 3300046538 Bacteria 14751
196 Ga0495609_0004338 3300046538 Bacteria 7792
197 Ga0495609_0004421 3300046538 Bacteria 7691
198 Ga0495609_0008199 3300046538 Bacteria 5129
199 Ga0495609_0016511 3300046538 Bacteria 3440
200 Ga0495609_0041355 3300046538 Bacteria 2072
201 Ga0495609_0128425 3300046538 Bacteria 1086
202 Ga0495597_0000030 3300046542 Bacteria 134736
203 Ga0495597_0000070 3300046542 Bacteria 89649
204 Ga0495597_0000189 3300046542 Bacteria 55865
205 Ga0495597_0004296 3300046542 Bacteria 7873
206 Ga0495597_0004552 3300046542 Bacteria 7581
207 Ga0495597_0004622 3300046542 Bacteria 7504
208 Ga0495597_0015270 3300046542 Bacteria 3637
209 Ga0495597_0069506 3300046542 Bacteria 1519
210 Ga0495597_0159318 3300046542 Bacteria 922
211 Ga0495622_0007346 3300046557 Bacteria 5118
212 Ga0495622_0013214 3300046557 Bacteria 3831
213 Ga0495622_0071384 3300046557 Bacteria 1602
214 Ga0495633_0005613 3300046558 Bacteria 7608
215 Ga0495633_0007562 3300046558 Bacteria 6234
216 Ga0495633_0013139 3300046558 Bacteria 4376
217 Ga0495633_0015574 3300046558 Bacteria 3941
218 Ga0495633_0033022 3300046558 Bacteria 2497
219 Ga0495633_0052291 3300046558 Bacteria 1925
220 Ga0495633_0066692 3300046558 Bacteria 1680
221 Ga0495633_0216357 3300046558 Bacteria 877
222 Ga0495668_0000036 3300046616 Bacteria 235057
223 Ga0495668_0001482 3300046616 Bacteria 22483
224 Ga0495668_0002106 3300046616 Bacteria 17209
225 Ga0495668_0021441 3300046616 Bacteria 3704
226 Ga0495668_0022938 3300046616 Bacteria 3564
227 Ga0495668_0036052 3300046616 Bacteria 2772
228 Ga0495668_0045832 3300046616 Bacteria 2430
229 Ga0495668_0071114 3300046616 Bacteria 1912
230 Ga0495668_0084404 3300046616 Bacteria 1741
231 Ga0495634_0001486 3300046642 Bacteria 20741
232 Ga0495611_0000408 3300046648 Bacteria 26792
233 Ga0495611_0004412 3300046648 Bacteria 6088
234 Ga0495611_0018899 3300046648 Bacteria 2957
235 Ga0495611_0075029 3300046648 Bacteria 1549
236 Ga0495611_0160483 3300046648 Bacteria 1050
237 Ga0495611_0210924 3300046648 Bacteria 904
238 Ga0495625_0031802 3300046660 Bacteria 3921
239 Ga0495625_0037428 3300046660 Bacteria 3560
240 Ga0495625_0218345 3300046660 Bacteria 1250
241 Ga0495635_0231072 3300046663 Bacteria 1249
242 Ga0495661_0000084 3300046665 Bacteria 114797
243 Ga0495661_0000372 3300046665 Bacteria 48450
244 Ga0495661_0002585 3300046665 Bacteria 13884
245 Ga0495661_0003816 3300046665 Bacteria 11027
246 Ga0495661_0006400 3300046665 Bacteria 8279
247 Ga0495661_0007441 3300046665 Bacteria 7637
248 Ga0495661_0008107 3300046665 Bacteria 7285
249 Ga0495661_0012506 3300046665 Bacteria 5731
250 Ga0495661_0034885 3300046665 Bacteria 3161
251 Ga0495661_0044560 3300046665 Bacteria 2718
252 Ga0495661_0049080 3300046665 Bacteria 2561
253 Ga0495661_0103977 3300046665 Bacteria 1593
254 Ga0495661_0167511 3300046665 Bacteria 1174
255 Ga0495588_0012186 3300046674 Bacteria 4055
256 Ga0495588_0012427 3300046674 Bacteria 4024
257 Ga0495588_0017872 3300046674 Bacteria 3451
258 Ga0495588_0123779 3300046674 Unclassified 1363
259 Ga0495588_0178425 3300046674 Bacteria 1122
260 Ga0495623_0004682 3300046679 Bacteria 8992
