F427416

General Info

Members Datasets Scaffolds Average Seq Length
376 152 752 118

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0104535|Ga0395905_0104535_1328_1693
Length 108
Sequence LSLSDWRSSRTARAVFWTAACFAFVMAVLPHHIIAFATLAILGSFAYPFAGLLRLLAGLSLFGALIEFAQEIPALHRDSDIVDWIADTLTAGLVLMIVXXXRSRSNAG

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
125 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
126 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 5.59
Rhizosphere 93.62
Stem 0
Stem Tuber 0
Unclassified 5.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0104535 3300037471 Bacteria 2659
2 JGI24741J21665_1004791 3300001915 Bacteria 2936
3 JGI24740J21852_10003386 3300001979 Bacteria 7020
4 JGI24740J21852_10004173 3300001979 Bacteria 6238
5 JGI24740J21852_10037501 3300001979 Bacteria 1496
6 JGI24737J22298_10018822 3300001990 Bacteria 2212
7 JGI24735J21928_10016589 3300002067 Bacteria 2283
8 Ga0070658_10023751 3300005327 Bacteria 4917
9 Ga0070658_10063011 3300005327 Bacteria 3022
10 Ga0070658_10104587 3300005327 Bacteria 2342
11 Ga0070676_10356019 3300005328 Bacteria 1007
12 Ga0070683_100012511 3300005329 Bacteria 7376
13 Ga0070683_100017485 3300005329 Bacteria 6338
14 Ga0070683_100575707 3300005329 Bacteria 1077
15 Ga0070670_100022846 3300005331 Bacteria 5382
16 Ga0070670_100051925 3300005331 Bacteria 3520
17 Ga0068869_100556676 3300005334 Bacteria 964
18 Ga0070666_10017408 3300005335 Bacteria 4607
19 Ga0070666_10105460 3300005335 Bacteria 1947
20 Ga0070680_100007626 3300005336 Bacteria 8253
21 Ga0070680_100010857 3300005336 Bacteria 7035
22 Ga0070682_100009961 3300005337 Bacteria 5384
23 Ga0068868_100161285 3300005338 Bacteria 1852
24 Ga0068868_100861789 3300005338 Bacteria 821
25 Ga0070660_100004030 3300005339 Bacteria 10144
26 Ga0070660_100009815 3300005339 Bacteria 6748
27 Ga0070660_100025704 3300005339 Bacteria 4378
28 Ga0070660_100029109 3300005339 Bacteria 4136
29 Ga0070660_100054926 3300005339 Bacteria 3077
30 Ga0070660_100083435 3300005339 Bacteria 2510
31 Ga0070660_100134119 3300005339 Bacteria 1983
32 Ga0070660_100332877 3300005339 Bacteria 1249
33 Ga0070691_10008706 3300005341 Bacteria 4646
34 Ga0070687_100486530 3300005343 Bacteria 828
35 Ga0070661_100008814 3300005344 Bacteria 6982
36 Ga0070661_100202562 3300005344 Bacteria 1517
37 Ga0070661_100254497 3300005344 Unclassified 1356
38 Ga0070661_100618619 3300005344 Bacteria 877
39 Ga0070661_100932770 3300005344 Bacteria 718
40 Ga0070692_10006719 3300005345 Bacteria 5012
41 Ga0070668_100056466 3300005347 Bacteria 3032
42 Ga0070668_100534869 3300005347 Bacteria 1018
43 Ga0070669_100263875 3300005353 Bacteria 1375
44 Ga0070671_100094371 3300005355 Bacteria 2507
45 Ga0070673_100004701 3300005364 Bacteria 8666
46 Ga0070673_100010731 3300005364 Bacteria 6214
47 Ga0070659_100004278 3300005366 Bacteria 10190
48 Ga0070659_100062833 3300005366 Bacteria 2936
49 Ga0070659_101301405 3300005366 Bacteria 644
50 Ga0070659_101800054 3300005366 Bacteria 548
51 Ga0070663_100017589 3300005455 Bacteria 4669
52 Ga0070663_100055937 3300005455 Bacteria 2826
53 Ga0070663_100077427 3300005455 Bacteria 2434
54 Ga0070662_100051913 3300005457 Bacteria 2962
55 Ga0070662_100282396 3300005457 Bacteria 1344
56 Ga0070662_100283384 3300005457 Bacteria 1342
57 Ga0070662_100723488 3300005457 Bacteria 843
58 Ga0070681_10062306 3300005458 Bacteria 3703
59 Ga0070681_10078833 3300005458 Bacteria 3251
60 Ga0070681_10893934 3300005458 Bacteria 806
61 Ga0068867_100080367 3300005459 Bacteria 2455
62 Ga0068867_101383289 3300005459 Unclassified 652
63 Ga0070679_100003115 3300005530 Bacteria 15159