261 Ga0495623_0111808 3300046679 Bacteria 1655
262 Ga0495623_0161110 3300046679 Bacteria 1318
263 Ga0495669_0000017 3300046684 Bacteria 131447
264 Ga0495669_0009177 3300046684 Bacteria 4167
265 Ga0495669_0033563 3300046684 Bacteria 2259
266 Ga0495669_0039162 3300046684 Bacteria 2098
267 Ga0495613_0036861 3300046689 Bacteria 3626
268 Ga0495613_0190444 3300046689 Bacteria 1450
269 Ga0495624_0037264 3300046690 Bacteria 3130
270 Ga0495624_0342003 3300046690 Unclassified 900
271 Ga0495670_0000755 3300046691 Bacteria 15518
272 Ga0495670_0009060 3300046691 Bacteria 4896
273 Ga0495670_0040502 3300046691 Bacteria 2323
274 Ga0495671_0002491 3300046692 Bacteria 11601
275 Ga0495671_0023397 3300046692 Bacteria 3228
276 Ga0495671_0060167 3300046692 Bacteria 1875
277 Ga0495649_0002064 3300046694 Bacteria 14451
278 Ga0495649_0023441 3300046694 Bacteria 3449
279 Ga0495589_0000227 3300046794 Bacteria 47488
280 Ga0495589_0003286 3300046794 Bacteria 8776
281 Ga0495589_0006278 3300046794 Bacteria 6277
282 Ga0495589_0028700 3300046794 Bacteria 2807
283 Ga0495589_0060737 3300046794 Bacteria 1856
284 Ga0495589_0115872 3300046794 Bacteria 1291
285 Ga0495600_0005415 3300046809 Bacteria 7694
286 Ga0495660_0005672 3300046810 Bacteria 7459
287 Ga0495660_0015894 3300046810 Bacteria 4343
288 Ga0495660_0020409 3300046810 Bacteria 3798
289 Ga0495660_0052472 3300046810 Bacteria 2215
290 Ga0495660_0145057 3300046810 Bacteria 1177
291 Ga0495581_0016683 3300047315 Bacteria 4269
292 Ga0495581_0088307 3300047315 Bacteria 1798
293 Ga0495604_0003298 3300047317 Bacteria 12886
294 Ga0495604_0021121 3300047317 Bacteria 5195
295 Ga0495604_0052413 3300047317 Bacteria 3159
296 Ga0495604_0152469 3300047317 Bacteria 1640
297 Ga0495636_0027443 3300047318 Bacteria 2319
298 Ga0495674_0491958 3300047319 Unclassified 982
299 Ga0495672_0002125 3300047320 Bacteria 18572
300 Ga0495672_0005762 3300047320 Bacteria 9752
301 Ga0495672_0008640 3300047320 Bacteria 7490
302 Ga0495672_0013934 3300047320 Bacteria 5527
303 Ga0495676_0000542 3300047321 Bacteria 30993
304 Ga0495676_0018242 3300047321 Bacteria 6188
305 Ga0495676_0176900 3300047321 Bacteria 1498
306 Ga0495680_0200502 3300047322 Bacteria 1432
307 Ga0495680_0205458 3300047322 Unclassified 1412
308 Ga0495683_0003006 3300047323 Bacteria 9940
309 Ga0495683_0004125 3300047323 Bacteria 8317
310 Ga0495683_0009554 3300047323 Bacteria 5166
311 Ga0495683_0034264 3300047323 Bacteria 2582
312 Ga0495683_0118689 3300047323 Bacteria 1257
313 Ga0495683_0235214 3300047323 Bacteria 810
314 Ga0495687_000007 3300047443 Bacteria 552679
315 Ga0495687_000445 3300047443 Bacteria 51086
316 Ga0495687_032169 3300047443 Bacteria 2398
317 Ga0495675_0008282 3300047444 Bacteria 6433
318 Ga0495675_0087742 3300047444 Bacteria 1954
319 Ga0495677_0000291 3300047445 Bacteria 21878
320 Ga0495677_0002022 3300047445 Bacteria 8094
321 Ga0495677_0006588 3300047445 Bacteria 4384
322 Ga0495677_0009538 3300047445 Bacteria 3584
323 Ga0495677_0016524 3300047445 Bacteria 2678
324 Ga0495677_0017370 3300047445 Bacteria 2609
325 Ga0495677_0043849 3300047445 Bacteria 1640