64 Ga0070684_100008699 3300005535 Bacteria 7958
65 Ga0070684_100218460 3300005535 Bacteria 1739
66 Ga0068853_100011549 3300005539 Bacteria 7179
67 Ga0068853_100113106 3300005539 Bacteria 2413
68 Ga0068853_100687367 3300005539 Bacteria 975
69 Ga0068853_100796972 3300005539 Bacteria 905
70 Ga0070672_100054694 3300005543 Bacteria 3126
71 Ga0070672_100534051 3300005543 Unclassified 1017
72 Ga0070693_100065915 3300005547 Bacteria 2118
73 Ga0070665_100019486 3300005548 Bacteria 6810
74 Ga0070665_100204978 3300005548 Bacteria 1973
75 Ga0068855_100046390 3300005563 Bacteria 5137
76 Ga0068855_100546312 3300005563 Bacteria 1254
77 Ga0068855_101023842 3300005563 Bacteria 866
78 Ga0068855_101973172 3300005563 Unclassified 590
79 Ga0070664_100002900 3300005564 Bacteria 13875
80 Ga0070664_100033459 3300005564 Bacteria 4306
81 Ga0070664_100038261 3300005564 Bacteria 4037
82 Ga0070664_100138613 3300005564 Bacteria 2140
83 Ga0070664_100430435 3300005564 Bacteria 1209
84 Ga0068857_100034051 3300005577 Bacteria 4507
85 Ga0068857_100061389 3300005577 Bacteria 3339
86 Ga0068857_100084903 3300005577 Bacteria 2829
87 Ga0068857_100349189 3300005577 Bacteria 1370
88 Ga0068857_100865797 3300005577 Bacteria 865
89 Ga0068854_100007647 3300005578 Bacteria 6912
90 Ga0068854_101078750 3300005578 Bacteria 714
91 Ga0068856_100033877 3300005614 Bacteria 5001
92 Ga0068856_100286093 3300005614 Bacteria 1665
93 Ga0068856_101378871 3300005614 Bacteria 720
94 Ga0068856_102039090 3300005614 Bacteria 584
95 Ga0068856_102401269 3300005614 Bacteria 535
96 Ga0068852_100099580 3300005616 Bacteria 2620
97 Ga0068852_100232022 3300005616 Bacteria 1759
98 Ga0068852_100644887 3300005616 Bacteria 1066
99 Ga0068852_101003275 3300005616 Bacteria 853
100 Ga0068852_102034414 3300005616 Unclassified 596
101 Ga0068851_10417492 3300005834 Bacteria 792
102 Ga0068851_10449942 3300005834 Unclassified 765
103 Ga0068870_11083034 3300005840 Unclassified 575
104 Ga0068863_100003331 3300005841 Bacteria 15870
105 Ga0068863_100023777 3300005841 Bacteria 5846
106 Ga0068858_100019682 3300005842 Bacteria 6311
107 Ga0068871_100748540 3300006358 Bacteria 898
108 Ga0105240_10015535 3300009093 Bacteria 10350
109 Ga0105245_10578597 3300009098 Bacteria 1147
110 Ga0105243_11326135 3300009148 Bacteria 738
111 Ga0105241_10545094 3300009174 Bacteria 1041
112 Ga0105241_12147588 3300009174 Bacteria 553
113 Ga0105242_11788792 3300009176 Bacteria 653
114 Ga0105242_13184536 3300009176 Unclassified 509
115 Ga0105248_10006373 3300009177 Bacteria 12948
116 Ga0105248_10045098 3300009177 Bacteria 4944
117 Ga0105237_10046565 3300009545 Bacteria 4362
118 Ga0105238_10015208 3300009551 Bacteria 7791
119 Ga0105238_10022690 3300009551 Bacteria 6397
120 Ga0105238_10612274 3300009551 Bacteria 1097
121 Ga0105239_10960750 3300010375 Bacteria 982
122 Ga0105246_10199842 3300011119 Bacteria 1553
123 Ga0157327_1017300 3300012512 Bacteria 773
124 Ga0157373_10004720 3300013100 Bacteria 10245
125 Ga0157373_10081919 3300013100 Bacteria 2275
126 Ga0157373_10171933 3300013100 Bacteria 1524
127 Ga0157373_10243323 3300013100 Bacteria 1272
128 Ga0157373_10252135 3300013100 Bacteria 1248
129 Ga0157373_10379151 3300013100 Bacteria 1011
130 Ga0157373_10914586 3300013100 Bacteria 651
131 Ga0157371_10231282 3300013102 Bacteria 1329
132 Ga0157371_11516508 3300013102 Bacteria 523
133 Ga0157370_10013215 3300013104 Bacteria 8512
134 Ga0157370_10020840 3300013104 Bacteria 6541
135 Ga0157370_10023532 3300013104 Bacteria 6113
136 Ga0157370_10513881 3300013104 Bacteria 1100
137 Ga0157370_12032985 3300013104 Unclassified 515
138 Ga0157369_10054591 3300013105 Bacteria 4315
139 Ga0157369_10063471 3300013105 Bacteria 3979
140 Ga0157369_10364811 3300013105 Bacteria 1499
141 Ga0157369_10481979 3300013105 Bacteria 1284
142 Ga0157369_10674150 3300013105 Bacteria 1065
143 Ga0157369_11024321 3300013105 Bacteria 845
144 Ga0157369_11733045 3300013105 Bacteria 635
145 Ga0157374_10018302 3300013296 Bacteria 6181
146 Ga0157374_10022233 3300013296 Bacteria 5656
147 Ga0163162_10082649 3300013306 Bacteria 3284
148 Ga0157372_10026347 3300013307 Bacteria 6326
149 Ga0157372_10194061 3300013307 Bacteria 2352
150 Ga0157372_10604186 3300013307 Bacteria 1278
151 Ga0157372_10831158 3300013307 Bacteria 1072
152 Ga0157372_13151568 3300013307 Bacteria 526
153 Ga0157375_10010935 3300013308 Bacteria 8004
154 Ga0157375_10144009 3300013308 Bacteria 2512
155 Ga0157375_10411739 3300013308 Bacteria 1518
156 Ga0163163_10067836 3300014325 Bacteria 3548
157 Ga0182008_10018087 3300014497 Bacteria 3651
158 Ga0157377_10071694 3300014745 Bacteria 2004
159 Ga0206356_11815184 3300020070 Bacteria 1002
160 Ga0206353_11164105 3300020082 Unclassified 603
161 Ga0207656_10012272 3300025321 Bacteria 3255
162 Ga0207656_10376300 3300025321 Bacteria 711
163 Ga0207680_10175926 3300025903 Bacteria 1444
164 Ga0207680_10368213 3300025903 Bacteria 1011
165 Ga0207647_10003878 3300025904 Bacteria 11181
166 Ga0207647_10004709 3300025904 Bacteria 10102
167 Ga0207647_10038092 3300025904 Bacteria 3043
168 Ga0207647_10039892 3300025904 Bacteria 2960
169 Ga0207647_10059538 3300025904 Bacteria 2337
170 Ga0207705_10027368 3300025909 Bacteria 4067
171 Ga0207705_10027617 3300025909 Bacteria 4047
172 Ga0207705_10031876 3300025909 Bacteria 3765
173 Ga0207705_10044200 3300025909 Bacteria 3201
174 Ga0207705_10109447 3300025909 Bacteria 2040
175 Ga0207705_10132286 3300025909 Bacteria 1857
176 Ga0207705_10138272 3300025909 Bacteria 1817
177 Ga0207705_10170988 3300025909 Bacteria 1636
178 Ga0207705_10457193 3300025909 Bacteria 990
179 Ga0207707_10058038 3300025912 Bacteria 3368
180 Ga0207707_10131196 3300025912 Bacteria 2191
181 Ga0207707_10154334 3300025912 Bacteria 2008
182 Ga0207695_10009301 3300025913 Bacteria 12160
183 Ga0207671_10271102 3300025914 Bacteria 1337
184 Ga0207660_10007208 3300025917 Bacteria 7197
185 Ga0207660_10195455 3300025917 Bacteria 1577
186 Ga0207660_10722261 3300025917 Bacteria 813
187 Ga0207660_10775855 3300025917 Bacteria 782
188 Ga0207657_10000856 3300025919 Bacteria 32149
189 Ga0207657_10011459 3300025919 Bacteria 8803
190 Ga0207657_10025133 3300025919 Bacteria 5498
191 Ga0207657_10040078 3300025919 Bacteria 4154
192 Ga0207657_10044683 3300025919 Bacteria 3893
193 Ga0207657_10052113 3300025919 Bacteria 3553
194 Ga0207657_10061796 3300025919 Bacteria 3210
195 Ga0207657_10456427 3300025919 Bacteria 1002
196 Ga0207657_10500173 3300025919 Bacteria 952
197 Ga0207657_11398034 3300025919 Bacteria 526
198 Ga0207649_10032608 3300025920 Bacteria 3107
199 Ga0207649_10090039 3300025920 Bacteria 2007
200 Ga0207649_10184736 3300025920 Bacteria 1462
201 Ga0207649_10274904 3300025920 Bacteria 1222
202 Ga0207649_10395030 3300025920 Bacteria 1033
203 Ga0207649_11180382 3300025920 Unclassified 605
204 Ga0207652_10047862 3300025921 Bacteria 3653
205 Ga0207652_10049330 3300025921 Bacteria 3603
206 Ga0207652_10628095 3300025921 Bacteria 962
207 Ga0207652_10635570 3300025921 Bacteria 955
208 Ga0207681_10960818 3300025923 Bacteria 716
209 Ga0207694_10036393 3300025924 Bacteria 3778
210 Ga0207694_11530019 3300025924 Bacteria 563
211 Ga0207650_10014335 3300025925 Bacteria 5510
212 Ga0207650_10071721 3300025925 Bacteria 2606
213 Ga0207644_10078357 3300025931 Bacteria 2435