326 Ga0495677_0080102 3300047445 Bacteria 1223
327 Ga0495679_003998 3300047446 Bacteria 6940
328 Ga0495679_010541 3300047446 Bacteria 3623
329 Ga0495679_017542 3300047446 Bacteria 2560
330 Ga0495679_023343 3300047446 Bacteria 2100
331 Ga0495685_001504 3300047447 Bacteria 7139
332 Ga0495685_002757 3300047447 Bacteria 5540
333 Ga0495673_0008830 3300047469 Bacteria 5622
334 Ga0495681_0000555 3300047470 Bacteria 28608
335 Ga0495681_0001867 3300047470 Bacteria 15469
336 Ga0495681_0003723 3300047470 Bacteria 10563
337 Ga0495681_0013701 3300047470 Bacteria 4691
338 Ga0495681_0051881 3300047470 Bacteria 1927
339 Ga0495681_0079024 3300047470 Bacteria 1472
340 Ga0495681_0095176 3300047470 Bacteria 1309
341 Ga0495681_0098889 3300047470 Bacteria 1278
342 Ga0495593_0027373 3300047673 Bacteria 3139
343 Ga0495593_0027631 3300047673 Bacteria 3122
344 Ga0495593_0040994 3300047673 Bacteria 2491
345 Ga0495593_0082110 3300047673 Bacteria 1666
346 Ga0495602_0015057 3300048088 Bacteria 7821
347 Ga0495614_0002837 3300048089 Bacteria 7714
348 Ga0495626_0002364 3300048091 Bacteria 13237
349 Ga0495626_0003275 3300048091 Bacteria 10465
350 Ga0495626_0003326 3300048091 Bacteria 10374
351 Ga0495626_0004591 3300048091 Bacteria 8420
352 Ga0495626_0008377 3300048091 Bacteria 5678
353 Ga0495626_0011822 3300048091 Bacteria 4598
354 Ga0495626_0015705 3300048091 Bacteria 3869
355 Ga0495626_0016190 3300048091 Bacteria 3794
356 Ga0495626_0016470 3300048091 Bacteria 3753
357 Ga0495626_0028382 3300048091 Bacteria 2714
358 Ga0495626_0041553 3300048091 Bacteria 2164
359 Ga0496101_0005767 3300048904 Bacteria 7916
360 Ga0496102_0230637 3300048905 Bacteria 1746
361 Ga0496105_0112587 3300048908 Bacteria 2246
362 Ga0496109_0004727 3300048912 Bacteria 11377
363 Ga0496112_0144686 3300048915 Bacteria 2346
364 Ga0496113_0002093 3300048916 Bacteria 11491
365 Ga0496115_0014889 3300048918 Bacteria 5898
366 Ga0496115_0094828 3300048918 Bacteria 2442
367 Ga0496115_0182305 3300048918 Bacteria 1735
368 Ga0496122_0000279 3300048925 Bacteria 114185
369 Ga0496123_0000146 3300048926 Bacteria 143990
370 Ga0496125_0000938 3300048928 Bacteria 45852
371 Ga0495678_000022 3300049459 Bacteria 237031
372 Ga0495678_001009 3300049459 Bacteria 24097
373 Ga0495678_001189 3300049459 Bacteria 21418
374 Ga0495682_0000038 3300049460 Bacteria 120212
375 Ga0495682_0002402 3300049460 Bacteria 8873
376 Ga0495682_0025197 3300049460 Bacteria 2214
377 Ga0495649_0238076
378 Ga0070658_10003122
379 Ga0070658_10188777
380 Ga0070660_100001131
381 Ga0070660_100139711
382 Ga0070661_100037936
383 Ga0070659_100049464
384 Ga0070659_100194102
385 Ga0068855_100012116
386 Ga0207688_10096445
387 Ga0207705_10000223
388 Ga0207654_10408901
389 Ga0207657_10015072
390 Ga0207657_10027220
391 Ga0207649_10092713
392 Ga0207667_10006615
393 Ga0395898_0094042
394 Ga0395905_0040837
395 Ga0395905_0230703
396 Ga0395905_0261585
397 Ga0395901_0300352
398 Ga0439448_0021779
399 Ga0439450_043865
400 Ga0451577_0002799
401 Ga0466965_0015703
402 Ga0466966_0058879
403 Ga0466966_0067901
404 Ga0466961_0059851
405 Ga0466963_0003457
406 Ga0466963_0144959
407 Ga0466964_0087862
408 Ga0453684_0436535
409 Ga0466970_0013019
410 Ga0466957_0000005
411 Ga0466957_0143766
412 Ga0466959_0020494
413 Ga0466959_0113714
414 Ga0466958_0194040
415 Ga0495617_040203
416 Ga0495627_040788
417 Ga0495603_0085075
418 Ga0495590_0000216
419 Ga0495590_0000820
420 Ga0495590_0010604
421 Ga0495590_0048978
422 Ga0495591_030416
423 Ga0495629_0003837
424 Ga0495638_0005668
425 Ga0495638_0026029
426 Ga0495653_0009068
427 Ga0495653_0017516
428 Ga0495653_0072887
429 Ga0495580_0019214
430 Ga0495582_0002301
431 Ga0495582_0003017
432 Ga0495582_0062743
433 Ga0495605_0003811
434 Ga0495605_0006702
435 Ga0495605_0009588
436 Ga0495605_0018963
437 Ga0495605_0027361
438 Ga0495605_0069430
439 Ga0495664_0110939
440 Ga0495584_0000075
441 Ga0495584_0004065
442 Ga0495584_0004123
443 Ga0495584_0023051
444 Ga0495584_0029621
445 Ga0495584_0040740
446 Ga0495584_0086202
447 Ga0495584_0178550
448 Ga0495585_0000298
449 Ga0495585_0000414
450 Ga0495585_0021948
451 Ga0495585_0026376
452 Ga0495585_0038144
453 Ga0495585_0044847
454 Ga0495585_0056680
455 Ga0495585_0067175
456 Ga0495585_0068980
457 Ga0495585_0086570
458 Ga0495585_0099837
459 Ga0495585_0169323
460 Ga0495594_0004550
461 Ga0495594_0011530
462 Ga0495594_0016906
463 Ga0495594_0049349
464 Ga0495594_0122001
465 Ga0495594_0199164
466 Ga0495596_0000186
467 Ga0495596_0000276
468 Ga0495596_0000980
469 Ga0495596_0001371
470 Ga0495596_0005963
471 Ga0495596_0007781
472 Ga0495596_0009621
473 Ga0495596_0010070
474 Ga0495596_0019419
475 Ga0495596_0032105
476 Ga0495596_0043696
477 Ga0495596_0046523
478 Ga0495596_0102908
479 Ga0495607_0004144
480 Ga0495607_0009653
481 Ga0495607_0011029
482 Ga0495607_0051675
483 Ga0495607_0060842
484 Ga0495607_0085077
485 Ga0495607_0101862
486 Ga0495607_0160359
487 Ga0495583_0000442
488 Ga0495583_0001893
489 Ga0495583_0002056
490 Ga0495583_0006730
491 Ga0495583_0007742
492 Ga0495583_0055363
493 Ga0495583_0062976
494 Ga0495606_0003979
495 Ga0495606_0024960
496 Ga0495606_0042234
497 Ga0495606_0056909
498 Ga0495606_0066086
499 Ga0495606_0103418
500 Ga0495606_0298586
501 Ga0495610_0096655
502 Ga0495616_0001061
503 Ga0495616_0003324
504 Ga0495616_0005701
505 Ga0495616_0043838
506 Ga0495616_0114251
507 Ga0495616_0187203
508 Ga0495630_0011865
509 Ga0495631_0000105
510 Ga0495631_0002337
511 Ga0495631_0002520
512 Ga0495631_0005141
513 Ga0495631_0005230
514 Ga0495631_0005617
515 Ga0495631_0010629
516 Ga0495631_0010662
517 Ga0495631_0010727
518 Ga0495631_0026806
519 Ga0495631_0030803
520 Ga0495631_0030922
521 Ga0495631_0032203
522 Ga0495631_0039674
523 Ga0495631_0046535
524 Ga0495631_0062104
525 Ga0495631_0129903
526 Ga0495632_0000043
527 Ga0495632_0000470
528 Ga0495632_0002550
529 Ga0495632_0012936
530 Ga0495632_0032300
531 Ga0495637_0009147
532 Ga0495643_0004368
533 Ga0495643_0012749
534 Ga0495643_0110719
535 Ga0495643_0110723
536 Ga0495644_0013871
537 Ga0495644_0055186
538 Ga0495648_0011627
539 Ga0495648_0013928
540 Ga0495648_0024478
541 Ga0495648_0031220
542 Ga0495648_0082622
543 Ga0495666_0000441
544 Ga0495666_0051095
545 Ga0495666_0078071
546 Ga0495666_0084421
547 Ga0495666_0143384