214 Ga0207644_10218464 3300025931 Bacteria 1510
215 Ga0207690_10008435 3300025932 Bacteria 6117
216 Ga0207690_10017430 3300025932 Bacteria 4383
217 Ga0207690_10191690 3300025932 Bacteria 1546
218 Ga0207690_10734959 3300025932 Bacteria 813
219 Ga0207706_10002707 3300025933 Bacteria 17263
220 Ga0207706_10025573 3300025933 Bacteria 5288
221 Ga0207706_10032563 3300025933 Bacteria 4641
222 Ga0207706_10036565 3300025933 Bacteria 4362
223 Ga0207706_10446516 3300025933 Bacteria 1119
224 Ga0207706_10484246 3300025933 Bacteria 1069
225 Ga0207686_10872102 3300025934 Bacteria 725
226 Ga0207669_10284435 3300025937 Bacteria 1249
227 Ga0207691_10002422 3300025940 Bacteria 18263
228 Ga0207691_11427720 3300025940 Bacteria 568
229 Ga0207711_10018302 3300025941 Bacteria 5823
230 Ga0207711_10374125 3300025941 Bacteria 1321
231 Ga0207661_10071929 3300025944 Bacteria 2828
232 Ga0207661_11132370 3300025944 Bacteria 720
233 Ga0207661_11163348 3300025944 Bacteria 710
234 Ga0207679_10054446 3300025945 Bacteria 2945
235 Ga0207679_10219434 3300025945 Bacteria 1599
236 Ga0207679_10500266 3300025945 Bacteria 1084
237 Ga0207679_10709203 3300025945 Bacteria 913
238 Ga0207679_10913732 3300025945 Bacteria 803
239 Ga0207667_10016675 3300025949 Bacteria 8292
240 Ga0207667_10149462 3300025949 Bacteria 2404
241 Ga0207667_10193591 3300025949 Bacteria 2086
242 Ga0207667_10736323 3300025949 Bacteria 986
243 Ga0207651_10045770 3300025960 Bacteria 2937
244 Ga0207651_10184179 3300025960 Bacteria 1659
245 Ga0207651_10355697 3300025960 Unclassified 1234
246 Ga0207668_10192771 3300025972 Bacteria 1616
247 Ga0207668_10485563 3300025972 Bacteria 1060
248 Ga0207640_10002013 3300025981 Bacteria 10971
249 Ga0207640_10144147 3300025981 Bacteria 1740
250 Ga0207658_10072462 3300025986 Bacteria 2611
251 Ga0207658_10227749 3300025986 Bacteria 1572
252 Ga0207677_10042542 3300026023 Bacteria 3013
253 Ga0207703_10351702 3300026035 Bacteria 1357
254 Ga0207639_10045089 3300026041 Bacteria 3319
255 Ga0207639_10238025 3300026041 Bacteria 1581
256 Ga0207639_11089988 3300026041 Bacteria 749
257 Ga0207678_10022461 3300026067 Bacteria 5524
258 Ga0207678_10110211 3300026067 Bacteria 2348
259 Ga0207678_10123319 3300026067 Bacteria 2211
260 Ga0207678_10698810 3300026067 Bacteria 892
261 Ga0207678_10699473 3300026067 Bacteria 892
262 Ga0207678_11397703 3300026067 Bacteria 619
263 Ga0207702_10013979 3300026078 Bacteria 6667
264 Ga0207702_10086640 3300026078 Bacteria 2732
265 Ga0207702_10175180 3300026078 Bacteria 1970
266 Ga0207702_10493395 3300026078 Bacteria 1193
267 Ga0207702_10592078 3300026078 Bacteria 1088
268 Ga0207641_10086713 3300026088 Bacteria 2730
269 Ga0207676_10257537 3300026095 Bacteria 1573
270 Ga0207674_10002976 3300026116 Bacteria 21037
271 Ga0207674_10007002 3300026116 Bacteria 13181
272 Ga0207674_10017301 3300026116 Bacteria 7866
273 Ga0207674_10261486 3300026116 Bacteria 1678
274 Ga0207683_10105552 3300026121 Bacteria 2518
275 Ga0207698_10002868 3300026142 Bacteria 10309
276 Ga0207698_10196791 3300026142 Bacteria 1801
277 Ga0207698_11477311 3300026142 Bacteria 695
278 Ga0268266_10018668 3300028379 Bacteria 5909
279 Ga0268264_10085214 3300028381 Bacteria 2712
280 Ga0307405_10124209 3300031731 Bacteria 1772
281 Ga0307405_10230150 3300031731 Bacteria 1366
282 Ga0307406_11030446 3300031901 Unclassified 707
283 Ga0307412_10081826 3300031911 Bacteria 2234
284 Ga0307409_100707407 3300031995 Bacteria 1007
285 Ga0307416_100001949 3300032002 Bacteria 11560
286 Ga0307411_10794160 3300032005 Bacteria 833
287 Ga0307415_100124643 3300032126 Bacteria 1939
288 Ga0373960_0158338 3300035121 Bacteria 778
289 Ga0395899_0001919 3300037312 Bacteria 17147
290 Ga0395899_0046459 3300037312 Bacteria 3234
291 Ga0395899_0113979 3300037312 Bacteria 1941
292 Ga0395899_0117545 3300037312 Bacteria 1907
293 Ga0395899_0172958 3300037312 Bacteria 1520
294 Ga0395899_0287492 3300037312 Bacteria 1116
295 Ga0395899_0534737 3300037312 Bacteria 755
296 Ga0395900_0001171 3300037418 Bacteria 32731
297 Ga0395900_0047236 3300037418 Bacteria 4432
298 Ga0395900_0116839 3300037418 Bacteria 2737
299 Ga0395900_0138483 3300037418 Bacteria 2493
300 Ga0395900_0235632 3300037418 Bacteria 1838
301 Ga0395900_0864439 3300037418 Bacteria 829
302 Ga0395900_1001496 3300037418 Bacteria 755
303 Ga0395898_0001741 3300037466 Bacteria 28718
304 Ga0395898_0001961 3300037466 Bacteria 25920
305 Ga0395898_0084931 3300037466 Bacteria 3051
306 Ga0395898_0087128 3300037466 Bacteria 3008
307 Ga0395898_0116341 3300037466 Bacteria 2562
308 Ga0395898_0162243 3300037466 Bacteria 2138
309 Ga0395898_1254230 3300037466 Bacteria 671
310 Ga0395898_1350658 3300037466 Unclassified 641
311 Ga0395905_0001079 3300037471 Bacteria 34311
312 Ga0395905_0005546 3300037471 Bacteria 12871
313 Ga0395905_0006325 3300037471 Bacteria 11937
314 Ga0395905_0011033 3300037471 Bacteria 8743
315 Ga0395905_0054498 3300037471 Bacteria 3742
316 Ga0395905_0063167 3300037471 Bacteria 3464
317 Ga0395905_0127466 3300037471 Bacteria 2393
318 Ga0395905_0131405 3300037471 Bacteria 2354
319 Ga0395905_0136197 3300037471 Bacteria 2310
320 Ga0395905_0224978 3300037471 Bacteria 1755
321 Ga0395905_0504895 3300037471 Bacteria 1109
322 Ga0395905_1024862 3300037471 Bacteria 728
323 Ga0395905_1069862 3300037471 Archaea 710
324 Ga0395901_0001340 3300038443 Bacteria 25815
325 Ga0395901_0005043 3300038443 Bacteria 13334
326 Ga0395901_0025621 3300038443 Bacteria 6055
327 Ga0395901_0161591 3300038443 Bacteria 2352
328 Ga0395901_0226774 3300038443 Unclassified 1951
329 Ga0395901_0325378 3300038443 Bacteria 1590
330 Ga0395901_1292673 3300038443 Bacteria 691
331 Ga0395901_2153115 3300038443 Bacteria 502
332 Ga0436365_1417856 3300039437 Bacteria 14894
333 Ga0436363_0142674 3300039450 Bacteria 3414
334 Ga0439455_0012613 3300042012 Bacteria 1901
335 Ga0439458_0002498 3300042157 Bacteria 4466
336 Ga0439464_0023786 3300042439 Bacteria 1692
337 Ga0466972_0106468 3300044658 Bacteria 1326
338 Ga0466966_0010964 3300044684 Bacteria 6016
339 Ga0466966_0014683 3300044684 Bacteria 5183
340 Ga0466961_0011411 3300044693 Bacteria 5683
341 Ga0466961_0199435 3300044693 Bacteria 1238
342 Ga0466970_0114398 3300044765 Bacteria 1475
343 Ga0466970_0518816 3300044765 Bacteria 687
344 Ga0466960_0428430 3300044901 Unclassified 766
345 Ga0466960_0573468 3300044901 Bacteria 668
346 Ga0466959_0127302 3300045049 Bacteria 1807
347 Ga0466959_0170476 3300045049 Bacteria 1526
348 Ga0466958_0214933 3300045836 Bacteria 1226
349 Ga0466967_0415955 3300045976 Unclassified 1310
350 Ga0496100_0027383 3300048903 Bacteria 3505
351 Ga0496101_0016587 3300048904 Bacteria 4980
352 Ga0496101_0617295 3300048904 Bacteria 857
353 Ga0496102_0295481 3300048905 Bacteria 1527
354 Ga0496102_0590140 3300048905 Bacteria 1034
355 Ga0496102_0986166 3300048905 Bacteria 763
356 Ga0496103_0200337 3300048906 Bacteria 1284
357 Ga0496106_0042063 3300048909 Bacteria 3426
358 Ga0496106_0794456 3300048909 Bacteria 751
359 Ga0496107_0044142 3300048910 Bacteria 3204
360 Ga0496107_0566450 3300048910 Bacteria 841
361 Ga0496108_0090085 3300048911 Bacteria 2607
362 Ga0496109_0247125 3300048912 Bacteria 1680
363 Ga0496109_0788452 3300048912 Unclassified 888
364 Ga0496110_0074688 3300048913 Bacteria 3011
365 Ga0496110_1183773 3300048913 Unclassified 673