548 Ga0495642_0000883
549 Ga0495642_0003923
550 Ga0495642_0006421
551 Ga0495642_0006678
552 Ga0495642_0008306
553 Ga0495642_0013828
554 Ga0495642_0017923
555 Ga0495642_0017970
556 Ga0495642_0026450
557 Ga0495642_0042799
558 Ga0495642_0066264
559 Ga0495642_0087682
560 Ga0495642_0089343
561 Ga0495652_0008263
562 Ga0495654_0003845
563 Ga0495654_0007290
564 Ga0495654_0095170
565 Ga0495665_0008544
566 Ga0495665_0078097
567 Ga0495640_0053669
568 Ga0495586_0044328
569 Ga0495586_0085672
570 Ga0495587_0031573
571 Ga0495609_0001610
572 Ga0495609_0004338
573 Ga0495609_0004421
574 Ga0495609_0008199
575 Ga0495609_0016511
576 Ga0495609_0041355
577 Ga0495609_0128425
578 Ga0495597_0000030
579 Ga0495597_0000070
580 Ga0495597_0000189
581 Ga0495597_0004296
582 Ga0495597_0004552
583 Ga0495597_0004622
584 Ga0495597_0015270
585 Ga0495597_0069506
586 Ga0495597_0159318
587 Ga0495622_0007346
588 Ga0495622_0013214
589 Ga0495622_0071384
590 Ga0495633_0005613
591 Ga0495633_0007562
592 Ga0495633_0013139
593 Ga0495633_0015574
594 Ga0495633_0033022
595 Ga0495633_0052291
596 Ga0495633_0066692
597 Ga0495633_0216357
598 Ga0495668_0000036
599 Ga0495668_0001482
600 Ga0495668_0002106
601 Ga0495668_0021441
602 Ga0495668_0022938
603 Ga0495668_0036052
604 Ga0495668_0045832
605 Ga0495668_0071114
606 Ga0495668_0084404
607 Ga0495634_0001486
608 Ga0495611_0000408
609 Ga0495611_0004412
610 Ga0495611_0018899
611 Ga0495611_0075029
612 Ga0495611_0160483
613 Ga0495611_0210924
614 Ga0495625_0031802
615 Ga0495625_0037428
616 Ga0495625_0218345
617 Ga0495635_0231072
618 Ga0495661_0000084
619 Ga0495661_0000372
620 Ga0495661_0002585
621 Ga0495661_0003816
622 Ga0495661_0006400
623 Ga0495661_0007441
624 Ga0495661_0008107
625 Ga0495661_0012506
626 Ga0495661_0034885
627 Ga0495661_0044560
628 Ga0495661_0049080
629 Ga0495661_0103977
630 Ga0495661_0167511
631 Ga0495588_0012186
632 Ga0495588_0012427
633 Ga0495588_0017872
634 Ga0495588_0123779
635 Ga0495588_0178425
636 Ga0495623_0004682
637 Ga0495623_0111808
638 Ga0495623_0161110
639 Ga0495669_0000017
640 Ga0495669_0009177
641 Ga0495669_0033563
642 Ga0495669_0039162
643 Ga0495613_0036861
644 Ga0495613_0190444
645 Ga0495624_0037264
646 Ga0495624_0342003
647 Ga0495670_0000755
648 Ga0495670_0009060
649 Ga0495670_0040502
650 Ga0495671_0002491
651 Ga0495671_0023397
652 Ga0495671_0060167
653 Ga0495649_0002064
654 Ga0495649_0023441
655 Ga0495589_0000227
656 Ga0495589_0003286
657 Ga0495589_0006278
658 Ga0495589_0028700
659 Ga0495589_0060737
660 Ga0495589_0115872
661 Ga0495600_0005415
662 Ga0495660_0005672
663 Ga0495660_0015894
664 Ga0495660_0020409
665 Ga0495660_0052472
666 Ga0495660_0145057
667 Ga0495581_0016683
668 Ga0495581_0088307
669 Ga0495604_0003298
670 Ga0495604_0021121
671 Ga0495604_0052413
672 Ga0495604_0152469
673 Ga0495636_0027443
674 Ga0495674_0491958
675 Ga0495672_0002125
676 Ga0495672_0005762
677 Ga0495672_0008640
678 Ga0495672_0013934
679 Ga0495676_0000542
680 Ga0495676_0018242
681 Ga0495676_0176900
682 Ga0495680_0200502
683 Ga0495680_0205458
684 Ga0495683_0003006
685 Ga0495683_0004125
686 Ga0495683_0009554
687 Ga0495683_0034264
688 Ga0495683_0118689
689 Ga0495683_0235214
690 Ga0495687_000007
691 Ga0495687_000445
692 Ga0495687_032169
693 Ga0495675_0008282
694 Ga0495675_0087742
695 Ga0495677_0000291
696 Ga0495677_0002022
697 Ga0495677_0006588
698 Ga0495677_0009538
699 Ga0495677_0016524
700 Ga0495677_0017370
701 Ga0495677_0043849
702 Ga0495677_0080102
703 Ga0495679_003998
704 Ga0495679_010541
705 Ga0495679_017542
706 Ga0495679_023343
707 Ga0495685_001504
708 Ga0495685_002757
709 Ga0495673_0008830
710 Ga0495681_0000555
711 Ga0495681_0001867
712 Ga0495681_0003723
713 Ga0495681_0013701
714 Ga0495681_0051881
715 Ga0495681_0079024
716 Ga0495681_0095176
717 Ga0495681_0098889
718 Ga0495593_0027373
719 Ga0495593_0027631
720 Ga0495593_0040994
721 Ga0495593_0082110
722 Ga0495602_0015057
723 Ga0495614_0002837
724 Ga0495626_0002364
725 Ga0495626_0003275
726 Ga0495626_0003326
727 Ga0495626_0004591
728 Ga0495626_0008377
729 Ga0495626_0011822
730 Ga0495626_0015705
731 Ga0495626_0016190
732 Ga0495626_0016470
733 Ga0495626_0028382
734 Ga0495626_0041553
735 Ga0496101_0005767
736 Ga0496102_0230637
737 Ga0496105_0112587
738 Ga0496109_0004727
739 Ga0496112_0144686
740 Ga0496113_0002093
741 Ga0496115_0014889
742 Ga0496115_0094828
743 Ga0496115_0182305
744 Ga0496122_0000279
745 Ga0496123_0000146
746 Ga0496125_0000938
747 Ga0495678_000022
748 Ga0495678_001009
749 Ga0495678_001189
750 Ga0495682_0000038
751 Ga0495682_0002402
752 Ga0495682_0025197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

41

272

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6onp-assembly1.cif.gz_A crystal structure of periplasmic binding protein xoxj from methylobacterium extorquens am1 0.8344 30 249
6onp-assembly1.cif.gz_A crystal structure of periplasmic binding protein xoxj from methylobacterium extorquens am1 0.8232 30 249
5sv6-assembly1.cif.gz_A crystal structure of mxaj from methlophaga aminisulfidivorans mpt 0.8206 30 248
5tuj-assembly1.cif.gz_C ancestral cationic amino acid solute binding protein (anccdt-1) 0.7743 29 244
7a99-assembly1.cif.gz_A crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp 0.7558 30 234
ID Description Score Start End Superfamily
5hmtA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8015 29 249 3.40.190.10
3mplA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8004 24 243 3.40.190.10
2y7iB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7902 27 242 3.40.190.10
3i6vA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7895 30 243 3.40.190.10
5orgB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7783 29 242 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2S5QBJ9-F1-model_v4 ABC transporter substrate-binding protein 0.97 29 94
AF-A0A2K8UJ96-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.9573 30 122
AF-A0A836WZJ8-F1-model_v4 Quinoprotein dehydrogenase-associated putative ABC transporter substrate-binding protein 0.957 29 123
AF-A0A2V9Z4A1-F1-model_v4 Quinoprotein dehydrogenase-associated putative ABC transporter substrate-binding protein 0.9322 25 123
AF-A0A7W1D9T6-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.9306 26 96 GO:0016020

Map