366 Ga0496112_0107967 3300048915 Bacteria 2753
367 Ga0496112_0722968 3300048915 Bacteria 923
368 Ga0496113_1016591 3300048916 Unclassified 652
369 Ga0496114_0059906 3300048917 Bacteria 3181
370 Ga0496115_0243726 3300048918 Bacteria 1481
371 Ga0501067_0184609 3300049583 Bacteria 1161
372 Ga0501068_0234124 3300049584 Bacteria 1168
373 Ga0501069_0186202 3300049585 Bacteria 1201
374 Ga0501069_0218230 3300049585 Bacteria 1108
375 Ga0501243_020298 3300049675 Bacteria 1092
376 nmdc:mga0k408_191821_c1 3300050493 Bacteria 1219
377 Ga0395905_0104535
378 JGI24741J21665_1004791
379 JGI24740J21852_10003386
380 JGI24740J21852_10004173
381 JGI24740J21852_10037501
382 JGI24737J22298_10018822
383 JGI24735J21928_10016589
384 Ga0070658_10023751
385 Ga0070658_10063011
386 Ga0070658_10104587
387 Ga0070676_10356019
388 Ga0070683_100012511
389 Ga0070683_100017485
390 Ga0070683_100575707
391 Ga0070670_100022846
392 Ga0070670_100051925
393 Ga0068869_100556676
394 Ga0070666_10017408
395 Ga0070666_10105460
396 Ga0070680_100007626
397 Ga0070680_100010857
398 Ga0070682_100009961
399 Ga0068868_100161285
400 Ga0068868_100861789
401 Ga0070660_100004030
402 Ga0070660_100009815
403 Ga0070660_100025704
404 Ga0070660_100029109
405 Ga0070660_100054926
406 Ga0070660_100083435
407 Ga0070660_100134119
408 Ga0070660_100332877
409 Ga0070691_10008706
410 Ga0070687_100486530
411 Ga0070661_100008814
412 Ga0070661_100202562
413 Ga0070661_100254497
414 Ga0070661_100618619
415 Ga0070661_100932770
416 Ga0070692_10006719
417 Ga0070668_100056466
418 Ga0070668_100534869
419 Ga0070669_100263875
420 Ga0070671_100094371
421 Ga0070673_100004701
422 Ga0070673_100010731
423 Ga0070659_100004278
424 Ga0070659_100062833
425 Ga0070659_101301405
426 Ga0070659_101800054
427 Ga0070663_100017589
428 Ga0070663_100055937
429 Ga0070663_100077427
430 Ga0070662_100051913
431 Ga0070662_100282396
432 Ga0070662_100283384
433 Ga0070662_100723488
434 Ga0070681_10062306
435 Ga0070681_10078833
436 Ga0070681_10893934
437 Ga0068867_100080367
438 Ga0068867_101383289
439 Ga0070679_100003115
440 Ga0070684_100008699
441 Ga0070684_100218460
442 Ga0068853_100011549
443 Ga0068853_100113106
444 Ga0068853_100687367
445 Ga0068853_100796972
446 Ga0070672_100054694
447 Ga0070672_100534051
448 Ga0070693_100065915
449 Ga0070665_100019486
450 Ga0070665_100204978
451 Ga0068855_100046390
452 Ga0068855_100546312
453 Ga0068855_101023842
454 Ga0068855_101973172
455 Ga0070664_100002900
456 Ga0070664_100033459
457 Ga0070664_100038261
458 Ga0070664_100138613
459 Ga0070664_100430435
460 Ga0068857_100034051
461 Ga0068857_100061389
462 Ga0068857_100084903
463 Ga0068857_100349189
464 Ga0068857_100865797
465 Ga0068854_100007647
466 Ga0068854_101078750
467 Ga0068856_100033877
468 Ga0068856_100286093
469 Ga0068856_101378871
470 Ga0068856_102039090
471 Ga0068856_102401269
472 Ga0068852_100099580
473 Ga0068852_100232022
474 Ga0068852_100644887
475 Ga0068852_101003275
476 Ga0068852_102034414
477 Ga0068851_10417492
478 Ga0068851_10449942
479 Ga0068870_11083034
480 Ga0068863_100003331
481 Ga0068863_100023777
482 Ga0068858_100019682
483 Ga0068871_100748540
484 Ga0105240_10015535
485 Ga0105245_10578597
486 Ga0105243_11326135
487 Ga0105241_10545094
488 Ga0105241_12147588
489 Ga0105242_11788792
490 Ga0105242_13184536
491 Ga0105248_10006373
492 Ga0105248_10045098
493 Ga0105237_10046565
494 Ga0105238_10015208
495 Ga0105238_10022690
496 Ga0105238_10612274
497 Ga0105239_10960750
498 Ga0105246_10199842
499 Ga0157327_1017300
500 Ga0157373_10004720
501 Ga0157373_10081919
502 Ga0157373_10171933
503 Ga0157373_10243323
504 Ga0157373_10252135
505 Ga0157373_10379151
506 Ga0157373_10914586
507 Ga0157371_10231282
508 Ga0157371_11516508
509 Ga0157370_10013215
510 Ga0157370_10020840
511 Ga0157370_10023532
512 Ga0157370_10513881
513 Ga0157370_12032985
514 Ga0157369_10054591
515 Ga0157369_10063471
516 Ga0157369_10364811
517 Ga0157369_10481979
518 Ga0157369_10674150
519 Ga0157369_11024321
520 Ga0157369_11733045
521 Ga0157374_10018302
522 Ga0157374_10022233
523 Ga0163162_10082649
524 Ga0157372_10026347
525 Ga0157372_10194061
526 Ga0157372_10604186
527 Ga0157372_10831158
528 Ga0157372_13151568
529 Ga0157375_10010935
530 Ga0157375_10144009
531 Ga0157375_10411739
532 Ga0163163_10067836
533 Ga0182008_10018087
534 Ga0157377_10071694
535 Ga0206356_11815184
536 Ga0206353_11164105
537 Ga0207656_10012272
538 Ga0207656_10376300
539 Ga0207680_10175926
540 Ga0207680_10368213
541 Ga0207647_10003878
542 Ga0207647_10004709
543 Ga0207647_10038092
544 Ga0207647_10039892
545 Ga0207647_10059538
546 Ga0207705_10027368
547 Ga0207705_10027617
548 Ga0207705_10031876
549 Ga0207705_10044200
550 Ga0207705_10109447
551 Ga0207705_10132286
552 Ga0207705_10138272
553 Ga0207705_10170988
554 Ga0207705_10457193
555 Ga0207707_10058038
556 Ga0207707_10131196
557 Ga0207707_10154334
558 Ga0207695_10009301
559 Ga0207671_10271102
560 Ga0207660_10007208
561 Ga0207660_10195455
562 Ga0207660_10722261
563 Ga0207660_10775855
564 Ga0207657_10000856
565 Ga0207657_10011459
566 Ga0207657_10025133
567 Ga0207657_10040078
568 Ga0207657_10044683
569 Ga0207657_10052113
570 Ga0207657_10061796
571 Ga0207657_10456427
572 Ga0207657_10500173
573 Ga0207657_11398034
574 Ga0207649_10032608
575 Ga0207649_10090039
576 Ga0207649_10184736
577 Ga0207649_10274904
578 Ga0207649_10395030
579 Ga0207649_11180382
580 Ga0207652_10047862
581 Ga0207652_10049330
582 Ga0207652_10628095
583 Ga0207652_10635570
584 Ga0207681_10960818
585 Ga0207694_10036393
586 Ga0207694_11530019
587 Ga0207650_10014335
588 Ga0207650_10071721
589 Ga0207644_10078357
590 Ga0207644_10218464
591 Ga0207690_10008435
592 Ga0207690_10017430
593 Ga0207690_10191690
594 Ga0207690_10734959
595 Ga0207706_10002707
596 Ga0207706_10025573
597 Ga0207706_10032563
598 Ga0207706_10036565
599 Ga0207706_10446516
600 Ga0207706_10484246
601 Ga0207686_10872102
602 Ga0207669_10284435
603 Ga0207691_10002422
604 Ga0207691_11427720
605 Ga0207711_10018302
606 Ga0207711_10374125
607 Ga0207661_10071929
608 Ga0207661_11132370
609 Ga0207661_11163348
610 Ga0207679_10054446
611 Ga0207679_10219434
612 Ga0207679_10500266
613 Ga0207679_10709203
614 Ga0207679_10913732
615 Ga0207667_10016675
616 Ga0207667_10149462
617 Ga0207667_10193591
618 Ga0207667_10736323
619 Ga0207651_10045770
620 Ga0207651_10184179
621 Ga0207651_10355697
622 Ga0207668_10192771
623 Ga0207668_10485563
624 Ga0207640_10002013
625 Ga0207640_10144147
626 Ga0207658_10072462
627 Ga0207658_10227749
628 Ga0207677_10042542
629 Ga0207703_10351702
630 Ga0207639_10045089
631 Ga0207639_10238025
632 Ga0207639_11089988
633 Ga0207678_10022461
634 Ga0207678_10110211
635 Ga0207678_10123319
636 Ga0207678_10698810
637 Ga0207678_10699473
638 Ga0207678_11397703
639 Ga0207702_10013979
640 Ga0207702_10086640
641 Ga0207702_10175180
642 Ga0207702_10493395
643 Ga0207702_10592078
644 Ga0207641_10086713
645 Ga0207676_10257537
646 Ga0207674_10002976
647 Ga0207674_10007002
648 Ga0207674_10017301
649 Ga0207674_10261486
650 Ga0207683_10105552
651 Ga0207698_10002868
652 Ga0207698_10196791
653 Ga0207698_11477311
654 Ga0268266_10018668
655 Ga0268264_10085214
656 Ga0307405_10124209
657 Ga0307405_10230150
658 Ga0307406_11030446
659 Ga0307412_10081826
660 Ga0307409_100707407
661 Ga0307416_100001949
662 Ga0307411_10794160
663 Ga0307415_100124643
664 Ga0373960_0158338
665 Ga0395899_0001919
666 Ga0395899_0046459
667 Ga0395899_0113979
668 Ga0395899_0117545
669 Ga0395899_0172958
670 Ga0395899_0287492
671 Ga0395899_0534737
672 Ga0395900_0001171
673 Ga0395900_0047236
674 Ga0395900_0116839
675 Ga0395900_0138483
676 Ga0395900_0235632
677 Ga0395900_0864439
678 Ga0395900_1001496
679 Ga0395898_0001741
680 Ga0395898_0001961
681 Ga0395898_0084931
682 Ga0395898_0087128
683 Ga0395898_0116341
684 Ga0395898_0162243
685 Ga0395898_1254230
686 Ga0395898_1350658
687 Ga0395905_0001079
688 Ga0395905_0005546
689 Ga0395905_0006325
690 Ga0395905_0011033
691 Ga0395905_0054498
692 Ga0395905_0063167
693 Ga0395905_0127466
694 Ga0395905_0131405
695 Ga0395905_0136197
696 Ga0395905_0224978
697 Ga0395905_0504895
698 Ga0395905_1024862
699 Ga0395905_1069862
700 Ga0395901_0001340
701 Ga0395901_0005043
702 Ga0395901_0025621
703 Ga0395901_0161591
704 Ga0395901_0226774
705 Ga0395901_0325378
706 Ga0395901_1292673
707 Ga0395901_2153115
708 Ga0436365_1417856
709 Ga0436363_0142674
710 Ga0439455_0012613
711 Ga0439458_0002498
712 Ga0439464_0023786
713 Ga0466972_0106468
714 Ga0466966_0010964
715 Ga0466966_0014683
716 Ga0466961_0011411
717 Ga0466961_0199435
718 Ga0466970_0114398
719 Ga0466970_0518816
720 Ga0466960_0428430
721 Ga0466960_0573468
722 Ga0466959_0127302
723 Ga0466959_0170476
724 Ga0466958_0214933
725 Ga0466967_0415955
726 Ga0496100_0027383
727 Ga0496101_0016587
728 Ga0496101_0617295
729 Ga0496102_0295481
730 Ga0496102_0590140
731 Ga0496102_0986166
732 Ga0496103_0200337
733 Ga0496106_0042063
734 Ga0496106_0794456
735 Ga0496107_0044142
736 Ga0496107_0566450
737 Ga0496108_0090085
738 Ga0496109_0247125
739 Ga0496109_0788452
740 Ga0496110_0074688
741 Ga0496110_1183773
742 Ga0496112_0107967
743 Ga0496112_0722968
744 Ga0496113_1016591
745 Ga0496114_0059906
746 Ga0496115_0243726
747 Ga0501067_0184609
748 Ga0501068_0234124
749 Ga0501069_0186202
750 Ga0501069_0218230
751 Ga0501243_020298
752 nmdc:mga0k408_191821_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qqe-assembly1.cif.gz_A crystal structure of the vesicular transport protein sec17 0.4749 16 83
2odm-assembly1.cif.gz_B crystal structure of s. aureus ylan, an essential leucine rich protein involved in the control of cell shape 0.4444 17 118
7e2d-assembly1.cif.gz_I monomer of trappii (closed) 0.4414 13 109
2odm-assembly1.cif.gz_B crystal structure of s. aureus ylan, an essential leucine rich protein involved in the control of cell shape 0.4361 17 118
8ccr-assembly1.cif.gz_A crystal structure of the t19d mutant of the de novo diheme binding 4d2 0.4301 9 109
ID Description Score Start End Superfamily
af_O13689_1_162_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.779 10 117 1.20.1270.60
af_O13689_1_162_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.716 10 117 1.20.1270.60
af_P53202_144_265_1.20.1310.10 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Cullin Repeats 0.5444 16 108 1.20.1310.10
af_Q8IBE8_457_624_1.20.1310.20 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like;Duffy-antigen binding domain 0.522 42 111 1.20.1310.20
af_A4IBX9_77_174_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4972 11 113 1.25.40.10
ID Description Score Start End GO Terms
AF-F6IIF0-F1-model_v4 VanZ-like domain-containing protein 0.9577 10 116 GO:0016020
AF-A0A1X7H2R4-F1-model_v4 VanZ family protein 0.9454 16 116 GO:0016020
AF-A0A3B7E1F3-F1-model_v4 deleted 0.9446 39 117
AF-A0A349TE40-F1-model_v4 VanZ-like domain-containing protein 0.9397 11 116 GO:0016020
AF-A0A1B2ADS1-F1-model_v4 VanZ like family protein 0.9388 26 112 GO:0016020

Map